Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1037.32singletonON30330313690.0
Kpol_1059.3singletonON30330313290.0
Kpol_1035.3singletonON113030113391e-177
Kpol_2000.35singletonON70432210121e-133
NCAS0C05600singletonON4453366613e-83
Kpol_1031.7singletonON16653026892e-81
Kpol_298.3singletonON16673136751e-79
Kpol_1036.100singletonON8333045972e-70
KNAG0E01570singletonON3813074781e-56
NCAS0G02330singletonON6571374634e-52
Kpol_541.1singletonON3751433901e-43
Kpol_1024.8singletonON2091962453e-24
NCAS0A09620singletonON68631821e-16
Kpol_544.2singletonON2921751845e-15
Kpol_250.3singletonON219431798e-15
NDAI0C03530singletonON12631261372e-08
NDAI0K00353singletonON12491261372e-08
NDAI0C01570singletonON12471261372e-08
Ecym_5175singletonON14101451345e-08
Kpol_1048.75singletonON12331521292e-07
NDAI0A04060singletonON12031621221e-06
Kpol_1031.4singletonON10631491221e-06
NDAI0G03370singletonON8521621212e-06
Skud_15.511singletonON7161421193e-06
NDAI0G04700singletonON12551621175e-06
YIL080WsingletonOFF15741431151e-05
NDAI0I02500singletonON3861201103e-05
KNAG0E03490singletonON8361471104e-05
Kpol_222.2singletonON7501491095e-05
Kwal_23.5250singletonON9021411078e-05
Kwal_26.8300singletonON9021411078e-05
Kwal_56.22670singletonON6761411079e-05
KAFR0F01500singletonON7951421015e-04
TDEL0C06480singletonON13741221006e-04
CAGL0G07183g2singletonON15041491008e-04
TBLA0A00520singletonON254100920.004
NCAS0H03510singletonON1220145880.019
NCAS0A05290singletonON926145880.021
TBLA0C03820singletonON72994840.050
TBLA0B06850singletonON430142830.075
Suva_16.1978.601ON40064750.61
TDEL0D052303.101ON71249684.4
CAGL0F03245g5.368ON103665668.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1037.32
         (303 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1037.32 s1037 (77327..78238) [912 bp, 303 aa] {ON} (77327.....   531   0.0  
Kpol_1059.3 s1059 (2209..3120) [912 bp, 303 aa] {ON} (2209..3120...   516   0.0  
Kpol_1035.3 s1035 complement(5707..9099) [3393 bp, 1130 aa] {ON}...   520   e-177
Kpol_2000.35 s2000 complement(68315..70429) [2115 bp, 704 aa] {O...   394   e-133
NCAS0C05600 Chr3 complement(1136016..1137353) [1338 bp, 445 aa] ...   259   3e-83
Kpol_1031.7 s1031 (14919..19916) [4998 bp, 1665 aa] {ON} (14919....   270   2e-81
Kpol_298.3 s298 (6306..11309) [5004 bp, 1667 aa] {ON} (6306..113...   264   1e-79
Kpol_1036.100 s1036 (259603..261150,261154..262107) [2502 bp, 83...   234   2e-70
KNAG0E01570 Chr5 (313977..315122) [1146 bp, 381 aa] {ON}              188   1e-56
NCAS0G02330 Chr7 complement(413199..415172) [1974 bp, 657 aa] {O...   182   4e-52
Kpol_541.1 s541 (1906..2055,2059..2121,3029..3775,3779..3943) [1...   154   1e-43
Kpol_1024.8 s1024 (32074..32703) [630 bp, 209 aa] {ON} (32074..3...    99   3e-24
NCAS0A09620 Chr1 complement(1923028..1923234) [207 bp, 68 aa] {O...    75   1e-16
Kpol_544.2 s544 complement(3985..4863) [879 bp, 292 aa] {ON} com...    75   5e-15
Kpol_250.3 s250 complement(6333..6992) [660 bp, 219 aa] {ON} com...    74   8e-15
NDAI0C03530 Chr3 (806284..810075) [3792 bp, 1263 aa] {ON}              57   2e-08
NDAI0K00353 Chr11 complement(70340..74089) [3750 bp, 1249 aa] {ON}     57   2e-08
NDAI0C01570 Chr3 (334303..338046) [3744 bp, 1247 aa] {ON}              57   2e-08
Ecym_5175 Chr5 (360152..364384) [4233 bp, 1410 aa] {ON} Similar ...    56   5e-08
Kpol_1048.75 s1048 (214263..217964) [3702 bp, 1233 aa] {ON} (214...    54   2e-07
NDAI0A04060 Chr1 (914708..918319) [3612 bp, 1203 aa] {ON}              52   1e-06
Kpol_1031.4 s1031 (9817..13008) [3192 bp, 1063 aa] {ON} (9817..1...    52   1e-06
NDAI0G03370 Chr7 complement(802196..804754) [2559 bp, 852 aa] {O...    51   2e-06
Skud_15.511 Chr15 (914024..916174) [2151 bp, 716 aa] {ON} YPL060...    50   3e-06
NDAI0G04700 Chr7 complement(1121097..1124864) [3768 bp, 1255 aa]...    50   5e-06
YIL080W Chr9 (205635..206484,206486..210357) [4722 bp, 1574 aa] ...    49   1e-05
NDAI0I02500 Chr9 (576038..577198) [1161 bp, 386 aa] {ON}               47   3e-05
KNAG0E03490 Chr5 (696203..698713) [2511 bp, 836 aa] {ON}  probab...    47   4e-05
Kpol_222.2 s222 complement(1263..2024,2028..2141,2145..2762,2766...    47   5e-05
Kwal_23.5250 s23 complement(1075954..1078662) [2709 bp, 902 aa] ...    46   8e-05
Kwal_26.8300 s26 (729038..731746) [2709 bp, 902 aa] {ON} YGR109W...    46   8e-05
Kwal_56.22670 s56 complement(228050..230080) [2031 bp, 676 aa] {...    46   9e-05
KAFR0F01500 Chr6 (294389..296776) [2388 bp, 795 aa] {ON}               44   5e-04
TDEL0C06480 Chr3 (1185928..1186584,1186586..1190053) [4125 bp, 1...    43   6e-04
CAGL0G07183g2 Chr7 complement(678730..682425,682425..683243) [45...    43   8e-04
TBLA0A00520 Chr1 (101637..102401) [765 bp, 254 aa] {ON}                40   0.004
NCAS0H03510 Chr8 (662442..666104) [3663 bp, 1220 aa] {ON}              39   0.019
NCAS0A05290 Chr1 complement(1047369..1050149) [2781 bp, 926 aa] ...    39   0.021
TBLA0C03820 Chr3 complement(914866..917055) [2190 bp, 729 aa] {O...    37   0.050
TBLA0B06850 Chr2 (1616713..1618005) [1293 bp, 430 aa] {ON}             37   0.075
Suva_16.197 Chr16 complement(346987..348189) [1203 bp, 400 aa] {...    33   0.61 
TDEL0D05230 Chr4 (948928..951066) [2139 bp, 712 aa] {ON} Anc_3.1...    31   4.4  
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    30   8.6  

>Kpol_1037.32 s1037 (77327..78238) [912 bp, 303 aa] {ON}
           (77327..78238) [912 nt, 304 aa]
          Length = 303

 Score =  531 bits (1369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/303 (88%), Positives = 268/303 (88%)

Query: 1   SFKQLITRSLTLKLFDPQALTIIFSDASLKGGASIILQPEVHNNKTLLFPISFLSVRFNP 60
           SFKQLITRSLTLKLFDPQALTIIFSDASLKGGASIILQPEVHNNKTLLFPISFLSVRFNP
Sbjct: 1   SFKQLITRSLTLKLFDPQALTIIFSDASLKGGASIILQPEVHNNKTLLFPISFLSVRFNP 60

Query: 61  TQQRYSTVERELFSVLPALNKGELLLSPDVTVYTDNKGIISIGNSDRNTHPRFTKYLDLV 120
           TQQRYSTVERELFSVLPALNKGELLLSPDVTVYTDNKGIISIGNSDRNTHPRFTKYLDLV
Sbjct: 61  TQQRYSTVERELFSVLPALNKGELLLSPDVTVYTDNKGIISIGNSDRNTHPRFTKYLDLV 120

Query: 121 NGHRVKWKYLPGAKNLLADYLSRFGLDDQPYLDLEQLQQFAVDIPTSNLTLLXXXXXXXX 180
           NGHRVKWKYLPGAKNLLADYLSRFGLDDQPYLDLEQLQQFAVDIPTSNLTLL        
Sbjct: 121 NGHRVKWKYLPGAKNLLADYLSRFGLDDQPYLDLEQLQQFAVDIPTSNLTLLSADSDAET 180

Query: 181 XXXXXXXXXXXXXXSDNTTDPDYVIDNVNSLTLSQLLEIQKLLADXXXXXXXXXXXXXDR 240
                         SDNTTDPDYVIDNVNSLTLSQLLEIQKLLAD             DR
Sbjct: 181 SSTTNPEPSTEAPNSDNTTDPDYVIDNVNSLTLSQLLEIQKLLADKISSIPPIFSKIIDR 240

Query: 241 FYYTSGNLYINMDSILFRVVIDKDYMDVATKLHALYHCTHRVLQLAMADEKLWNPNSNLL 300
           FYYTSGNLYINMDSILFRVVIDKDYMDVATKLHALYHCTHRVLQLAMADEKLWNPNSNLL
Sbjct: 241 FYYTSGNLYINMDSILFRVVIDKDYMDVATKLHALYHCTHRVLQLAMADEKLWNPNSNLL 300

Query: 301 LLV 303
           LLV
Sbjct: 301 LLV 303

>Kpol_1059.3 s1059 (2209..3120) [912 bp, 303 aa] {ON} (2209..3120)
           [912 nt, 304 aa]
          Length = 303

 Score =  516 bits (1329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/303 (86%), Positives = 263/303 (86%)

Query: 1   SFKQLITRSLTLKLFDPQALTIIFSDASLKGGASIILQPEVHNNKTLLFPISFLSVRFNP 60
           SFKQLITRSLTLKLFDPQALTIIFSDASLKGGASIILQPEVHNNKTLLFPISFLSVRFNP
Sbjct: 1   SFKQLITRSLTLKLFDPQALTIIFSDASLKGGASIILQPEVHNNKTLLFPISFLSVRFNP 60

Query: 61  TQQRYSTVERELFSVLPALNKGELLLSPDVTVYTDNKGIISIGNSDRNTHPRFTKYLDLV 120
           TQQRYSTVERELFSVLPALNKGELLLSPDVTVYTDNKGIISIGNSDRNTHPRFTKYLDLV
Sbjct: 61  TQQRYSTVERELFSVLPALNKGELLLSPDVTVYTDNKGIISIGNSDRNTHPRFTKYLDLV 120

Query: 121 NGHRVKWKYLPGAKNLLADYLSRFGLDDQPYLDLEQLQQFAVDIPTSNLTLLXXXXXXXX 180
           NGHRVKWKYLPGAKNLLADYLSRFGLDDQPYLDLEQLQQF VDIP S+LTLL        
Sbjct: 121 NGHRVKWKYLPGAKNLLADYLSRFGLDDQPYLDLEQLQQFTVDIPLSHLTLLSADSDVAP 180

Query: 181 XXXXXXXXXXXXXXSDNTTDPDYVIDNVNSLTLSQLLEIQKLLADXXXXXXXXXXXXXDR 240
                         SDN TDPDYVI NVNSLTL QLLEIQ+LLAD             DR
Sbjct: 181 SSTTNPEPSTEAPNSDNPTDPDYVIQNVNSLTLPQLLEIQQLLADKISSAPPIFSKIIDR 240

Query: 241 FYYTSGNLYINMDSILFRVVIDKDYMDVATKLHALYHCTHRVLQLAMADEKLWNPNSNLL 300
           FYYTSGNLYINMDSILFRVVIDKDYMDVATKLHALYHCTHRVLQLAMADEKLWNPNSNLL
Sbjct: 241 FYYTSGNLYINMDSILFRVVIDKDYMDVATKLHALYHCTHRVLQLAMADEKLWNPNSNLL 300

Query: 301 LLV 303
           LLV
Sbjct: 301 LLV 303

>Kpol_1035.3 s1035 complement(5707..9099) [3393 bp, 1130 aa] {ON}
           complement(5707..9099) [3393 nt, 1131 aa]
          Length = 1130

 Score =  520 bits (1339), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 263/301 (87%), Positives = 263/301 (87%)

Query: 2   FKQLITRSLTLKLFDPQALTIIFSDASLKGGASIILQPEVHNNKTLLFPISFLSVRFNPT 61
           FKQLITRSLTLKLFDPQA TIIFSDASLKGGASIILQPEVHNN TLLFPISFLSVRFNPT
Sbjct: 495 FKQLITRSLTLKLFDPQAPTIIFSDASLKGGASIILQPEVHNNTTLLFPISFLSVRFNPT 554

Query: 62  QQRYSTVERELFSVLPALNKGELLLSPDVTVYTDNKGIISIGNSDRNTHPRFTKYLDLVN 121
           QQRYSTVERELFSVL ALNKGELLLSPDVTVYTDNKGIISIGNSDRNTHPRFTKYLDLVN
Sbjct: 555 QQRYSTVERELFSVLHALNKGELLLSPDVTVYTDNKGIISIGNSDRNTHPRFTKYLDLVN 614

Query: 122 GHRVKWKYLPGAKNLLADYLSRFGLDDQPYLDLEQLQQFAVDIPTSNLTLLXXXXXXXXX 181
           GHRVKWKYLPGAKNLLADYLSRFGLDDQPYLDLEQLQQFAVDIPTSNLTLL         
Sbjct: 615 GHRVKWKYLPGAKNLLADYLSRFGLDDQPYLDLEQLQQFAVDIPTSNLTLLSADSDAETS 674

Query: 182 XXXXXXXXXXXXXSDNTTDPDYVIDNVNSLTLSQLLEIQKLLADXXXXXXXXXXXXXDRF 241
                        SDNTTDPDYVIDNVNSLTLSQLLEIQKLLAD             DRF
Sbjct: 675 STTNPEPSTEAPNSDNTTDPDYVIDNVNSLTLSQLLEIQKLLADKISSIPPIFSKIIDRF 734

Query: 242 YYTSGNLYINMDSILFRVVIDKDYMDVATKLHALYHCTHRVLQLAMADEKLWNPNSNLLL 301
           YYTSGNLYINMDSILFRVVIDKDYMDVATKLHALYHCTHRVLQLAMADEKLWNPNSNLLL
Sbjct: 735 YYTSGNLYINMDSILFRVVIDKDYMDVATKLHALYHCTHRVLQLAMADEKLWNPNSNLLL 794

Query: 302 L 302
           L
Sbjct: 795 L 795

>Kpol_2000.35 s2000 complement(68315..70429) [2115 bp, 704 aa] {ON}
           complement(68315..70429) [2115 nt, 705 aa]
          Length = 704

 Score =  394 bits (1012), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 203/322 (63%), Positives = 234/322 (72%), Gaps = 21/322 (6%)

Query: 2   FKQLITRSLTLKLFDPQALTIIFSDASLKGGASIILQPEVHNNKTLLFPISFLSVRFNPT 61
           FK+ ITRSLTLKLFDP A TIIF+DASL GGASII QPE HN K +LFPI+FLSVRF PT
Sbjct: 27  FKEWITRSLTLKLFDPTAPTIIFTDASLTGGASIIFQPETHNKKQILFPITFLSVRFTPT 86

Query: 62  QQRYSTVERELFSVLPALNKGELLLSPDVTVYTDNKGIISIGNSDRNTHPRFTKYLDLVN 121
           QQRYSTVERELF+VL AL KG LLLS ++T+YTDNKGIISIGNSDRNTHPRFTK+LDL+N
Sbjct: 87  QQRYSTVERELFAVLHALEKGNLLLSSEITIYTDNKGIISIGNSDRNTHPRFTKFLDLLN 146

Query: 122 GHRVKWKYLPGAKNLLADYLSRFGLDDQPYLDLEQLQQFAVDIPTSNLTLLXXXXXXXXX 181
           GHR+KWKYLPG KN+LADYLSRFGL DQP LDL+ LQ+ A+D+P + L+ L         
Sbjct: 147 GHRLKWKYLPGTKNVLADYLSRFGLKDQPELDLDLLQKDAIDLPVATLSSLNLNSTDASP 206

Query: 182 XXXXXXXXXXXXXS-DNTT--------------------DPDYVIDNVNSLTLSQLLEIQ 220
                        S DNT                     DP+YV+DNVNSLT+SQL++IQ
Sbjct: 207 NSTTIDPASSVPLSTDNTNTPEITSNTTPSEQDETEESLDPNYVVDNVNSLTMSQLIQIQ 266

Query: 221 KLLADXXXXXXXXXXXXXDRFYYTSGNLYINMDSILFRVVIDKDYMDVATKLHALYHCTH 280
            LL+              D+F Y S  LYIN+D +L+RVVID DY++VATKLH LYHCTH
Sbjct: 267 TLLSTKETLIPHLFSKVIDKFLYISDLLYINLDLVLYRVVIDNDYIEVATKLHGLYHCTH 326

Query: 281 RVLQLAMADEKLWNPNSNLLLL 302
           RVLQLAM D+KLWNPNSNLLLL
Sbjct: 327 RVLQLAMNDQKLWNPNSNLLLL 348

>NCAS0C05600 Chr3 complement(1136016..1137353) [1338 bp, 445 aa]
           {ON} 
          Length = 445

 Score =  259 bits (661), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 143/336 (42%), Positives = 193/336 (57%), Gaps = 39/336 (11%)

Query: 3   KQLITRSLTLKLFDPQALTIIFSDASLKGGASIILQPEVHNNKTLLFPISFLSVRFNPTQ 62
           KQLIT SL LKLFDPQ  T I++DA+  GGAS++ QP+  N K  L+PI+F S+RF PTQ
Sbjct: 70  KQLITDSLKLKLFDPQVPTFIYTDANQTGGASMVCQPKTINGKVYLYPIAFYSIRFTPTQ 129

Query: 63  QRYSTVERELFSVLPALNKGELLLSPDVTVYTDNKGIISIGNSDRNTHPRFTKYLDLVNG 122
           QRYSTVERELF+VL  L K  L+LSP +T++TDN GI+SIG S+RNTHPRFTKYLD++NG
Sbjct: 130 QRYSTVERELFAVLHTLEKARLILSPQITIFTDNTGIVSIGRSERNTHPRFTKYLDILNG 189

Query: 123 HRVKWKYLPGAKNLLADYLSRFGLDDQPYLDLEQLQQFAVDIPTSNLTL----------- 171
           +R+ WK++PG  N++ADYLSRFGL +QPYL L  + + A +I   ++ L           
Sbjct: 190 YRLTWKHIPGPTNVVADYLSRFGLSNQPYLQLSDIDKVATEIELEDIHLKAVNTEHNIPS 249

Query: 172 -------LXXXXXXXXXXXXXXXXXXXXXXSDNTTDP----------------DYVIDNV 208
                  L                      S+  TDP                + +ID+ 
Sbjct: 250 NTQPPDRLSESTPTNTESNEANEPSPNTEQSNEVTDPTPSTIPNDTLVQTEDDNIIIDSP 309

Query: 209 NSLTLSQLLEIQKLLADXXXXXXXXXXXXXDRFYYTSGN--LYINMDSILFRVVIDKDYM 266
            +LT +++L I++L                   Y+T  N  LY   D+ L+ ++ D +Y+
Sbjct: 310 INLTWTEILLIKELFTTSGTIPQKFSKVI---IYFTLINNILYYFRDNQLYHIINDAEYL 366

Query: 267 DVATKLHALYHCTHRVLQLAMADEKLWNPNSNLLLL 302
           D AT LH L+H +HRVLQ  M  + LW PN  LL L
Sbjct: 367 DRATTLHQLFHASHRVLQQMMITDHLWPPNGQLLTL 402

>Kpol_1031.7 s1031 (14919..19916) [4998 bp, 1665 aa] {ON}
            (14919..19916) [4998 nt, 1666 aa]
          Length = 1665

 Score =  270 bits (689), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 141/302 (46%), Positives = 194/302 (64%), Gaps = 23/302 (7%)

Query: 3    KQLITRSLTLKLFDPQALTIIFSDASLKGGASIILQPEVHNNKTLLFPISFLSVRFNPTQ 62
            KQ I +S+TLKLFDPQA TII++DASL G ASI+LQPE  N  T+L+PI+F S+RFNPTQ
Sbjct: 1025 KQAILKSITLKLFDPQAPTIIYTDASLTGAASILLQPENQNGNTILYPIAFYSIRFNPTQ 1084

Query: 63   QRYSTVERELFSVLPALNKGELLLSPDVTVYTDNKGIISIGNSDRNTHPRFTKYLDLVNG 122
            QRYSTVEREL++VL  L K  LLLS ++T+YTDN+GIISIG ++R THPR TKYLDL+N 
Sbjct: 1085 QRYSTVERELWAVLHTLEKARLLLSSNITIYTDNQGIISIGKTERATHPRLTKYLDLLNT 1144

Query: 123  HRVKWKYLPGAKNLLADYLSRFGLDDQPYLDLEQLQQFA--VDIPTSNLTLLXXXXXXXX 180
            +R+ WKY+ G++N +ADYLSR+GL  +  L+L++ +Q    +D+ T+ L  L        
Sbjct: 1145 YRLTWKYIKGSQNYVADYLSRYGLSQKTTLNLDEWEQLGTTIDLATTQLNNL-------- 1196

Query: 181  XXXXXXXXXXXXXXSDNTTDPDYVIDNVNSLTLSQLLEIQKLLADXXXXXXXXXXXXXDR 240
                            +  D D +I+NV++L+ SQ+LEIQ++L +               
Sbjct: 1197 ------------TNEPSANDTDLIINNVHNLSWSQILEIQQILRE-NLPVPQIYQNIIHI 1243

Query: 241  FYYTSGNLYINMDSILFRVVIDKDYMDVATKLHALYHCTHRVLQLAMADEKLWNPNSNLL 300
            F + + N YI     L  ++ D DY+  AT  H  +H +HRVL+  M  EK WNP  ++L
Sbjct: 1244 FTWVNNNFYIFYHQQLHHILTDIDYIQKATSAHNRFHASHRVLEQIMVQEKYWNPKHSVL 1303

Query: 301  LL 302
            LL
Sbjct: 1304 LL 1305

>Kpol_298.3 s298 (6306..11309) [5004 bp, 1667 aa] {ON} (6306..11309)
            [5004 nt, 1668 aa]
          Length = 1667

 Score =  264 bits (675), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 141/313 (45%), Positives = 189/313 (60%), Gaps = 14/313 (4%)

Query: 3    KQLITRSLTLKLFDPQALTIIFSDASLKGGASIILQPEVHNNKTLLFPISFLSVRFNPTQ 62
            KQLI +SLTLKLFDPQA TII++DASL G ASI+LQPE  N KT L+PI+F S+RF  TQ
Sbjct: 1003 KQLILKSLTLKLFDPQAPTIIYTDASLTGAASIVLQPETVNGKTTLYPITFYSLRFTDTQ 1062

Query: 63   QRYSTVERELFSVLPALNKGELLLSPDVTVYTDNKGIISIGNSDRNTHPRFTKYLDLVNG 122
            QRYSTVEREL++VL  L K  L+LS  +T+YTDN+GIIS+G ++R THPR TKYLDL+N 
Sbjct: 1063 QRYSTVERELWAVLHTLEKARLVLSSSITIYTDNQGIISMGKTERATHPRLTKYLDLLNT 1122

Query: 123  HRVKWKYLPGAKNLLADYLSRFGLDDQPYLDLEQLQQFAVDI-------------PTSNL 169
            +R+ WKY+ G  N +ADYLSR+GLD QP L+L++ ++F+VDI                NL
Sbjct: 1123 YRLNWKYIKGRDNHVADYLSRYGLDSQPTLNLDEWEKFSVDIKLNAVTHSDQQSKENPNL 1182

Query: 170  TLLXXXXXXXXXXXXXXXXXXXXXXSDNTTDPDYVIDNVNSLTLSQLLEIQKLLADXXXX 229
            T                          N      +I +V +L+ SQ+L+IQ+++ +    
Sbjct: 1183 TQHTTNEHTQKAPEESREPATDTTDQQNNEGTPDIIQDVRNLSWSQILDIQRIIREHLPI 1242

Query: 230  XXXXXXXXXDRFYYTSGNLYINMDSILFRVVIDKDYMDVATKLHALYHCTHRVLQLAMAD 289
                       F + + N YI     L  ++ D DY++ AT LH  +H  HR+L+  M  
Sbjct: 1243 PQIYQDIIH-IFTWVNNNFYIIYHEQLHHILTDVDYIEKATSLHNAFHANHRILEQMMIQ 1301

Query: 290  EKLWNPNSNLLLL 302
            EK WNP   +LLL
Sbjct: 1302 EKFWNPRHAILLL 1314

>Kpol_1036.100 s1036 (259603..261150,261154..262107) [2502 bp, 833
           aa] {ON} (259603..261150,261154..262107) [2502 nt, 834
           aa]
          Length = 833

 Score =  234 bits (597), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 127/304 (41%), Positives = 181/304 (59%), Gaps = 14/304 (4%)

Query: 3   KQLITRSLTLKLFDPQALTIIFSDASLKGGASIILQPEVHNNKTLLFPISFLSVRFNPTQ 62
           KQ I +S+TLKLFDPQ  T+I++DASL G ASI+LQPE  N K  L+PI+F S+RF   Q
Sbjct: 529 KQAILKSITLKLFDPQTPTVIYADASLIGAASILLQPETTNGKAALYPIAFYSLRFTEAQ 588

Query: 63  QRYSTVERELFSVLPALNKGELLLSPDVTVYTDNKGIISIGNSDRNTHPRFTKYLDLVNG 122
           QRYSTVEREL+++L  L K  L+LS  +T+YTDN+GIISIG ++R THPR TKYLDL+N 
Sbjct: 589 QRYSTVERELWAILHTLEKARLILSSSITIYTDNQGIISIGKTERVTHPRLTKYLDLLNT 648

Query: 123 HRVKWKYLPGAKNLLADYLSRFGLDDQPYLDLEQLQQFAVDIPTSNLTLLXXXXXXXXXX 182
           +R+ WKY+ G+ N +ADYLSR+GLD QP L+L++  +F+V+I  +  T            
Sbjct: 649 YRLTWKYIKGSDNHVADYLSRYGLDSQPTLNLDKWDKFSVEIELNTTTHSDQPSEGSPTL 708

Query: 183 XXXXXXXXXXXXSDNT-------TDPDY------VIDNVNSLTLSQLLEIQKLLADXXXX 229
                       +D +        DP+       +I++V +L+ SQ+L+IQ++  +    
Sbjct: 709 TEQTAPEPVPEATDESHEQANDLIDPETSENIPNIINDVRNLSWSQILDIQRIPRE-HLP 767

Query: 230 XXXXXXXXXDRFYYTSGNLYINMDSILFRVVIDKDYMDVATKLHALYHCTHRVLQLAMAD 289
                      F + + N YI     L  ++ D  Y++ AT L   +H  HR+L+  M  
Sbjct: 768 TPNIYQNIIHIFTWVNNNFYIIYHDQLHHILTDVHYIEKATSLLNAFHANHRILEQMMIP 827

Query: 290 EKLW 293
           EK W
Sbjct: 828 EKYW 831

>KNAG0E01570 Chr5 (313977..315122) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score =  188 bits (478), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 105/307 (34%), Positives = 169/307 (55%), Gaps = 8/307 (2%)

Query: 3   KQLITRSLTLKLFDPQALTIIFSDASLKGGASIILQPEVHNNKTLLFPISFLSVRFNPTQ 62
           ++ I  ++ LK F+ QA T+IF+DAS +G  +++ QPE  N  T L PI+F S+RF P Q
Sbjct: 9   RRYIMDAIKLKPFNSQAPTMIFTDASFEGVGAMVCQPETINGSTQLLPIAFYSIRFTPRQ 68

Query: 63  QRYSTVERELFSVLPALNKGELLLSPDVTVYTDNKGIISIGNSDRNTHPRFTKYLDLVNG 122
           + Y+TVEREL++VL  L K  L L P++ VY DN  I+SIG S+++T  R TKY++L++ 
Sbjct: 69  KNYATVERELWAVLYTLEKARLFLLPEIIVYADNTSIVSIGRSEKHTTNRLTKYIELLHA 128

Query: 123 HRVKWKYLPGAKNLLADYLSRFGLDDQPYLDLEQLQQFA--VDIPTSNLT-LLXXXXXXX 179
           +R+ WK++PG KN++ADYL R  L D+P+L  +   + A  V++     T ++       
Sbjct: 129 YRITWKHIPGVKNVVADYLFRECLIDKPFLSDQTFDEHATFVEVNAVETTPVVEPEPDEE 188

Query: 180 XXXXXXXXXXXXXXXSDNTT----DPDYVIDNVNSLTLSQLLEIQKLLADXXXXXXXXXX 235
                          SD+ +    D + +      L  + +L ++++  +          
Sbjct: 189 NPAAKTQDSGQLEPNSDDISTADDDSEIIYRRPQDLPWTAVLSLKRIFMEKLDVLRQLAQ 248

Query: 236 XXXDRFYYTSGNLYINMDSILFRVVIDKDYMDVATKLHALYHCTHRVLQLAMADEKLWNP 295
                F   S  L     ++L+ ++ D DY+  AT LH  +H +HR L+  M  +K WNP
Sbjct: 249 VVR-HFTCISDTLNYVDGTVLYYIITDNDYLQRATTLHNRFHASHRALKQMMFKKKWWNP 307

Query: 296 NSNLLLL 302
           NS+LL+L
Sbjct: 308 NSDLLML 314

>NCAS0G02330 Chr7 complement(413199..415172) [1974 bp, 657 aa] {ON} 
            retrotransposon
          Length = 657

 Score =  182 bits (463), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 108/137 (78%)

Query: 35  IILQPEVHNNKTLLFPISFLSVRFNPTQQRYSTVERELFSVLPALNKGELLLSPDVTVYT 94
           ++ QPE  N +T L+PI+F S++F+ TQQ YSTVERELF+VL  L K  L+LSP +T++T
Sbjct: 1   MVCQPETINGRTFLYPIAFYSIQFSQTQQNYSTVERELFAVLHTLEKARLILSPQITIFT 60

Query: 95  DNKGIISIGNSDRNTHPRFTKYLDLVNGHRVKWKYLPGAKNLLADYLSRFGLDDQPYLDL 154
           DN GI+SIG S RNTHPRFTKYLD++NG+R+ WK++PG KN++ADYLSRFGLDDQPYL L
Sbjct: 61  DNTGIVSIGRSARNTHPRFTKYLDILNGYRLTWKHIPGPKNVVADYLSRFGLDDQPYLHL 120

Query: 155 EQLQQFAVDIPTSNLTL 171
             + + A +I  + + L
Sbjct: 121 ADIDKTATEIELNTIDL 137

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 63/108 (58%), Gaps = 2/108 (1%)

Query: 195 SDNTTDPDYVIDNVNSLTLSQLLEIQKLLADXXXXXXXXXXXXXDRFYYTSGNLYINMDS 254
           +D  TD +++I+  N+L  +++L I+++L+D               F   +  LY  +D 
Sbjct: 196 NDELTD-EFIIETPNNLNWTEILSIKQILSDSATIPRKFTKVIKS-FAIINDTLYYFLDG 253

Query: 255 ILFRVVIDKDYMDVATKLHALYHCTHRVLQLAMADEKLWNPNSNLLLL 302
            L+ ++ D +YMD AT+LH L+H +HRVL+  M  +K+W+PN  LL L
Sbjct: 254 NLYNIINDAEYMDRATELHKLFHASHRVLKQMMLTDKIWSPNGELLTL 301

>Kpol_541.1 s541 (1906..2055,2059..2121,3029..3775,3779..3943) [1125
           bp, 375 aa] {ON}
           (1906..2055,2059..2121,3029..3775,3779..3943) [1125 nt,
           375 aa]
          Length = 375

 Score =  154 bits (390), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 78/143 (54%), Positives = 103/143 (72%), Gaps = 1/143 (0%)

Query: 1   SFKQLITRSLTLKLFDPQALTIIFSDASLKGGASIILQPEVHNNKTLLFPISFLSVRFNP 60
           +  Q ITRSL LK  +P+A TII++DAS    ASI+LQ E+  ++T LFPI+F S+RF  
Sbjct: 234 AMNQWITRSLPLKFLNPKAPTIIYTDASKFVAASIVLQLEIQRDRTTLFPIAFFSIRFTS 293

Query: 61  TQQRYSTVERELFSVLPALNKGELLLSPDVTVYTDNKGIISIGNSDRNTHPRFTKYLDLV 120
           TQQRY TV+R+L++VL  L    LLLS ++TVYTDN+ II IG S+R TH R TKYLD +
Sbjct: 294 TQQRYPTVDRKLWAVLHTLENVRLLLS-NITVYTDNQVIIGIGRSERKTHQRLTKYLDFL 352

Query: 121 NGHRVKWKYLPGAKNLLADYLSR 143
           N +R+ WKY  G+ N++  YLSR
Sbjct: 353 NTYRLTWKYDKGSNNIITGYLSR 375

>Kpol_1024.8 s1024 (32074..32703) [630 bp, 209 aa] {ON}
           (32074..32703) [630 nt, 210 aa]
          Length = 209

 Score = 99.0 bits (245), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 63/196 (32%), Positives = 95/196 (48%), Gaps = 27/196 (13%)

Query: 102 IGNSDRNTHPRFTKYLDLVNGHRVKWKYLPGAKNLLADYLSRFGLDDQPYLDLEQLQQFA 161
           +G ++R THPR TKYLDL+N +R+ WKY+ G  N  ADYLSR+GLD QP L+L++  +F+
Sbjct: 1   MGKTERATHPRLTKYLDLLNTYRLNWKYIKGTDNHAADYLSRYGLDSQPTLNLDEWDKFS 60

Query: 162 VDIPTSN-----------LTLLXXXXXXXXXXXXXXXXXXXXXXSDNTTDPDY--VIDNV 208
           VDI  +             TL                        D  T  D   +I +V
Sbjct: 61  VDIELNATTHSDQHSEDFTTLTQQTTPEPIQEATEESHEQANYLIDQQTHEDIPNIIHDV 120

Query: 209 NSLTLSQLLEIQKLLADXXXXXXXXXXXXXDRFYYTSGNLYINMDSILFRVVIDKDYMDV 268
            +L+ SQ+L+I + +                 F + + N YI     L  ++ D DY++ 
Sbjct: 121 RNLSWSQILDIYQNIIHI--------------FTWVNNNFYIIYLDQLHHILTDVDYIER 166

Query: 269 ATKLHALYHCTHRVLQ 284
           AT LH  +H  H++L+
Sbjct: 167 ATSLHNAFHANHQILE 182

>NCAS0A09620 Chr1 complement(1923028..1923234) [207 bp, 68 aa]
          {ON} 
          Length = 68

 Score = 74.7 bits (182), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 35/63 (55%), Positives = 46/63 (73%)

Query: 35 IILQPEVHNNKTLLFPISFLSVRFNPTQQRYSTVERELFSVLPALNKGELLLSPDVTVYT 94
          ++ QP+  + KT L+PI+  SVRF  TQQRYSTVEREL++VL  L K  L LS  +T+YT
Sbjct: 1  MVCQPDTVDGKTQLYPIASPSVRFTETQQRYSTVERELWAVLYTLEKARLTLSSSITIYT 60

Query: 95 DNK 97
          DN+
Sbjct: 61 DNQ 63

>Kpol_544.2 s544 complement(3985..4863) [879 bp, 292 aa] {ON}
           complement(3985..4863) [879 nt, 293 aa]
          Length = 292

 Score = 75.5 bits (184), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 54/175 (30%), Positives = 80/175 (45%), Gaps = 14/175 (8%)

Query: 141 LSRFGLDDQPYLDLEQLQQFAVDI------------PTSNLTLLXXXXXXXXXXXXX-XX 187
           +S +GLD Q  L+LE+  + AVDI            P S+ T +                
Sbjct: 10  ISIYGLDSQSTLNLEEWDKLAVDIDLNTIRLNTTISPNSDDTHINNGPPPLSDPHKDDLQ 69

Query: 188 XXXXXXXSDNTTDPDYVIDNVNSLTLSQLLEIQKLLADXXXXXXXXXXXXXDRFYYTSGN 247
                   +   DPD +I NV++L+ SQ+LEIQ++L +               F + + N
Sbjct: 70  TSTPQTNCEPNNDPDLIITNVHNLSWSQILEIQQILRENLPIPQIYQNIIH-IFTWVNNN 128

Query: 248 LYINMDSILFRVVIDKDYMDVATKLHALYHCTHRVLQLAMADEKLWNPNSNLLLL 302
            YI     L  ++ D DY+  AT +H  +H  HRVL+  M  EK WNP  ++LLL
Sbjct: 129 FYIFYHQQLHHILTDIDYIHKATLVHNRFHSCHRVLEQTMTQEKYWNPKHSILLL 183

>Kpol_250.3 s250 complement(6333..6992) [660 bp, 219 aa] {ON}
           complement(6333..6992) [660 nt, 220 aa]
          Length = 219

 Score = 73.6 bits (179), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%)

Query: 3   KQLITRSLTLKLFDPQALTIIFSDASLKGGASIILQPEVHNNK 45
           K+ I RSLTLKLFDP A T+IFSDASL GGASII QPE+HNNK
Sbjct: 166 KEWIARSLTLKLFDPTAPTVIFSDASLTGGASIIFQPEIHNNK 208

>NDAI0C03530 Chr3 (806284..810075) [3792 bp, 1263 aa] {ON} 
          Length = 1263

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 68/126 (53%), Gaps = 5/126 (3%)

Query: 25  SDASLKGGASIILQPEVHNNKTLLFPISFLSVRFNPTQQRYSTVERELFSVLPALNKGEL 84
           +DAS+ G  +++   EV +NK L   +S+ S   N TQ+RY   E EL +++  L   + 
Sbjct: 596 TDASMDGLGAVL--EEVADNKVLGV-VSYYSKSLNETQRRYPPGELELMAIIEGLEHFKY 652

Query: 85  LL-SPDVTVYTDNKGIISIGNSDRNTHPRFTKYLDLVNGHRVKWKYLPGAKNLLADYLSR 143
           +L      + TD+  ++SI N       R  ++LD ++       YLPG KN++AD +SR
Sbjct: 653 MLHGKHFVLRTDHISLLSIQNQKEPAR-RVQRWLDTLSEFDFSLAYLPGPKNVVADAISR 711

Query: 144 FGLDDQ 149
             L+++
Sbjct: 712 AKLENK 717

>NDAI0K00353 Chr11 complement(70340..74089) [3750 bp, 1249 aa] {ON}
          Length = 1249

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 68/126 (53%), Gaps = 5/126 (3%)

Query: 25  SDASLKGGASIILQPEVHNNKTLLFPISFLSVRFNPTQQRYSTVERELFSVLPALNKGEL 84
           +DAS+ G  +++   EV +NK L   +S+ S   N TQ+RY   E EL +++  L   + 
Sbjct: 596 TDASMDGLGAVL--EEVADNKVLGV-VSYYSKSLNETQRRYPPGELELMAIIEGLEHFKY 652

Query: 85  LL-SPDVTVYTDNKGIISIGNSDRNTHPRFTKYLDLVNGHRVKWKYLPGAKNLLADYLSR 143
           +L      + TD+  ++SI N       R  ++LD ++       YLPG KN++AD +SR
Sbjct: 653 MLHGKHFVLRTDHISLLSIQNQKEPAR-RVQRWLDTLSEFDFSLAYLPGPKNVVADAISR 711

Query: 144 FGLDDQ 149
             L+++
Sbjct: 712 AKLENK 717

>NDAI0C01570 Chr3 (334303..338046) [3744 bp, 1247 aa] {ON} 
          Length = 1247

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 68/126 (53%), Gaps = 5/126 (3%)

Query: 25  SDASLKGGASIILQPEVHNNKTLLFPISFLSVRFNPTQQRYSTVERELFSVLPALNKGEL 84
           +DAS+ G  +++   EV +NK L   +S+ S   N TQ+RY   E EL +++  L   + 
Sbjct: 596 TDASMDGLGAVL--EEVADNKVLGV-VSYYSKSLNETQRRYPPGELELMAIIEGLEHFKY 652

Query: 85  LL-SPDVTVYTDNKGIISIGNSDRNTHPRFTKYLDLVNGHRVKWKYLPGAKNLLADYLSR 143
           +L      + TD+  ++SI N       R  ++LD ++       YLPG KN++AD +SR
Sbjct: 653 MLHGKHFVLRTDHISLLSIQNQKEPAR-RVQRWLDTLSEFDFSLAYLPGPKNVVADAISR 711

Query: 144 FGLDDQ 149
             L+++
Sbjct: 712 AKLENK 717

>Ecym_5175 Chr5 (360152..364384) [4233 bp, 1410 aa] {ON} Similar to
            Saccharomyces cerevisiae YGR109W-B Retrotransposon TYA
            Gag and TYB Pol genes; transcribed/translated as one
            unit; polyprotein is processed to make a
            nucleocapsid-like protein (Gag), reverse transcriptase
            (RT), protease (PR), and integrase (IN); similar to
            retroviral genes [Saccharomyces cerevisiae S288c]
          Length = 1410

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 43/145 (29%), Positives = 69/145 (47%), Gaps = 7/145 (4%)

Query: 3    KQLITRSLTLKLFDPQALT---IIFSDASLKGGASIILQPEVHNNKTLLFPISFLSVRFN 59
            K L++    L  F  Q L    ++ +DAS +G  +++   EV     +L  + + S  FN
Sbjct: 914  KTLLSSEPILVKFKTQDLNANYVLTTDASKEGVGAVL--EEVDEKGKVLGVVEYFSKSFN 971

Query: 60   PTQQRYSTVERELFSVLPALNKGELLL-SPDVTVYTDNKGIISIGNSDRNTHPRFTKYLD 118
              Q RY   E EL  ++ AL   + LL      + TD+ G+++  N     H R  ++LD
Sbjct: 972  DVQSRYPAGELELLGIMEALRHFKYLLHGRKFKIKTDHLGLLTTQNKGE-PHRRVARWLD 1030

Query: 119  LVNGHRVKWKYLPGAKNLLADYLSR 143
             +  +     YL G  N++AD LSR
Sbjct: 1031 ELEEYDFTLSYLKGPDNVVADVLSR 1055

>Kpol_1048.75 s1048 (214263..217964) [3702 bp, 1233 aa] {ON}
           (214263..217964) [3702 nt, 1234 aa]
          Length = 1233

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 76/152 (50%), Gaps = 5/152 (3%)

Query: 1   SFKQLITRSLTLKLFDPQALTIIFSDASLKGGASIILQPEVHNNKTLLFPISFLSVRFNP 60
             K ++T    L  F P     + +DAS K G   +L+ EV     +L  + + S     
Sbjct: 541 ELKTILTNHPILVPFQPNGNYRLTTDAS-KYGIGAVLE-EVTPTGNVLGVVGYYSQSLKG 598

Query: 61  TQQRYSTVERELFSVLPALNKGELLLSP-DVTVYTDNKGIISIGNSDRNTHPRFTKYLDL 119
            QQ Y   E EL  ++ AL+  + LL     ++ TD+  ++S+ N +    PR  ++LD 
Sbjct: 599 AQQNYPAGELELLGIVQALDHFKYLLHGIHFSLRTDHVSLLSLRN-ETEPAPRVQRHLDK 657

Query: 120 VNGHRVKWKYLPGAKNLLADYLSRFGLD-DQP 150
           +  +  +  Y+PG +N++AD LSR G + D+P
Sbjct: 658 LADYDFELSYIPGPENVVADALSRVGYNGDRP 689

>NDAI0A04060 Chr1 (914708..918319) [3612 bp, 1203 aa] {ON}
          Length = 1203

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 75/162 (46%), Gaps = 19/162 (11%)

Query: 1   SFKQLITRSLTLKLFDPQALTIIFSDASLKGGASIILQ---------P--------EVHN 43
           +FK+ + R  T+  F P    +IF+DAS     ++++Q         P        +  N
Sbjct: 531 NFKETLQRLPTIGRFIPGYPILIFTDASRYSTGAVVIQLSDKADSRKPIQMIIDEIKERN 590

Query: 44  NKTLLFPISFLSVRFNPTQQRYSTVERELFSVLPALNKGE-LLLSPDVTVYTDNKGIISI 102
            K     + F S +  P +Q YS  + EL ++   L + E  L+   VTV TD+  +  +
Sbjct: 591 GKVQGKILGFSSYKLTPAEQNYSVYDLELLAIDKVLEQYEQWLIGSPVTVITDHANLSRL 650

Query: 103 GNSDRNTHPRFTKYLDLVNGHRVKWKYLPGAKNLLADYLSRF 144
               R T PR ++ ++ +    V+  ++ G  N +AD LSR+
Sbjct: 651 TTKVRLT-PRISRTMEFLMQFDVRIGFMEGDSNTMADGLSRY 691

>Kpol_1031.4 s1031 (9817..13008) [3192 bp, 1063 aa] {ON}
           (9817..13008) [3192 nt, 1064 aa]
          Length = 1063

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 70/149 (46%), Gaps = 4/149 (2%)

Query: 1   SFKQLITRSLTLKLFDPQALTIIFSDASLKGGASIILQPEVHNNKTLLFPISFLSVRFNP 60
             K +++    L  F P  L  + +DAS K G   +L+ EV     L   + + S     
Sbjct: 382 ELKDILSSEPVLVAFRPDGLYRLTTDAS-KNGVGAVLE-EVTETGKLKGVVGYFSHSLKG 439

Query: 61  TQQRYSTVERELFSVLPALNKGELLL-SPDVTVYTDNKGIISIGNSDRNTHPRFTKYLDL 119
            ++ Y   E EL  ++ AL   + LL      + TD+ G++SI   +     R  ++LDL
Sbjct: 440 PERNYPAGELELLGIVSALKHFKYLLHGRHFVLRTDHVGLLSI-RKEGEPSTRVQRWLDL 498

Query: 120 VNGHRVKWKYLPGAKNLLADYLSRFGLDD 148
           +    +  +YL G KN++AD +SR   +D
Sbjct: 499 LADFDIDLQYLQGKKNVVADAISRMEGND 527

>NDAI0G03370 Chr7 complement(802196..804754) [2559 bp, 852 aa] {ON} 
          Length = 852

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 75/162 (46%), Gaps = 19/162 (11%)

Query: 1   SFKQLITRSLTLKLFDPQALTIIFSDASLKGGASIILQ---------P--------EVHN 43
           +FK+ + R  T+  F P    +IF+DAS     ++++Q         P        +  N
Sbjct: 272 NFKETLQRLPTIGRFIPGYPILIFTDASRYSTGAVVIQLSDKADSRKPIQIIIDEIKERN 331

Query: 44  NKTLLFPISFLSVRFNPTQQRYSTVERELFSVLPALNKGE-LLLSPDVTVYTDNKGIISI 102
            K     + F S +  P +Q YS  + EL ++   L + E  L+   VTV TD+  +  +
Sbjct: 332 GKVQGKILGFSSHKLTPAEQNYSVYDLELLAIDKVLEQYEQWLIGSPVTVITDHANLSRL 391

Query: 103 GNSDRNTHPRFTKYLDLVNGHRVKWKYLPGAKNLLADYLSRF 144
               R T PR ++ ++ +    V+  ++ G  N +AD LSR+
Sbjct: 392 TTKVRLT-PRISRTMEFLMQFDVRIGFMEGDSNTMADGLSRY 432

>Skud_15.511 Chr15 (914024..916174) [2151 bp, 716 aa] {ON} YPL060C-A
           (REPEAT)
          Length = 716

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 70/142 (49%), Gaps = 4/142 (2%)

Query: 3   KQLITRSLTLKLFDPQALTIIFSDASLKGGASIILQPEVHNNKTLLFPISFLSVRFNPTQ 62
           K  +  S  L  FD +A   + +DAS K G   +L+ E++    L+  + + S      Q
Sbjct: 43  KTALCSSPVLIPFDSKATYRLTTDAS-KDGIGAVLE-EINTKNKLIGVVGYFSKTLEGAQ 100

Query: 63  QRYSTVERELFSVLPALNKGELLL-SPDVTVYTDNKGIISIGNSDRNTHPRFTKYLDLVN 121
           + Y   E EL  ++ AL+    +L     T+ TD+  ++S+ N +     R  ++LD + 
Sbjct: 101 KNYPAGELELLGIIKALHHFRYMLHGKHFTLRTDHISLLSLQNKNEPAR-RVQRWLDDLA 159

Query: 122 GHRVKWKYLPGAKNLLADYLSR 143
            +    +YL G KN++AD +SR
Sbjct: 160 TYEFTLEYLAGPKNVVADAISR 181

>NDAI0G04700 Chr7 complement(1121097..1124864) [3768 bp, 1255 aa]
           {ON} 
          Length = 1255

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 74/162 (45%), Gaps = 19/162 (11%)

Query: 1   SFKQLITRSLTLKLFDPQALTIIFSDASLKGGASIILQ---------P--------EVHN 43
           +FK+ + R  T+  F P    +IF+DAS     ++++Q         P        +  N
Sbjct: 531 NFKETLQRLPTIGRFIPGYPILIFTDASRYSTGAVVIQLSDKADSRKPIQIIIDEIKERN 590

Query: 44  NKTLLFPISFLSVRFNPTQQRYSTVERELFSVLPALNKGE-LLLSPDVTVYTDNKGIISI 102
            K       F S +  P +Q YS  + EL ++   L + E  L+   VTV TD+  +  +
Sbjct: 591 GKVQGKISGFSSHKLTPAEQNYSVYDLELLAIDKVLEQYEQWLIGSPVTVITDHANLSRL 650

Query: 103 GNSDRNTHPRFTKYLDLVNGHRVKWKYLPGAKNLLADYLSRF 144
               R T PR ++ ++ +    V+  ++ G  N +AD LSR+
Sbjct: 651 TTKVRLT-PRISRTMEFLMQFDVRIGFMEGDSNTMADGLSRY 691

>YIL080W Chr9 (205635..206484,206486..210357) [4722 bp, 1574 aa] {OFF}
            TyB Gag-Pol protein; proteolytically processed to make
            the Gag, RT, PR, and IN proteins that are required for
            retrotransposition
          Length = 1574

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 70/143 (48%), Gaps = 4/143 (2%)

Query: 2    FKQLITRSLTLKLFDPQALTIIFSDASLKGGASIILQPEVHNNKTLLFPISFLSVRFNPT 61
             K  +  S  L  F+ +A   + +DAS K G   +L+ EV N   L+  + + S      
Sbjct: 895  LKAALCNSPVLVPFNNKANYRLTTDAS-KDGIGAVLE-EVDNKNKLVGVVGYFSKSLESA 952

Query: 62   QQRYSTVERELFSVLPALNKGELLL-SPDVTVYTDNKGIISIGNSDRNTHPRFTKYLDLV 120
            Q+ Y   E EL  ++ AL+    +L     T+ TD+  ++S+ N +     R  ++LD +
Sbjct: 953  QKNYPAGELELLGIIKALHHFRYMLHGKHFTLRTDHISLLSLQNKNEPAR-RVQRWLDDL 1011

Query: 121  NGHRVKWKYLPGAKNLLADYLSR 143
              +    +YL G KN++AD +SR
Sbjct: 1012 ATYDFTLEYLAGPKNVVADAISR 1034

>NDAI0I02500 Chr9 (576038..577198) [1161 bp, 386 aa] {ON} 
          Length = 386

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 60/120 (50%), Gaps = 4/120 (3%)

Query: 25  SDASLKGGASIILQPEVHNNKTLLFPISFLSVRFNPTQQRYSTVERELFSVLPALNKGEL 84
           +DAS K G   +L+ EV  +  LL  + + S   +  QQRY   E EL  ++ ALN    
Sbjct: 197 TDAS-KTGVGAVLK-EVDKDNKLLGVVGYFSKSLHGAQQRYPAGELELLGIVEALNHFRY 254

Query: 85  LLSP-DVTVYTDNKGIISIGNSDRNTHPRFTKYLDLVNGHRVKWKYLPGAKNLLADYLSR 143
           +L      V TD+  ++S+      T     ++LD +  +  + +YL G  N++AD LSR
Sbjct: 255 MLHGIHFIVRTDHISLLSVQKIKEPTR-LVLRWLDELAEYDFELQYLAGPDNVVADALSR 313

>KNAG0E03490 Chr5 (696203..698713) [2511 bp, 836 aa] {ON}  probable
           pseudogene; Ty3-like gene with NNN added at twp places
           to avoid internal stop codons
          Length = 836

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 76/147 (51%), Gaps = 9/147 (6%)

Query: 3   KQLITRSLTLKLFDPQALTIIFSDASLKG-GASIILQPEVHNNKTLLFPISFLSVRFNPT 61
           K  +T + TLK FDP    +I +DAS    GA++    ++++ + L+  +SFLS      
Sbjct: 161 KSALTNAPTLKPFDPTKEVVITTDASDHAIGATL----KIYDQRKLIGVVSFLSRSLRGH 216

Query: 62  QQRYSTVERELFSVLPALNKGELLL-SPDVTVYTDNKGIISIGNSDRNTHPRFTKY-LDL 119
           +  +   E+E F+V+ AL+K    +   + T+ TD++ +  I    +    R T++  + 
Sbjct: 217 ELNWPVREKEFFAVVHALHKWRHYVPGKEFTLRTDHQSLQHIMKK-KGFKLRLTRWXXND 275

Query: 120 VNGHRVKWKYLPGAKNLLADYLSRFGL 146
           V     K +Y+PG KN  A+ LSR  +
Sbjct: 276 VAEFNFKIEYIPGKKN-HANPLSRLNV 301

>Kpol_222.2 s222
           complement(1263..2024,2028..2141,2145..2762,2766..3524)
           [2253 bp, 750 aa] {ON}
           complement(1263..2024,2028..2141,2145..2762,2766..3524)
           [2253 nt, 751 aa]
          Length = 750

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 73/149 (48%), Gaps = 10/149 (6%)

Query: 1   SFKQLITRSLTLK-----LFDPQALTIIFSDASLKGGASIILQPEVHNNKTLLFPISFLS 55
           SFK+L  R+LT K      F  ++   + +DAS  G  +++ + +  N K  +  +   S
Sbjct: 282 SFKEL-KRALTSKPVLVVAFKEESRYRLTTDASKIGVGAVLEEIDEKNKKIGV--VGCYS 338

Query: 56  VRFNPTQQRYSTVERELFSVLPALNKGELLL-SPDVTVYTDNKGIISIGNSDRNTHPRFT 114
                 Q  Y   E EL  ++ AL   + LL      +  D+  ++S+   D    PR  
Sbjct: 339 QSLRGAQWDYPVCELELLGIIEALKHFKYLLHGHHFILRMDHISLLSL-KRDTEPTPRVQ 397

Query: 115 KYLDLVNGHRVKWKYLPGAKNLLADYLSR 143
           +++D++     + +YLPG++N++AD LSR
Sbjct: 398 RWIDVLADFDFELQYLPGSQNVVADVLSR 426

>Kwal_23.5250 s23 complement(1075954..1078662) [2709 bp, 902 aa]
           {ON} YGR109W-B - TyB Gag-Pol protein [contig 8] FULL
          Length = 902

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 69/141 (48%), Gaps = 9/141 (6%)

Query: 25  SDASLKGGASIILQPEVHNNKTLLFPISFLSVRFNPTQQRYSTVERELFSVLPALNKGEL 84
           +DAS  G  +++   E  + K ++  + + S     +Q+ Y   E EL +++ AL   + 
Sbjct: 245 TDASKDGLGAVL---EEVSGKRMIGVVGYFSKSLQGSQKNYPAGELELLAIVEALRHFKY 301

Query: 85  LL-SPDVTVYTDNKGIISIGNSDRNTHPRFTKYLDLVNGHRVKWKYLPGAKNLLADYLSR 143
           +L      + TD+  ++++    +  H R  +++D ++      +YLPG  N +A+ +SR
Sbjct: 302 MLHGKHFVLRTDHISLLTM-RGQKEPHRRCARWMDELSEFEFTMEYLPGEANNVANAISR 360

Query: 144 FGLDDQPYLDLEQLQQFAVDI 164
                 P LD+E  +Q  + +
Sbjct: 361 ----SSPRLDMEGSEQKGLGV 377

>Kwal_26.8300 s26 (729038..731746) [2709 bp, 902 aa] {ON} YGR109W-B
           - TyB Gag-Pol protein [contig 280] FULL
          Length = 902

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 69/141 (48%), Gaps = 9/141 (6%)

Query: 25  SDASLKGGASIILQPEVHNNKTLLFPISFLSVRFNPTQQRYSTVERELFSVLPALNKGEL 84
           +DAS  G  +++   E  + K ++  + + S     +Q+ Y   E EL +++ AL   + 
Sbjct: 245 TDASKDGLGAVL---EEVSGKRMIGVVGYFSKSLQGSQKNYPAGELELLAIVEALRHFKY 301

Query: 85  LL-SPDVTVYTDNKGIISIGNSDRNTHPRFTKYLDLVNGHRVKWKYLPGAKNLLADYLSR 143
           +L      + TD+  ++++    +  H R  +++D ++      +YLPG  N +A+ +SR
Sbjct: 302 MLHGKHFVLRTDHISLLTM-RGQKEPHRRCARWMDELSEFEFTMEYLPGEANNVANAISR 360

Query: 144 FGLDDQPYLDLEQLQQFAVDI 164
                 P LD+E  +Q  + +
Sbjct: 361 ----SSPRLDMEGSEQKGLGV 377

>Kwal_56.22670 s56 complement(228050..230080) [2031 bp, 676 aa] {ON}
           YGR109W-B - TyB Gag-Pol protein [contig 184] FULL
          Length = 676

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 69/141 (48%), Gaps = 9/141 (6%)

Query: 25  SDASLKGGASIILQPEVHNNKTLLFPISFLSVRFNPTQQRYSTVERELFSVLPALNKGEL 84
           +DAS  G  +++   E  + K ++  + + S     +Q+ Y   E EL +++ AL   + 
Sbjct: 19  TDASKDGLGAVL---EEVSGKRMIGVVGYFSKSLQGSQKNYPAGELELLAIVEALRHFKY 75

Query: 85  LL-SPDVTVYTDNKGIISIGNSDRNTHPRFTKYLDLVNGHRVKWKYLPGAKNLLADYLSR 143
           +L      + TD+  ++++    +  H R  +++D ++      +YLPG  N +A+ +SR
Sbjct: 76  MLHGKHFVLRTDHISLLTM-RGQKEPHRRCARWMDELSEFEFTMEYLPGEANNVANAISR 134

Query: 144 FGLDDQPYLDLEQLQQFAVDI 164
                 P LD+E  +Q  + +
Sbjct: 135 ----SSPRLDMEGSEQKGLGV 151

>KAFR0F01500 Chr6 (294389..296776) [2388 bp, 795 aa] {ON} 
          Length = 795

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 67/142 (47%), Gaps = 6/142 (4%)

Query: 3   KQLITRSLTLKLFDPQALTIIFSDASLKGGASIILQPEVHNNKTLLFPISFLSVRFNPTQ 62
           K+ +T    L  F P A   + +DAS K G   +L+ EV  + T +  + + S      Q
Sbjct: 302 KETLTSPTILVPFQPNASYKLTTDAS-KDGVGAVLE-EV--SGTSIVSVGYFSKSLPGAQ 357

Query: 63  QRYSTVERELFSVLPALNKGELLL-SPDVTVYTDNKGIISIGNSDRNTHPRFTKYLDLVN 121
           + Y   E EL  +  AL     LL     T+ TD+  ++S+ N+      R  ++LD ++
Sbjct: 358 KNYPAGELELLGITEALRHFRYLLHGTHFTLRTDHISLLSLQNTKEPAQ-RVQRWLDELS 416

Query: 122 GHRVKWKYLPGAKNLLADYLSR 143
            +    +YL   +N++ D +SR
Sbjct: 417 EYEFTLEYLANPRNVVVDAISR 438

>TDEL0C06480 Chr3 (1185928..1186584,1186586..1190053) [4125 bp, 1374
           aa] {ON} 
          Length = 1374

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 60/122 (49%), Gaps = 9/122 (7%)

Query: 25  SDASLKGGASIILQPEVHNNKTLLFPISFLSVRFNPTQQRYSTVERELFSVLPALNKGEL 84
           +DAS  G  +++ Q E    K ++  + + S      Q  Y   E EL  ++ +L   + 
Sbjct: 798 TDASKSGLGAVLEQME---GKKVVGVVGYFSKSLQGAQNNYPAGELELLGIIESLRHFKY 854

Query: 85  LL-SPDVTVYTDNKGIISIGNSDRNTHP--RFTKYLDLVNGHRVKWKYLPGAKNLLADYL 141
           LL     T+ TD+  ++++ N    T P  R  ++LD +  + +  +YL G  N++AD L
Sbjct: 855 LLHGKRFTLRTDHISLLALKN---KTEPSIRLARWLDELAEYEIDLEYLKGPDNVVADTL 911

Query: 142 SR 143
           SR
Sbjct: 912 SR 913

>CAGL0G07183g2 Chr7 complement(678730..682425,682425..683243) [4515
           bp, 1504 aa] {ON} encodes gag, pol, protease, reverse
           transcriptase,RNaseH and integrase of gb|AY673967
           Candida glabrata Tcg3 LTR retrotransposon (Ty3/gypsy
           superfamily)
          Length = 1504

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 77/149 (51%), Gaps = 14/149 (9%)

Query: 1   SFKQLITRSLTLKLFDPQA-----LTIIFSDASLKGGASIILQPEVHNNKTLLFPISFLS 55
           S K  +  +  L  FDP++     +T+  SD  +  GA++    E  + +     I++LS
Sbjct: 792 SLKDALISAPILIAFDPKSPYQLTMTVDASDNCI--GATL----EYKDGRKPKGVIAYLS 845

Query: 56  VRFNPTQQRYSTVERELFSVLPALNK-GELLLSPDVTVYTDNKGIISIGNSDRNTHPRFT 114
            + +  + R+   ++EL++++ AL K    +    V +YTD+K  +++ N      PR  
Sbjct: 846 HKLHSYETRWHIRDKELYAIVFALKKWTHYVQGSHVIIYTDHKTNVNL-NRLALLSPRLA 904

Query: 115 KYLDLVNGHRVKWKYLPGAKNLLADYLSR 143
           ++ +++  +  + KY+PG +N  AD LSR
Sbjct: 905 RWAEVLANYDFEIKYIPGPRN-HADILSR 932

>TBLA0A00520 Chr1 (101637..102401) [765 bp, 254 aa] {ON} 
          Length = 254

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 48/100 (48%), Gaps = 2/100 (2%)

Query: 51  ISFLSVRFNPTQQRYSTVERELFSVLPALNKGELLL-SPDVTVYTDNKGIISIGNSDRNT 109
           I + S   NPTQ RY   E EL S++  L   +  L      + TD+  +++  N  +  
Sbjct: 113 IVYFSKTVNPTQARYPVGEIELLSIIQNLQHFKYYLHGHHFILRTDHISLLAYRNK-KEP 171

Query: 110 HPRFTKYLDLVNGHRVKWKYLPGAKNLLADYLSRFGLDDQ 149
             R +++LD +       +Y+ G+ N +AD LSR    ++
Sbjct: 172 SARISRWLDFLAEFDFTLEYIKGSLNHVADALSRLATKNE 211

>NCAS0H03510 Chr8 (662442..666104) [3663 bp, 1220 aa] {ON} 
          Length = 1220

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 72/145 (49%), Gaps = 7/145 (4%)

Query: 1   SFKQLITRSLTLKLFDPQALTIIFSDAS-LKGGASIILQPEVHNNKTLLFPISFLSVRFN 59
           + K  +T +  L  FD     ++ +DAS    GA++ L   V++   +   ++++S + +
Sbjct: 490 TLKSKLTSAPVLLPFDESKGIVVTTDASDYAVGATLEL---VNDQGNVEGVVAYMSAKLH 546

Query: 60  PTQQRYSTVERELFSVLPALNK-GELLLSPDVTVYTDNKGIISIGNSDRNTHPRFTKYLD 118
             Q  +   E+E +++  AL      L      ++TD++ +  + +S ++T P+  ++LD
Sbjct: 547 GAQLNWPVREKEGYAIRLALEHWSHYLKGKHFVLHTDHESLKFL-HSKKDTSPKIARWLD 605

Query: 119 LVNGHRVKWKYLPGAKNLLADYLSR 143
               +  +  Y+PG  N  AD LSR
Sbjct: 606 TFAEYDFEIVYIPGEHN-RADGLSR 629

>NCAS0A05290 Chr1 complement(1047369..1050149) [2781 bp, 926 aa]
           {ON} 
          Length = 926

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 72/145 (49%), Gaps = 7/145 (4%)

Query: 1   SFKQLITRSLTLKLFDPQALTIIFSDAS-LKGGASIILQPEVHNNKTLLFPISFLSVRFN 59
           + K  +T +  L  FD     ++ +DAS    GA++ L   V++   +   ++++S + +
Sbjct: 196 TLKSKLTSAPVLLPFDESKGIVVTTDASDYAVGATLEL---VNDQGNVEGVVAYMSAKLH 252

Query: 60  PTQQRYSTVERELFSVLPALNK-GELLLSPDVTVYTDNKGIISIGNSDRNTHPRFTKYLD 118
             Q  +   E+E +++  AL      L      ++TD++ +  + +S ++T P+  ++LD
Sbjct: 253 GAQLNWPVREKEGYAIRLALEHWSHYLKGKHFVLHTDHESLKFL-HSKKDTSPKIARWLD 311

Query: 119 LVNGHRVKWKYLPGAKNLLADYLSR 143
               +  +  Y+PG  N  AD LSR
Sbjct: 312 TFAEYDFEIVYIPGEHN-RADGLSR 335

>TBLA0C03820 Chr3 complement(914866..917055) [2190 bp, 729 aa] {ON} 
          Length = 729

 Score = 37.0 bits (84), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 45/94 (47%), Gaps = 2/94 (2%)

Query: 51  ISFLSVRFNPTQQRYSTVERELFSVLPALNKGELLL-SPDVTVYTDNKGIISIGNSDRNT 109
           I + S   NPTQ RY   E EL S++  L   +  L      + TD+  +++  N  +  
Sbjct: 100 IGYFSKTVNPTQARYLVGEIELLSIIQNLQHFKYYLHGHHFILRTDHISLLAYRNK-KEP 158

Query: 110 HPRFTKYLDLVNGHRVKWKYLPGAKNLLADYLSR 143
             R +++LD +       +Y+ G+ N + D LSR
Sbjct: 159 SARISRWLDFLAEFDFTLEYIKGSLNHVVDALSR 192

>TBLA0B06850 Chr2 (1616713..1618005) [1293 bp, 430 aa] {ON} 
          Length = 430

 Score = 36.6 bits (83), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 65/142 (45%), Gaps = 5/142 (3%)

Query: 3   KQLITRSLTLKLFDPQALTIIFSDASLKGGASIILQPEVHNNKTLLFPISFLSVRFNPTQ 62
           K L++ +  L  F P     + +DAS+     ++   E   N  L   + + S   + TQ
Sbjct: 223 KNLLSSAPVLVPFVPGNTYRLTTDASIVFIGGVL---ERMVNDKLKGVVGYYSKTVSDTQ 279

Query: 63  QRYSTVERELFSVLPALNKGELLL-SPDVTVYTDNKGIISIGNSDRNTHPRFTKYLDLVN 121
             Y+  E EL +++  LN     L      + TD+  ++S  +S +    R  ++LD + 
Sbjct: 280 SGYAAGELELLAIISNLNHFRYYLHGHKFILRTDHISLLSY-HSLKEPSKRDARWLDFLG 338

Query: 122 GHRVKWKYLPGAKNLLADYLSR 143
               K +Y+ G  N++AD LSR
Sbjct: 339 EFDFKLEYIKGGNNVVADALSR 360

>Suva_16.197 Chr16 complement(346987..348189) [1203 bp, 400 aa] {ON}
           YPL112C (REAL)
          Length = 400

 Score = 33.5 bits (75), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 3/64 (4%)

Query: 37  LQPEVHNNKTLLFPISFLSVRFNPTQQRYSTVERELFSVLPALNKGELLLSPDVTVYTDN 96
           +Q +V NN  LL PI     R + +Q   S + ++L S L A NK ELL+   +    D 
Sbjct: 284 VQLKVQNNALLLSPIIMHKARDDASQ---SPIRKQLLSDLNADNKSELLIRKQLKAIKDE 340

Query: 97  KGII 100
           K ++
Sbjct: 341 KTLL 344

>TDEL0D05230 Chr4 (948928..951066) [2139 bp, 712 aa] {ON} Anc_3.101
           YOL095C
          Length = 712

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 27/49 (55%)

Query: 12  LKLFDPQALTIIFSDASLKGGASIILQPEVHNNKTLLFPISFLSVRFNP 60
           L+ +  Q++      +  K G++ ++   +H++K L FPI FL   FNP
Sbjct: 563 LQTYFEQSMVRHHGPSGTKLGSNAVILSTIHSSKGLEFPIVFLMGGFNP 611

>CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa]
           {ON} similar to uniprot|P32361 Saccharomyces cerevisiae
           YHR079c IRE1
          Length = 1036

 Score = 30.0 bits (66), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 1/65 (1%)

Query: 28  SLKGGASIILQPEVHNNKTLLFPISFLSVRFNPTQQRYSTVERELFSVLPALNKGELLLS 87
           SL G AS+I   + +NN ++L  IS +    NP    +    R +   LPA+++  LLL 
Sbjct: 396 SLVGSASLINNEQDNNNYSVLGSISGVHTLQNPDYNVFYENNRGVLG-LPAMSRNTLLLD 454

Query: 88  PDVTV 92
           P  +V
Sbjct: 455 PPNSV 459

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.138    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,876,644
Number of extensions: 1185534
Number of successful extensions: 2670
Number of sequences better than 10.0: 50
Number of HSP's gapped: 2734
Number of HSP's successfully gapped: 56
Length of query: 303
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 194
Effective length of database: 40,982,805
Effective search space: 7950664170
Effective search space used: 7950664170
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)