Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1037.31singletonON1741749031e-126
Kpol_1059.2singletonON1741748991e-125
Kpol_1035.4singletonON4751594729e-57
Kpol_208.2singletonON2411471441e-10
Kpol_250.5singletonON409701151e-06
Kpol_1008.22singletonON333771018e-05
Kpol_2000.36singletonON315811001e-04
Kpol_483.5singletonON47867964e-04
Kpol_526.5singletonON16470870.003
ABR137W2.147ON95548760.20
Kpol_541.2singletonON29348730.32
Suva_13.4328.799ON1559121730.48
Ecym_81982.147ON95542691.5
Ecym_44707.156ON54656691.5
TBLA0I029204.240ON133767663.1
NCAS0A053302.488ON35651654.6
KNAG0F027205.267ON1872127645.8
SAKL0F04730g7.147ON42956629.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1037.31
         (174 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1037.31 s1037 (76748..77272) [525 bp, 174 aa] {ON} (76748.....   352   e-126
Kpol_1059.2 s1059 (1630..2154) [525 bp, 174 aa] {ON} (1630..2154...   350   e-125
Kpol_1035.4 s1035 complement(8990..10417) [1428 bp, 475 aa] {ON}...   186   9e-57
Kpol_208.2 s208 complement(1873..2598) [726 bp, 241 aa] {ON} com...    60   1e-10
Kpol_250.5 s250 complement(7886..9115) [1230 bp, 409 aa] {ON} co...    49   1e-06
Kpol_1008.22 s1008 complement(45208..46209) [1002 bp, 333 aa] {O...    44   8e-05
Kpol_2000.36 s2000 complement(70426..71373) [948 bp, 315 aa] {ON...    43   1e-04
Kpol_483.5 s483 complement(7611..9047) [1437 bp, 478 aa] {ON} co...    42   4e-04
Kpol_526.5 s526 complement(5550..6044) [495 bp, 164 aa] {ON} com...    38   0.003
ABR137W Chr2 (653116..655983) [2868 bp, 955 aa] {ON} Syntenic ho...    34   0.20 
Kpol_541.2 s541 (2163..3044) [882 bp, 293 aa] {ON} (2163..3044) ...    33   0.32 
Suva_13.432 Chr13 complement(744705..749384) [4680 bp, 1559 aa] ...    33   0.48 
Ecym_8198 Chr8 complement(406687..409554) [2868 bp, 955 aa] {ON}...    31   1.5  
Ecym_4470 Chr4 complement(955124..956764) [1641 bp, 546 aa] {ON}...    31   1.5  
TBLA0I02920 Chr9 complement(693705..697718) [4014 bp, 1337 aa] {...    30   3.1  
NCAS0A05330 Chr1 (1054164..1055234) [1071 bp, 356 aa] {ON}             30   4.6  
KNAG0F02720 Chr6 complement(511178..516796) [5619 bp, 1872 aa] {...    29   5.8  
SAKL0F04730g Chr6 (379103..379133,379231..380489) [1290 bp, 429 ...    28   9.3  

>Kpol_1037.31 s1037 (76748..77272) [525 bp, 174 aa] {ON}
           (76748..77272) [525 nt, 175 aa]
          Length = 174

 Score =  352 bits (903), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 174/174 (100%), Positives = 174/174 (100%)

Query: 1   MQNQGIKQEEEDSQINILKKGLENTSTQFSAVKKEEAAIEGRILADERKQEALMSEVGKI 60
           MQNQGIKQEEEDSQINILKKGLENTSTQFSAVKKEEAAIEGRILADERKQEALMSEVGKI
Sbjct: 1   MQNQGIKQEEEDSQINILKKGLENTSTQFSAVKKEEAAIEGRILADERKQEALMSEVGKI 60

Query: 61  EKYLDSEQDVLTNLINDKIEAKFADFNAVRVSPSGTNLSSKEETLMKVNRYFPEIIINPS 120
           EKYLDSEQDVLTNLINDKIEAKFADFNAVRVSPSGTNLSSKEETLMKVNRYFPEIIINPS
Sbjct: 61  EKYLDSEQDVLTNLINDKIEAKFADFNAVRVSPSGTNLSSKEETLMKVNRYFPEIIINPS 120

Query: 121 SPLLNDCNKPNGEVSLVVSNELHLNSSYCREPAKILYLILLNVYVPFMMYSIKG 174
           SPLLNDCNKPNGEVSLVVSNELHLNSSYCREPAKILYLILLNVYVPFMMYSIKG
Sbjct: 121 SPLLNDCNKPNGEVSLVVSNELHLNSSYCREPAKILYLILLNVYVPFMMYSIKG 174

>Kpol_1059.2 s1059 (1630..2154) [525 bp, 174 aa] {ON} (1630..2154)
           [525 nt, 175 aa]
          Length = 174

 Score =  350 bits (899), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 173/174 (99%), Positives = 173/174 (99%)

Query: 1   MQNQGIKQEEEDSQINILKKGLENTSTQFSAVKKEEAAIEGRILADERKQEALMSEVGKI 60
           MQNQGIKQEEEDSQINILKKGLENTSTQFSAVKKEEAAIEGRILADERKQEALMSEVGKI
Sbjct: 1   MQNQGIKQEEEDSQINILKKGLENTSTQFSAVKKEEAAIEGRILADERKQEALMSEVGKI 60

Query: 61  EKYLDSEQDVLTNLINDKIEAKFADFNAVRVSPSGTNLSSKEETLMKVNRYFPEIIINPS 120
           EKYLDSEQDVLTNLINDKIEAKFADFNAVRVSPSGTNLSSKEETLMKVNRYFPEIIINPS
Sbjct: 61  EKYLDSEQDVLTNLINDKIEAKFADFNAVRVSPSGTNLSSKEETLMKVNRYFPEIIINPS 120

Query: 121 SPLLNDCNKPNGEVSLVVSNELHLNSSYCREPAKILYLILLNVYVPFMMYSIKG 174
           SPLLNDCNKPNGEVSLVVSNELHLNSSYCREPAKILYLILLNVYVPFMMYSIK 
Sbjct: 121 SPLLNDCNKPNGEVSLVVSNELHLNSSYCREPAKILYLILLNVYVPFMMYSIKA 174

>Kpol_1035.4 s1035 complement(8990..10417) [1428 bp, 475 aa] {ON}
           complement(8990..10417) [1428 nt, 476 aa]
          Length = 475

 Score =  186 bits (472), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 100/159 (62%), Positives = 115/159 (72%), Gaps = 7/159 (4%)

Query: 1   MQNQGIKQEEEDSQINILKKGLENTSTQFSAVKKEEAAIEGRILADERKQEALMSEVGKI 60
           +QN   +  +E++Q NILKKGLENTSTQFSAV+KEEAAIEGRIL DERKQ +L+SEVGKI
Sbjct: 40  LQNMEARSNKEETQTNILKKGLENTSTQFSAVQKEEAAIEGRILEDERKQASLISEVGKI 99

Query: 61  EKYLDSEQDVLTNLINDKIEAKFADFNAVRVSPSGTNLSSKEETLMKVNRYFPEIIINPS 120
           E YL+SEQD L N I DKI  + A F   +V       SSKEE LMKVNRYFPEII NP+
Sbjct: 100 ESYLNSEQDALHNFIQDKITTELAKFKNGKV-------SSKEEILMKVNRYFPEIITNPN 152

Query: 121 SPLLNDCNKPNGEVSLVVSNELHLNSSYCREPAKILYLI 159
           SPLL  C K  GEVSLV   E+HL +   REPA+ L  I
Sbjct: 153 SPLLAGCTKSYGEVSLVAPTEIHLKTENYREPAENLLKI 191

>Kpol_208.2 s208 complement(1873..2598) [726 bp, 241 aa] {ON}
           complement(1873..2598) [726 nt, 242 aa]
          Length = 241

 Score = 60.1 bits (144), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 73/147 (49%), Gaps = 11/147 (7%)

Query: 17  ILKKGLENTSTQFSAVKKEEAAIEGRILADERKQEALMSEVGKIEKYL-------DSEQD 69
           I  K L+  S QFSA+++ E  +   I+ DE      ++++G+ EK         +SE  
Sbjct: 57  IRGKILKQASIQFSALQRNEEEMASHIVKDEED----IAKLGETEKNFAKRFNVDESELK 112

Query: 70  VLTNLINDKIEAKFADFNAVRVSPSGTNLSSKEETLMKVNRYFPEIIINPSSPLLNDCNK 129
              + +  ++       N+   + SG+   S  E L +V ++FP +II  S  LL +CNK
Sbjct: 113 RFEDSVEKRLFQMEEKMNSKDTNISGSKFPSLHEILARVGKHFPHLIIYGSHGLLTNCNK 172

Query: 130 PNGEVSLVVSNELHLNSSYCREPAKIL 156
              +VSL ++N+  L   +  +PA+ +
Sbjct: 173 NYSDVSLSITNDTTLKEEHLEDPARTI 199

>Kpol_250.5 s250 complement(7886..9115) [1230 bp, 409 aa] {ON}
           complement(7886..9115) [1230 nt, 410 aa]
          Length = 409

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 40/70 (57%)

Query: 87  NAVRVSPSGTNLSSKEETLMKVNRYFPEIIINPSSPLLNDCNKPNGEVSLVVSNELHLNS 146
           N+   + SG+   S  E L +V ++FP +II  S  LL +CNK   +VSL  SN++ L  
Sbjct: 52  NSKETNNSGSKYPSPNEILARVGKHFPHLIIYGSHGLLTNCNKNYSDVSLPNSNDITLKE 111

Query: 147 SYCREPAKIL 156
            +  +P +IL
Sbjct: 112 EHLDDPGRIL 121

>Kpol_1008.22 s1008 complement(45208..46209) [1002 bp, 333 aa] {ON}
           complement(45208..46209) [1002 nt, 334 aa]
          Length = 333

 Score = 43.5 bits (101), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 43/77 (55%), Gaps = 3/77 (3%)

Query: 94  SGTNLSSKEETLMKVNRYFPEIIINPSSPLLNDCNKPNGEVSLVVSNELHLNSSYCREPA 153
           S + L S+ ETL KV R+FP ++I  +  L+ +CNK   EVS+ ++N+  L      +P 
Sbjct: 25  SRSKLPSQNETLAKVERHFPSLVIYGNHSLVANCNKDYSEVSVSMNNDAILKDEDIEDPL 84

Query: 154 KILYLI---LLNVYVPF 167
            +L  I   L+  +V F
Sbjct: 85  NVLLTIQSLLVGKHVRF 101

>Kpol_2000.36 s2000 complement(70426..71373) [948 bp, 315 aa] {ON}
           complement(70426..71373) [948 nt, 316 aa]
          Length = 315

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 43/81 (53%), Gaps = 3/81 (3%)

Query: 94  SGTNLSSKEETLMKVNRYFPEIIINPSSPLLNDCNKPNGEVSLVVSNELHLNSSYCREPA 153
           S + L S+ ETL KV R+FP ++I  +  L+ +C K   +VS+ ++N+  L      +P 
Sbjct: 152 SRSKLPSQNETLAKVERHFPSLVIYGNHSLVANCTKNYSDVSVPMNNDAILKDEDIEDPL 211

Query: 154 KILYLI---LLNVYVPFMMYS 171
            +L  I   L+  +V F  + 
Sbjct: 212 DVLLTIQGLLVGKHVRFQDWG 232

>Kpol_483.5 s483 complement(7611..9047) [1437 bp, 478 aa] {ON}
           complement(7611..9047) [1437 nt, 479 aa]
          Length = 478

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 35/67 (52%), Gaps = 4/67 (5%)

Query: 97  NLSSK----EETLMKVNRYFPEIIINPSSPLLNDCNKPNGEVSLVVSNELHLNSSYCREP 152
           NL SK     E L +V +YFP ++I  +  LL  C K   +VSLVV+ E+ L      +P
Sbjct: 124 NLESKLPPSNEILAQVRKYFPSLVIYENHSLLKSCIKAYSDVSLVVTREVILKDDDLEDP 183

Query: 153 AKILYLI 159
            + L  I
Sbjct: 184 VRTLMAI 190

>Kpol_526.5 s526 complement(5550..6044) [495 bp, 164 aa] {ON}
           complement(5550..6044) [495 nt, 165 aa]
          Length = 164

 Score = 38.1 bits (87), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 40/70 (57%)

Query: 87  NAVRVSPSGTNLSSKEETLMKVNRYFPEIIINPSSPLLNDCNKPNGEVSLVVSNELHLNS 146
           N+  ++ S +   S ++ L +V ++FP ++I  +  L+ +CNK   +VSL  +N++ L  
Sbjct: 52  NSKDINNSASKSPSPQDILARVGKHFPFLVIFGNHGLVANCNKNYSDVSLPSTNDITLKE 111

Query: 147 SYCREPAKIL 156
            +  +  +IL
Sbjct: 112 DHLDDQGRIL 121

>ABR137W Chr2 (653116..655983) [2868 bp, 955 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR120W (MSH1)
          Length = 955

 Score = 33.9 bits (76), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 26/48 (54%)

Query: 119 PSSPLLNDCNKPNGEVSLVVSNELHLNSSYCREPAKILYLILLNVYVP 166
           P +   NDC+  NG++ +V    +   S++ R+ A I+ L  +  YVP
Sbjct: 745 PGNFTANDCSLQNGDIWIVTGPNMGGKSTFLRQTAIIVILAQIGCYVP 792

>Kpol_541.2 s541 (2163..3044) [882 bp, 293 aa] {ON} (2163..3044)
           [882 nt, 294 aa]
          Length = 293

 Score = 32.7 bits (73), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%)

Query: 100 SKEETLMKVNRYFPEIIINPSSPLLNDCNKPNGEVSLVVSNELHLNSS 147
           SK+  + K+ R  PEII+    P +  C KP  + S+  + E+ +NS 
Sbjct: 65  SKKILINKIKRNLPEIILEADHPAIGTCTKPYSDTSIHRAPEMIINSG 112

>Suva_13.432 Chr13 complement(744705..749384) [4680 bp, 1559 aa]
           {ON} YMR247C (REAL)
          Length = 1559

 Score = 32.7 bits (73), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 54/121 (44%), Gaps = 18/121 (14%)

Query: 52  ALMSEVGKIEKYLDSEQDVLTNLINDKIEA-------KFADFNAVRVSPSGTNLSSKEET 104
           A M ++ K   +LDS  +VL   IN++I A          D+N +   P+ +     E T
Sbjct: 806 ASMQKLIKHALFLDSLLEVLPEYINNRIIAFITTVSEAVTDYNCLSAEPNDS-FYDFEHT 864

Query: 105 LM---KVNRYFPEIIINPSSPLLNDCNKPNGEVSLVVSNELHLNSSYCREPAKILYLILL 161
                K+N  FP +I + + P+ +D        SL   +    N  Y    ++ILY ILL
Sbjct: 865 FFKHGKINTDFPTVIESIAHPVDDDG-------SLFTDSVAKSNHVYFFYYSRILYKILL 917

Query: 162 N 162
           N
Sbjct: 918 N 918

>Ecym_8198 Chr8 complement(406687..409554) [2868 bp, 955 aa] {ON}
           similar to Ashbya gossypii ABR137W
          Length = 955

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 23/42 (54%)

Query: 125 NDCNKPNGEVSLVVSNELHLNSSYCREPAKILYLILLNVYVP 166
           NDCN  +G + ++    +   S++ R+ A I+ L  +  YVP
Sbjct: 752 NDCNVDSGNLWVITGPNMGGKSTFLRQTAIIVLLAQIGCYVP 793

>Ecym_4470 Chr4 complement(955124..956764) [1641 bp, 546 aa] {ON}
           similar to Ashbya gossypii ADR014W
          Length = 546

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 31/56 (55%)

Query: 39  IEGRILADERKQEALMSEVGKIEKYLDSEQDVLTNLINDKIEAKFADFNAVRVSPS 94
           +EGR + D++++EAL S+      + DS Q+ L   + + +E K    + V  SP+
Sbjct: 195 LEGRAVLDDKEEEALDSDGSLDSGFSDSSQEKLAAQLQEALEVKSPKDDEVEFSPT 250

>TBLA0I02920 Chr9 complement(693705..697718) [4014 bp, 1337 aa] {ON}
           Anc_4.240 YLR384C
          Length = 1337

 Score = 30.0 bits (66), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 29/67 (43%), Gaps = 4/67 (5%)

Query: 85  DFNAVRVSPSGTNLSSKEETLMKVNRYFPEI----IINPSSPLLNDCNKPNGEVSLVVSN 140
           DF  +RV    + L  +++ L K N   PE+    I N      ND    N   SL V+N
Sbjct: 599 DFRVIRVDNQHSTLEYEDDVLNKWNSQHPELVAFGITNTGKLFANDVQLTNAVTSLEVTN 658

Query: 141 ELHLNSS 147
              L ++
Sbjct: 659 SFLLFTT 665

>NCAS0A05330 Chr1 (1054164..1055234) [1071 bp, 356 aa] {ON} 
          Length = 356

 Score = 29.6 bits (65), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 4/51 (7%)

Query: 52  ALMSEVGKIEKYLDSEQDVLTNLINDKIEAKFADFNAVRVSPSGTNLSSKE 102
           A+ + +  +EKY+ SE D +++    KIE+K  D   VR    GT++SS +
Sbjct: 264 AIPTHLYGLEKYVTSELDAMSSTDEYKIESKCEDAEQVR----GTSVSSSQ 310

>KNAG0F02720 Chr6 complement(511178..516796) [5619 bp, 1872 aa] {ON}
            Anc_5.267 YHR023W
          Length = 1872

 Score = 29.3 bits (64), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 58/127 (45%), Gaps = 15/127 (11%)

Query: 13   SQINILKKGLENTSTQFSAVKKEEAAIEGRILADERKQEALMSEVGKIEKYLDSEQDVLT 72
            S I+ L+K L+ +S +FS   +E+  I G+I          + E   ++K    EQ++  
Sbjct: 1634 SDIDQLRKKLDESSDKFSNSVREKHDINGQI--------KYLEETLALQK----EQNIRN 1681

Query: 73   NLINDKIEAKFADFNAVRVSPSGTN--LSSKEETLMKVNRYFPEIIINPSSPLLNDCNKP 130
              +  K++A+  D+     +    N  L    +TL+KV+    E I       LND  + 
Sbjct: 1682 EELVQKLQAEMEDYREKFEAEKHANIELHEDHQTLVKVSTQLKEKIATLQEQ-LNDTTQK 1740

Query: 131  NGEVSLV 137
            +G ++ +
Sbjct: 1741 DGWIAKI 1747

>SAKL0F04730g Chr6 (379103..379133,379231..380489) [1290 bp, 429 aa]
           {ON} highly similar to uniprot|P29952 YER003C
           Saccharomyces cerevisiae PMI40 mannose-6-phosphate
           isomerase
          Length = 429

 Score = 28.5 bits (62), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 89  VRVSPSGTNLSSKEETLMKVNRYFPEII-INPSSPLLNDCNKPNGEVSLVVSNELH 143
            + SPS  N ++  E L+++N  FP+ I +     LLN C    GE   + + + H
Sbjct: 226 AKTSPSDFNKNTLPELLIRLNEQFPDDIGLFCGGLLLNHCTLKAGEAIFLRAKDPH 281

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.130    0.349 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,011,721
Number of extensions: 852522
Number of successful extensions: 3289
Number of sequences better than 10.0: 122
Number of HSP's gapped: 3284
Number of HSP's successfully gapped: 124
Length of query: 174
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 72
Effective length of database: 41,785,467
Effective search space: 3008553624
Effective search space used: 3008553624
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 62 (28.5 bits)