Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1037.306.26ON36736716720.0
TPHA0J003806.26ON3562848181e-107
ZYRO0C07634g6.26ON3822578001e-104
TDEL0G044306.26ON3472297811e-101
KNAG0I017506.26ON3242417634e-99
Suva_15.1746.26ON2952317457e-97
Smik_15.1696.26ON2912787386e-96
YOL001W (PHO80)6.26ON2932317388e-96
CAGL0E02541g6.26ON3422837421e-95
Ecym_30296.26ON3512297385e-95
ACR001C6.26ON3462597342e-94
Skud_15.1616.26ON2932637282e-94
SAKL0E01408g6.26ON3072307269e-94
Kwal_56.224436.26ON2802417203e-93
KLTH0C11110g6.26ON2802637142e-92
TBLA0A071606.26ON2682606993e-90
KLLA0D01287g6.26ON3452596967e-89
NCAS0D021506.26ON3692226058e-75
NDAI0C026406.26ON4272155211e-61
Skud_9.1197.240ON2851622103e-18
YIL050W (PCL7)7.240ON2851622061e-17
Smik_9.1407.240ON2851662052e-17
Suva_9.1497.240ON2861632042e-17
ADL075W7.240ON2071511755e-14
KNAG0D016307.240ON4381831816e-14
NCAS0E032207.240ON3412161743e-13
Ecym_43367.240ON3851201711e-12
NCAS0A134807.240ON4481301665e-12
SAKL0F08602g7.240ON4741551658e-12
KLLA0C08305g7.240ON4091741631e-11
Kwal_23.58077.240ON4651591622e-11
TPHA0C010907.240ON3851941612e-11
KLTH0A04268g7.240ON5801101622e-11
CAGL0M12342g7.240ON4571261594e-11
KAFR0I018407.240ON3251181558e-11
KAFR0L008807.240ON3131171503e-10
KNAG0L014707.240ON3541801504e-10
TDEL0H020207.240ON3631811496e-10
NDAI0A025607.240ON5031191471e-09
ZYRO0C08118g7.240ON4051921363e-08
YER059W (PCL6)7.240ON420671292e-07
TBLA0D040707.240ON661601302e-07
Smik_5.1897.240ON415601283e-07
Suva_5.1677.240ON424601283e-07
Kpol_1033.137.240ON250601253e-07
Skud_5.1737.240ON420641264e-07
NDAI0E047707.240ON303571229e-07
Kpol_2000.147.289ON3101091221e-06
TBLA0C048507.289ON368991151e-05
ZYRO0C09284g7.289ON3111161112e-05
YDL179W (PCL9)7.289ON3041051112e-05
CAGL0J09328g7.289ON297951103e-05
NCAS0A137707.289ON3121061094e-05
SAKL0F09856g7.289ON3351001095e-05
YDL127W (PCL2)7.289ON3081121078e-05
Suva_4.687.289ON3051071079e-05
CAGL0E02233g3.70ON2661071051e-04
TDEL0H015507.289ON3091121051e-04
TPHA0P008107.289ON2471331041e-04
Suva_14.503.70ON2791031042e-04
Suva_4.1187.289ON3091121023e-04
KNAG0A014903.70ON2621071014e-04
Kwal_23.60067.289ON3041091024e-04
Smik_4.1107.289ON3081121014e-04
NDAI0A022707.289ON3301051024e-04
TBLA0J006507.289ON363941014e-04
Kpol_1020.87.289ON2961161006e-04
AFR159C7.289ON308106997e-04
KLTH0H03674g6.236ON4841221008e-04
TPHA0A005803.70ON289113998e-04
Ecym_80387.289ON314112970.001
Skud_4.1287.289ON308112970.001
Skud_14.483.70ON279103960.002
Smik_14.423.70ON279103960.002
KLTH0A05346g7.289ON301110950.002
YNL289W (PCL1)3.70ON279103950.003
KLLA0E13223g3.70ON282104940.003
Kpol_1020.163.70ON282104940.003
Skud_4.797.289ON30998940.004
TBLA0A078903.70ON361103940.004
KAFR0A082803.70ON241123920.004
Smik_4.607.289ON305105930.004
NCAS0D040706.236ON473111930.005
KNAG0B029307.289ON312102920.006
KAFR0C015603.70ON26793890.011
SAKL0C12100g3.70ON31496900.012
ZYRO0C02068g3.70ON330115900.012
NCAS0A098703.70ON29493870.022
KNAG0F018706.236ON483107860.035
NDAI0A060503.70ON28696850.038
Skud_7.1396.236ON434150860.041
TPHA0A032507.289ON289121830.068
TDEL0E007903.70ON25497820.081
Smik_7.1386.236ON437106830.082
KLLA0F05654g7.289ON311114810.12
NDAI0C019805.347ON226106810.12
KLLA0B02024g6.236ON527130790.27
KAFR0L012007.289ON27996780.32
Suva_7.1306.236ON442104780.34
AEL195W3.70ON237117770.39
CAGL0H08998g6.236ON547105780.44
YGL134W (PCL10)6.236ON433104770.53
NDAI0F004605.677ON65749770.60
ZYRO0E07326g6.236ON428112760.69
TPHA0E027506.236ON605108760.76
KLLA0D17358g8.368ON184862751.1
Ecym_12013.527ON444114741.1
KAFR0K023856.236ON40892721.8
NDAI0C043005.347ON240107712.0
YHR071W (PCL5)5.347ON22970693.1
NCAS0H016505.347ON21098684.5
Skud_8.1295.347ON22089684.7
SAKL0A03938g6.236ON50185685.4
CAGL0J06336g7.289ON314114685.9
KAFR0B025508.234ON89069686.9
Skud_16.2808.86ON48962677.6
CAGL0J10846g5.347ON229101668.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1037.30
         (367 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {O...   648   0.0  
TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON...   319   e-107
ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} simila...   312   e-104
TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.2...   305   e-101
KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26...   298   4e-99
Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W...   291   7e-97
Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W...   288   6e-96
YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cycli...   288   8e-96
CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} simila...   290   1e-95
Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to ...   288   5e-95
ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON} S...   287   2e-94
Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W...   285   2e-94
SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar...   284   9e-94
Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W...   281   3e-93
KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {O...   279   2e-92
TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6....   273   3e-90
KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} simila...   272   7e-89
NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26     237   8e-75
NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {O...   205   1e-61
Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W (...    86   3e-18
YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p ...    84   1e-17
Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W (...    84   2e-17
Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W (...    83   2e-17
ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic hom...    72   5e-14
KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.2...    74   6e-14
NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {O...    72   3e-13
Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}...    70   1e-12
NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa] ...    69   5e-12
SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} simila...    68   8e-12
KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {...    67   1e-11
Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL05...    67   2e-11
TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {O...    67   2e-11
KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} simila...    67   2e-11
CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa...    66   4e-11
KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.24...    64   8e-11
KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.2...    62   3e-10
KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7....    62   4e-10
TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {O...    62   6e-10
NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.2...    61   1e-09
ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} simila...    57   3e-08
YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p...    54   2e-07
TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa] ...    55   2e-07
Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W ...    54   3e-07
Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W ...    54   3e-07
Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON} (30454.....    53   3e-07
Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W ...    53   4e-07
NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7....    52   9e-07
Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON} (24019.....    52   1e-06
TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa] ...    49   1e-05
ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {O...    47   2e-05
YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,...    47   2e-05
CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} simila...    47   3e-05
NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {...    47   4e-05
SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {...    47   5e-05
YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,...    46   8e-05
Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W (R...    46   9e-05
CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar...    45   1e-04
TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.28...    45   1e-04
TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {O...    45   1e-04
Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W (R...    45   2e-04
Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W (...    44   3e-04
KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70 Y...    44   4e-04
Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {...    44   4e-04
Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W (...    44   4e-04
NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289      44   4e-04
TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {...    44   4e-04
Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON} (18215..1...    43   6e-04
AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON} Sy...    43   7e-04
KLTH0H03674g Chr8 (333755..335209) [1455 bp, 484 aa] {ON} weakly...    43   8e-04
TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70...    43   8e-04
Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON} si...    42   0.001
Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W (...    42   0.001
Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W (R...    42   0.002
Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W (R...    42   0.002
KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {O...    41   0.002
YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin, ...    41   0.003
KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} simil...    41   0.003
Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON...    41   0.003
Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W (R...    41   0.004
TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3...    41   0.004
KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {...    40   0.004
Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W (R...    40   0.004
NCAS0D04070 Chr4 (764711..766132) [1422 bp, 473 aa] {ON} Anc_6.236     40   0.005
KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.28...    40   0.006
KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON...    39   0.011
SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa] ...    39   0.012
ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {O...    39   0.012
NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {...    38   0.022
KNAG0F01870 Chr6 (356849..358300) [1452 bp, 483 aa] {ON} Anc_6.2...    38   0.035
NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {...    37   0.038
Skud_7.139 Chr7 (260060..261364) [1305 bp, 434 aa] {ON} YGL134W ...    38   0.041
TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.28...    37   0.068
TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70...    36   0.081
Smik_7.138 Chr7 (249640..250953) [1314 bp, 437 aa] {ON} YGL134W ...    37   0.082
KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly ...    36   0.12 
NDAI0C01980 Chr3 complement(445212..445892) [681 bp, 226 aa] {ON...    36   0.12 
KLLA0B02024g Chr2 (176585..178168) [1584 bp, 527 aa] {ON} some s...    35   0.27 
KAFR0L01200 Chr12 complement(225099..225938) [840 bp, 279 aa] {O...    35   0.32 
Suva_7.130 Chr7 (251870..253198) [1329 bp, 442 aa] {ON} YGL134W ...    35   0.34 
AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic hom...    34   0.39 
CAGL0H08998g Chr8 (877952..879595) [1644 bp, 547 aa] {ON} weakly...    35   0.44 
YGL134W Chr7 (255663..256964) [1302 bp, 433 aa] {ON}  PCL10Pho85...    34   0.53 
NDAI0F00460 Chr6 complement(106641..108614) [1974 bp, 657 aa] {O...    34   0.60 
ZYRO0E07326g Chr5 complement(560064..561350) [1287 bp, 428 aa] {...    34   0.69 
TPHA0E02750 Chr5 (574999..576816) [1818 bp, 605 aa] {ON} Anc_6.2...    34   0.76 
KLLA0D17358g Chr4 complement(1477523..1483069) [5547 bp, 1848 aa...    33   1.1  
Ecym_1201 Chr1 (406247..407581) [1335 bp, 444 aa] {ON} similar t...    33   1.1  
KAFR0K02385 Chr11 complement(491679..492905) [1227 bp, 408 aa] {...    32   1.8  
NDAI0C04300 Chr3 (981107..981829) [723 bp, 240 aa] {ON}                32   2.0  
YHR071W Chr8 (237004..237693) [690 bp, 229 aa] {ON}  PCL5Cyclin,...    31   3.1  
NCAS0H01650 Chr8 complement(316598..317230) [633 bp, 210 aa] {ON...    31   4.5  
Skud_8.129 Chr8 (210309..210971) [663 bp, 220 aa] {ON} YHR071W (...    31   4.7  
SAKL0A03938g Chr1 (367076..368581) [1506 bp, 501 aa] {ON} weakly...    31   5.4  
CAGL0J06336g Chr10 complement(602954..603898) [945 bp, 314 aa] {...    31   5.9  
KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.2...    31   6.9  
Skud_16.280 Chr16 (516846..518315) [1470 bp, 489 aa] {ON} YPL003...    30   7.6  
CAGL0J10846g Chr10 complement(1058824..1059513) [690 bp, 229 aa]...    30   8.5  

>Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {ON}
           complement(72024..73127) [1104 nt, 368 aa]
          Length = 367

 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/367 (88%), Positives = 324/367 (88%)

Query: 1   MKKEILSKQFKSIDNSMHRSXXXXXXXXXXXXXXXXXXXXXXXXXXTLPPKFIDCSRSDL 60
           MKKEILSKQFKSIDNSMHRS                          TLPPKFIDCSRSDL
Sbjct: 1   MKKEILSKQFKSIDNSMHRSGNQGENNNSKNVSNENKIEIENIETITLPPKFIDCSRSDL 60

Query: 61  VALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRFHSRVPPNISVYNYLIRLTKY 120
           VALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRFHSRVPPNISVYNYLIRLTKY
Sbjct: 61  VALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRFHSRVPPNISVYNYLIRLTKY 120

Query: 121 SSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLTATTIASKGLCDSFCTNSHYSKV 180
           SSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLTATTIASKGLCDSFCTNSHYSKV
Sbjct: 121 SSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLTATTIASKGLCDSFCTNSHYSKV 180

Query: 181 GGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQQNKFTMDFSDLSMVGMTVQSNH 240
           GGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQQNKFTMDFSDLSMVGMTVQSNH
Sbjct: 181 GGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQQNKFTMDFSDLSMVGMTVQSNH 240

Query: 241 QNSGFNILDIYYHKIVQLVGSFSASSDKSRKANYTLLLSGNNMEKEVSNNIKENSNGQNI 300
           QNSGFNILDIYYHKIVQLVGSFSASSDKSRKANYTLLLSGNNMEKEVSNNIKENSNGQNI
Sbjct: 241 QNSGFNILDIYYHKIVQLVGSFSASSDKSRKANYTLLLSGNNMEKEVSNNIKENSNGQNI 300

Query: 301 GESEQAISSKLSRDPPPKRNFETIXXXXXXXXXXXXXXXXXSSKRLQKYSITRTDSIEYD 360
           GESEQAISSKLSRDPPPKRNFETI                 SSKRLQKYSITRTDSIEYD
Sbjct: 301 GESEQAISSKLSRDPPPKRNFETINNERQTTYTNNTTNETESSKRLQKYSITRTDSIEYD 360

Query: 361 KSKRNNA 367
           KSKRNNA
Sbjct: 361 KSKRNNA 367

>TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON}
           Anc_6.26 YOL001W
          Length = 356

 Score =  319 bits (818), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 166/284 (58%), Positives = 203/284 (71%), Gaps = 21/284 (7%)

Query: 48  LPPKFIDCSRSDLVALIARMLSFLIEMND-NDPANTNYLNEEPNNRSVMN--------LT 98
           LP  F+ CSRSDLV LI+RML+FLI++ND N+    N     P    V N        LT
Sbjct: 37  LPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVNNKNNNNMINLT 96

Query: 99  RFHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLT 158
           RFHSRVPPNISV NYLIRLTKY+SLEH VLLS++YYIDLLSSVYPEFKINSLTVHRFLL 
Sbjct: 97  RFHSRVPPNISVNNYLIRLTKYASLEHSVLLSSLYYIDLLSSVYPEFKINSLTVHRFLLA 156

Query: 159 ATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQ 218
           ATT+ASKGL DSFCTNSHY+KVGGV CSELNILET+FLRR+NYRIIPRDDNIKLCK+E +
Sbjct: 157 ATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLCKLEKK 216

Query: 219 QNKFTMDFSDLSMVGMTVQSNHQNSGFNILDIYYHKIVQLVGSFSASSDKSRKANYTLLL 278
            ++FT+D  DL    +  +  H NSG+N+L+IYY K+VQ+VG    S+DKS+K NY +  
Sbjct: 217 SSQFTLDLGDLLAANIQPELTHPNSGYNVLNIYYRKMVQIVGLLKNSTDKSKKVNYIIQT 276

Query: 279 SGNNMEKEVSNNIKENSNGQNIGESEQAISSKLSRDPPPKRNFE 322
           + N            ++N  +I ++ + I        P KRN++
Sbjct: 277 NYN------------DTNISDIDDNRKVIQIYAQHITPQKRNYD 308

>ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 382

 Score =  312 bits (800), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 155/257 (60%), Positives = 193/257 (75%), Gaps = 13/257 (5%)

Query: 48  LPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRFHSRVPPN 107
           LP +F +CSR+DLV LI+RML+FLI+MND+  ++T+ L+      SV NLT+FHS+VPP 
Sbjct: 47  LPKRFSECSRTDLVILISRMLTFLIQMNDS--SSTSALD------SVTNLTKFHSKVPPG 98

Query: 108 ISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLTATTIASKGL 167
           ISVYNYL+RLTKYSSL+HCVL++ VYYIDL+SSVYP F +NSLTVHRFLLTATT+ASKGL
Sbjct: 99  ISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFLLTATTVASKGL 158

Query: 168 CDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQQNKF---TM 224
           CDSFCTN+HY+KVGGVHCSELN+LE E LRR+NYRIIPRDDNI  C +E Q   F   T 
Sbjct: 159 CDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQHRHFVLDTQ 218

Query: 225 DFSDLSMVGMTVQSNHQNSGFNILDIYYHKIVQLVGSFSASSDKSRKANYTLL--LSGNN 282
           D  D + +   +  N  NSG+N+LD YY+KIVQLVGS  ++ DKS+  NYT    L   N
Sbjct: 219 DGDDWTPILSNLSGNRNNSGYNVLDTYYNKIVQLVGSLKSTQDKSKLVNYTFANTLKPTN 278

Query: 283 MEKEVSNNIKENSNGQN 299
           +      N+  + +G N
Sbjct: 279 IHNNEGLNLNPSPSGNN 295

>TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.26
           YOL001W
          Length = 347

 Score =  305 bits (781), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 151/229 (65%), Positives = 180/229 (78%), Gaps = 8/229 (3%)

Query: 48  LPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRFHSRVPPN 107
           LP KF  CSR+DL  LI+RML+FLI++ND     +  L++  N R    LTRFHSRVPP 
Sbjct: 35  LPRKFSKCSRTDLAVLISRMLTFLIQIND-----SLALSKPENAR---GLTRFHSRVPPG 86

Query: 108 ISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLTATTIASKGL 167
           ISVYNYLIRLTKYSSLEHCVLL+ VYYIDLLSSVYP F ++SLTVHRFLLTATT+ASKGL
Sbjct: 87  ISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTVHRFLLTATTVASKGL 146

Query: 168 CDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQQNKFTMDFS 227
           CDSFCTN+HY+KVGGVH SELNILE EFL+RVNYRI+PRDDNI  CK+E +  KFT+   
Sbjct: 147 CDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNIDWCKLETKLQKFTLYEE 206

Query: 228 DLSMVGMTVQSNHQNSGFNILDIYYHKIVQLVGSFSASSDKSRKANYTL 276
                    Q++ +NSG+N+LD Y+ KIVQLVGS+++S DKS+  NY L
Sbjct: 207 PEMGQNSRPQNSLKNSGYNVLDAYFRKIVQLVGSYASSPDKSKVVNYVL 255

>KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26
           YOL001W
          Length = 324

 Score =  298 bits (763), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 145/241 (60%), Positives = 185/241 (76%), Gaps = 12/241 (4%)

Query: 47  TLPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNE----------EPNNRSVMN 96
           +LP  F  CSR DL+ALI+RML FLI++ND+       L +          + +  S   
Sbjct: 25  SLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAADTDGSSETK 84

Query: 97  LTRFHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFL 156
           LTRFHS VPP ISVYNYLIRLTKYS+LE  VLL+++YYIDLLSSVYP F INSLTVHRFL
Sbjct: 85  LTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSLTVHRFL 144

Query: 157 LTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIE 216
           LTATT+ASKGLCDSFCTN+HY+KVGGV  SELNILE+EFL+++NYR++PRDDNI  CK E
Sbjct: 145 LTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRDDNITWCKYE 204

Query: 217 HQQNKFTMDFSDLSMVGMTVQSNHQ-NSGFNILDIYYHKIVQLVGSFSASSDKSRKANYT 275
           H+ ++FT+ ++  ++  ++  ++ Q NSG+N+L +YYHKI+QLVG FS+S DKS+KANY 
Sbjct: 205 HRAHEFTI-YNKAALTNVSKPTHTQRNSGYNVLQMYYHKIIQLVGKFSSSLDKSKKANYV 263

Query: 276 L 276
            
Sbjct: 264 F 264

>Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W
           (REAL)
          Length = 295

 Score =  291 bits (745), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 139/231 (60%), Positives = 176/231 (76%), Gaps = 10/231 (4%)

Query: 48  LPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRFHSRVPPN 107
           LP +F  CSR+DLV LI+RML  LI +N+N         + P+++  + LTR+HS++PPN
Sbjct: 23  LPSEFKKCSRTDLVVLISRMLVSLIAINENSST------KRPDDQ--ITLTRYHSKIPPN 74

Query: 108 ISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLTATTIASKGL 167
           IS++NY IRLTK+SSLEHCVL++++YYIDLL + YP+F +NSLT HRFLLTATT+A+KGL
Sbjct: 75  ISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGL 134

Query: 168 CDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQQNKFTMDFS 227
           CDSF TN+HYSKVGGV C ELNILE +FL+RVNYRI+PRD NI LC IE +Q  F +D +
Sbjct: 135 CDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCSIEQKQKTFVIDKN 194

Query: 228 DLSMV--GMTVQSNHQNSGFNILDIYYHKIVQLVGSFSASSDKSRKANYTL 276
            L  V  G    +N   SG+N+LD YY +IVQLVGSF AS DKSR+ NY L
Sbjct: 195 ALGSVDLGSYSYANRSKSGYNVLDKYYQRIVQLVGSFDASPDKSRRVNYAL 245

>Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W
           (REAL)
          Length = 291

 Score =  288 bits (738), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 151/278 (54%), Positives = 195/278 (70%), Gaps = 24/278 (8%)

Query: 48  LPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRFHSRVPPN 107
           LP  F  CSR+DLV LI+RML  LI +N+N       +++ P N+  + LTR+HS++PPN
Sbjct: 23  LPTDFNKCSRTDLVVLISRMLVSLIAINENS------VSKIPENQ--ITLTRYHSKIPPN 74

Query: 108 ISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLTATTIASKGL 167
           IS++NY IRLTK+SSLEHCVL++++YYIDLL + YP+F +NSLT HRFLLTATTIA+KGL
Sbjct: 75  ISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTIATKGL 134

Query: 168 CDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQQNKFTMDFS 227
           CDSF TN+HY+KVGGV C ELNILE +FL+RVNYRIIPRD NI LC IE +Q KF +D +
Sbjct: 135 CDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCSIEQKQKKFVIDKN 194

Query: 228 DLSMVGMTVQS--NHQNSGFNILDIYYHKIVQLVGSFSASSDKSRKANYTLLLSGNNMEK 285
            L    +   S  +   SG+N+LD YY +IVQLVGSF+AS DKS+K +Y L         
Sbjct: 195 ALGSFDLDSYSYTDRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKKIDYVL--------- 245

Query: 286 EVSNNIKENSNGQNIGESEQAISSKLSRDPPPKRNFET 323
             SN  K+N +G  I E   ++ +  S+    KRN E 
Sbjct: 246 -PSNIDKDNESGPQINEQRGSLPNHYSQ----KRNSEA 278

>YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cyclin,
           interacts with cyclin-dependent kinase Pho85p; regulates
           the response to nutrient levels and environmental
           conditions, including the response to phosphate
           limitation and stress-dependent calcium signaling
          Length = 293

 Score =  288 bits (738), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 139/231 (60%), Positives = 174/231 (75%), Gaps = 10/231 (4%)

Query: 48  LPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRFHSRVPPN 107
           LP  F  CSR+DLV LI+RML  LI +N+N             +   + LTR+HS++PPN
Sbjct: 23  LPADFNKCSRTDLVVLISRMLVSLIAINENSATK--------KSDDQITLTRYHSKIPPN 74

Query: 108 ISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLTATTIASKGL 167
           IS++NY IRLTK+SSLEHCVL++++YYIDLL +VYP+F +NSLT HRFLLTATT+A+KGL
Sbjct: 75  ISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAHRFLLTATTVATKGL 134

Query: 168 CDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQQNKFTMDFS 227
           CDSF TN+HY+KVGGV C ELNILE +FL+RVNYRIIPRD NI LC IE +Q KF +D +
Sbjct: 135 CDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVIDKN 194

Query: 228 DLSMVGMTVQS--NHQNSGFNILDIYYHKIVQLVGSFSASSDKSRKANYTL 276
            L  + +   S  N   SG+N+LD YY +IVQLVGSF+AS DKSRK +Y L
Sbjct: 195 ALGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRKVDYVL 245

>CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001w PHO80
           cyclin
          Length = 342

 Score =  290 bits (742), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 148/283 (52%), Positives = 197/283 (69%), Gaps = 15/283 (5%)

Query: 48  LPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRFHSRVPPN 107
           LP  F+ C + DLV LIARML F+I++ND+        N + N R    LTRFHS++ PN
Sbjct: 19  LPRDFLKCPKGDLVILIARMLQFIIQINDS--------NIKENERK-YGLTRFHSKIAPN 69

Query: 108 ISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLTATTIASKGL 167
           ISV+NY  RLTKYS LEH VLLS VYYIDLLS+VYP F +NSLT HRFLLTATTIASKGL
Sbjct: 70  ISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTATTIASKGL 129

Query: 168 CDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQQNKFTMDFS 227
           CDSFCTN+HYSKVGGV C+ELN+LE EFLR+VNYRIIPRD+NI  CK+E Q+N F +  S
Sbjct: 130 CDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQKNFFILPES 189

Query: 228 DLSMVGMTVQSNH---QNSGFNILDIYYHKIVQLVGSFSASSDKSRKANYTLLLSGNNME 284
             S +  +++  +    N+G+N+L  YY+KI+++VG +S+S DK++K NY + +    + 
Sbjct: 190 IESDLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKTKKVNYDIDMPAKTLH 249

Query: 285 KEVSNNIKENSNGQNIGESEQAISSKLSRDPP---PKRNFETI 324
           +   N+  +N +  N      + +  + +  P   PKRNF+T+
Sbjct: 250 EHQQNDAVKNCSNNNSNYQTASNNIPIPQTIPQNRPKRNFDTV 292

>Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR001C
          Length = 351

 Score =  288 bits (738), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 142/229 (62%), Positives = 179/229 (78%), Gaps = 14/229 (6%)

Query: 48  LPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRFHSRVPPN 107
           LP KF+DCSR+ LV LI+RMLS LI +ND   A T          + + LTRFHSRVPP+
Sbjct: 25  LPRKFLDCSRTHLVVLISRMLSSLIRLND---AYTE--------SNTLQLTRFHSRVPPS 73

Query: 108 ISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLTATTIASKGL 167
           ISVY+YLIRLTKYSSLEHCVLL++VYYIDLLSSV+PEF+++SLTVHRFLLTATT+ASKGL
Sbjct: 74  ISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLTATTVASKGL 133

Query: 168 CDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQQNKFTMDFS 227
           CDSFCTN+HY+KVGGV C+ELN+LE EFL RVNYRI+PRD+NIK C  EHQ+  F+  F+
Sbjct: 134 CDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQEGTFS--FA 191

Query: 228 DLSMVGMTVQSNHQNSGFNILDIYYHKIVQLVGSFSASSDKSRKANYTL 276
           ++       Q + +N  F++L+ YYH+++ L+G+  AS DKS   N+TL
Sbjct: 192 NIPADAEQDQKSEENR-FDVLENYYHRMIHLIGNLDASPDKSYDLNFTL 239

>ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL001W
           (PHO80)
          Length = 346

 Score =  287 bits (734), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 144/259 (55%), Positives = 185/259 (71%), Gaps = 24/259 (9%)

Query: 48  LPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRFHSRVPPN 107
           LP +F+ CSR+ LV LI+RML+ LI MND           + +    + LTRFHSRVPP 
Sbjct: 18  LPRQFLSCSRTYLVVLISRMLTSLIGMND----------AQGDKSKPIKLTRFHSRVPPA 67

Query: 108 ISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLTATTIASKGL 167
           ISVYNYLIRLTKYSSLEHCVLL++VYYIDLL++VYPEF+++SLTVHRFLLTATT+ASKGL
Sbjct: 68  ISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLTATTVASKGL 127

Query: 168 CDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQQNKFTMDFS 227
           CDSFCTN+HY+KVGGV CSELN+LE EFL RVNYRI+PRDDNI+ C +E Q+  F+  +S
Sbjct: 128 CDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQERIFS--YS 185

Query: 228 DLSMVGMTVQSNHQNSGFNILDIYYHKIVQLVGSFSASSDKSRKANYTL----------- 276
           ++ M         +N+GF +L+ YYH+++ L+G F+ S DKS   ++TL           
Sbjct: 186 NIPM-DKDCALQDRNNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLSFTLAESPTNSIQKT 244

Query: 277 LLSGNNMEKEVSNNIKENS 295
           L  GN+ +     NI + S
Sbjct: 245 LPGGNDFQTAYPGNIDDGS 263

>Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W
           (REAL)
          Length = 293

 Score =  285 bits (728), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 143/263 (54%), Positives = 187/263 (71%), Gaps = 20/263 (7%)

Query: 48  LPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRFHSRVPPN 107
           LP +F  CSR+DLV LI+RML  LI +N+N         ++P+++  + LTR+HS+VPPN
Sbjct: 23  LPAEFYKCSRTDLVVLISRMLVSLIAINENS------TTKKPDDQ--ITLTRYHSKVPPN 74

Query: 108 ISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLTATTIASKGL 167
           IS++NY IRLTK+SSLEHCVL++++YYIDLL + YP+F +NSLT HRFLLTATT+A+KGL
Sbjct: 75  ISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGL 134

Query: 168 CDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQQNKFTMDFS 227
           CDSF TN+HY+KVGGV C ELNILE +FL+RVNYRIIPRD NI LC IE +Q KF  D +
Sbjct: 135 CDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVADKN 194

Query: 228 DLSMVGMTVQS--NHQNSGFNILDIYYHKIVQLVGSFSASSDKSRKANYTLLLSGNNMEK 285
                 +   S  +   SG+N+LD YY +IVQLVGSF+AS DKS+K +Y L         
Sbjct: 195 APGSFDLDSYSYVSRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKKVDYVL--------- 245

Query: 286 EVSNNIKENSNGQNIGESEQAIS 308
             SN  K+  +G  I + +  +S
Sbjct: 246 -PSNIDKDTESGPQIQQQKGTLS 267

>SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar to
           uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 307

 Score =  284 bits (726), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 144/230 (62%), Positives = 170/230 (73%), Gaps = 20/230 (8%)

Query: 48  LPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRFHSRVPPN 107
           LP +F+ CSR+ LV LI+RMLS LI+MND+   + N           + LTRFHSRVPP 
Sbjct: 49  LPDEFLKCSRTALVVLISRMLSSLIQMNDSMCKDKN-----------LKLTRFHSRVPPG 97

Query: 108 ISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLTATTIASKGL 167
           ISVYNYLIRL KYSSLE  VL++ VYYIDLLSSVYP F +NSLTVHRFLLTATT+ASKGL
Sbjct: 98  ISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGL 157

Query: 168 CDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQQNKF-TMDF 226
            DSFCTN HY+KVGGV CSELN+LETEFL+RVNYRIIPRDDNI  CK E+QQ  F T   
Sbjct: 158 SDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGVFITFPL 217

Query: 227 SDLSMVGMTVQSNHQNSGFNILDIYYHKIVQLVGSFSASSDKSRKANYTL 276
           +D        +    N+GFN+LD YY K++QLVG  ++S DK+ K +Y L
Sbjct: 218 AD--------KIKGPNNGFNVLDTYYKKMIQLVGPSNSSPDKTSKVSYVL 259

>Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W
           (PHO80) - The Pho80p Cyclin [contig 185] FULL
          Length = 280

 Score =  281 bits (720), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 138/241 (57%), Positives = 176/241 (73%), Gaps = 20/241 (8%)

Query: 47  TLPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRFHSRVPP 106
            LP  F  CSR+DLV LI+RMLSFL  +ND+ P +               LTRFHSRVPP
Sbjct: 33  ALPEDFSQCSRTDLVILISRMLSFLTRINDSVPKD-----------DAKELTRFHSRVPP 81

Query: 107 NISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLTATTIASKG 166
            ISVY+Y++RLT+YSSLE  VL+++VYYIDLLS++YP F +NSLTVHRFLLTATT+ASKG
Sbjct: 82  QISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFLLTATTVASKG 141

Query: 167 LCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQQNKFTMDF 226
           LCDSFCTNSHY+KVGGV CSEL++LE+EFL++VNYRI+PRDDNI  CK E +   F    
Sbjct: 142 LCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKKAGLFVTPT 201

Query: 227 SDLSMVGMTVQSNHQNSGFNILDIYYHKIVQLVGSFSASSDKSRKANYTLLLSGNNMEKE 286
              S  G        N+GFN+LD YY KI+++VGSF +S DK+++A+Y ++   +N  K+
Sbjct: 202 YSKSCRG-------PNNGFNVLDTYYRKIIEIVGSFDSSPDKTKRAHYVMI--NSNTRKD 252

Query: 287 V 287
           V
Sbjct: 253 V 253

>KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {ON}
           similar to uniprot|P20052 Saccharomyces cerevisiae
           YOL001W PHO80 Cyclin negatively regulates phosphate
           metabolism Pho80p-Pho85p (cyclin-CDK complex)
           phosphorylates Pho4p and Swi5p deletion of PHO80 leads
           to aminoglycoside supersensitivity truncated form of
           PHO80 affects vacuole inheritance
          Length = 280

 Score =  279 bits (714), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 139/263 (52%), Positives = 181/263 (68%), Gaps = 20/263 (7%)

Query: 47  TLPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRFHSRVPP 106
            LP  F  C R+DLV LI+RMLSFLI +ND+ P + +             LTRFHSRVPP
Sbjct: 33  ALPNDFSQCPRTDLVILISRMLSFLIRINDSIPKDNS-----------SELTRFHSRVPP 81

Query: 107 NISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLTATTIASKG 166
            ISVY+YL+RLT+YSSLE  VL+++VYYIDLLS++Y  F +NSLTVHRFLLTATT+ SKG
Sbjct: 82  QISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNSLTVHRFLLTATTVGSKG 141

Query: 167 LCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQQNKFTMDF 226
           LCDSFCTNSHY+KVGGV CSEL++LE+EFL+RVNYRI+PRDDNI  CK E ++  F    
Sbjct: 142 LCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDNILNCKAERREGLFV--- 198

Query: 227 SDLSMVGMTVQSNHQNSGFNILDIYYHKIVQLVGSFSASSDKSRKANYTLLLSGNNMEKE 286
                     ++   N+GFN+LD YY KI+++VGS+ +S DK+++A+Y +       E E
Sbjct: 199 ----TATYAKENRGPNNGFNVLDTYYQKIIEIVGSYDSSPDKTKRAHYVMKTPPAPREAE 254

Query: 287 VSNNIKENSNGQNIGESEQAISS 309
                + +   ++ G   QA SS
Sbjct: 255 APKKKRAHEESESAG--SQASSS 275

>TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6.26
           YOL001W
          Length = 268

 Score =  273 bits (699), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 141/260 (54%), Positives = 189/260 (72%), Gaps = 12/260 (4%)

Query: 47  TLPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRFHSRVPP 106
            L   F+ CS+ DL+ LI+RMLSF I++ND+   + N  N   N  S + LTRFHS+VPP
Sbjct: 13  VLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTN---NRLSPLFLTRFHSKVPP 69

Query: 107 NISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLTATTIASKG 166
           NIS+++YLIRLTKYSSLE  VL+++VYYIDLLS+VYPEF +NSLTVHR+LLTATTIASKG
Sbjct: 70  NISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLTATTIASKG 129

Query: 167 LCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQQNKFTMDF 226
           LCDSFCTNSHY+KVGG+ C+ELN+LETEFL RV YR+IPRD+ IKLCK+E++ +      
Sbjct: 130 LCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEYKYSPIEDIN 189

Query: 227 SDLSMVGMTVQSNHQNSGFNILDIYYHKIVQLVGSFSASSDKSRKANYTLLLSGNNMEKE 286
           +D+      +    QNSG+N+L  YY+K+VQLVG+  +S +  R  NY   ++    + E
Sbjct: 190 NDIH-----IPDELQNSGYNVLSTYYNKMVQLVGNCKSSKNSFRNVNYIFSIN----QDE 240

Query: 287 VSNNIKENSNGQNIGESEQA 306
           + N++ E     +I  ++QA
Sbjct: 241 IYNSMPELEKPNHIIPTQQA 260

>KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 345

 Score =  272 bits (696), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 144/259 (55%), Positives = 178/259 (68%), Gaps = 24/259 (9%)

Query: 48  LPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRFHSRVPPN 107
           LP +++ CSR+ LV +I+RMLSFLI++ND + A              M LTRFHS+  P+
Sbjct: 21  LPEEYLRCSRTHLVVIISRMLSFLIQINDANNAGN----------QTMELTRFHSKAAPS 70

Query: 108 ISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLTATTIASKGL 167
           I+VY YLIRLTKYSSLEH VLLS VYYIDLLS+VYPEF +NSLTVHRFLLTATTIASKGL
Sbjct: 71  ITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLTATTIASKGL 130

Query: 168 CDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQQNKFTMDFS 227
           CDSFCTN+HYSKVGGV CSELNILE EFL RV YRIIPRDDNI+ CKIE +        S
Sbjct: 131 CDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQKLG------S 184

Query: 228 DLSMVGMTVQSNHQNSGFNILDIYYHKIVQLVGSFSASSDKSRKANYTLL------LSGN 281
           ++ +          ++GFN+L  YY KIVQLVG+   S DK+    + ++      + G 
Sbjct: 185 NMLIPMKNASQRGPDNGFNVLQNYYRKIVQLVGNPLNSPDKTSTYFFKMVDPMNPGIGGT 244

Query: 282 NMEKE--VSNNIKENSNGQ 298
            +     + NN+K+  NG+
Sbjct: 245 LVPPSTTIKNNLKDKGNGR 263

>NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26
          Length = 369

 Score =  237 bits (605), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 154/222 (69%), Gaps = 10/222 (4%)

Query: 48  LPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRFHSRVPPN 107
           +P ++I CSRSDLV L++RML  LI+ ND             ++ S M+LTRFHSR+PPN
Sbjct: 31  VPYEYIKCSRSDLVVLVSRMLVLLIQSND-----MTSNTSNSSSDSNMHLTRFHSRIPPN 85

Query: 108 ISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLTATTIASKGL 167
           IS++NYL RLTKY  +EHCVLLS +YYIDL ++ YP F  NSLT HRFLLTA T+A KGL
Sbjct: 86  ISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTAHRFLLTAITVAGKGL 145

Query: 168 CDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQQNKFTMDFS 227
           CDSFCT + Y+K+GGV   ELNILET FLR VNYRIIPR  N+ L K+E     FT+D  
Sbjct: 146 CDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLIKLERGNQVFTLDHL 205

Query: 228 DLSMVGMTVQSNH--QNSGFNILDIYYHKIVQLVGSFSASSD 267
           D+    ++  S     ++G+++L+IYY  IV++ G   ASSD
Sbjct: 206 DMKDPKLSFLSYDYLPDNGYSVLNIYYQNIVRITG---ASSD 244

>NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {ON}
           Anc_6.26 YOL001W
          Length = 427

 Score =  205 bits (521), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 105/215 (48%), Positives = 145/215 (67%), Gaps = 9/215 (4%)

Query: 47  TLPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRFHSRVPP 106
           TLP KF++C R DLV LI+RML  LI++ND   AN N L   P+N +    TRFHSRV P
Sbjct: 58  TLPIKFMECPRRDLVVLISRMLVTLIKINDTK-ANDNNL---PSNYA----TRFHSRVIP 109

Query: 107 NISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLTATTIASKG 166
            IS+ NYL+RLTK+  L+  VLL+ VYYIDLLS+V+P F  NSLT HRF+LTA  +ASK 
Sbjct: 110 GISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIVASKS 169

Query: 167 LCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQQNKFTMDF 226
           LCDS  + +HY+K GGV  +EL +LE  FL+ + YR++PRD N  LC +E+  + F ++ 
Sbjct: 170 LCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHFDTFALND 229

Query: 227 SDLSMVGMTVQSNH-QNSGFNILDIYYHKIVQLVG 260
             +   G +       +SG+N+L +YY +I+ ++G
Sbjct: 230 GQIKESGTSFSYRQLPHSGYNVLHMYYRRIIDIIG 264

>Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 85.5 bits (210), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 86/162 (53%), Gaps = 11/162 (6%)

Query: 54  DCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRFHSRVPPNISVYNY 113
           D S  +L+ +I+ +L+ ++  ND     +  ++++  +  +  +  F+ +  P ISV  Y
Sbjct: 104 DFSTDELIQMISALLNRIVTANDEYAEISQQVSKDNQDELLAPILAFYGKSVPEISVVQY 163

Query: 114 LIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFK-----------INSLTVHRFLLTATTI 162
           L R+ KY    + + LS + Y D +S  Y  F            ++S  +HR L+T  TI
Sbjct: 164 LERIQKYCPTTNDIFLSLLVYFDRISKKYGHFSDRNAHTKQMFGMDSGNIHRLLITGITI 223

Query: 163 ASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRII 204
            +K L D F +NS Y+KVGG+   ELN LE +FL   +++++
Sbjct: 224 CTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 265

>YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p
           cyclin of the Pho80p subfamily, forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p; involved in glycogen
           metabolism, expression is cell-cycle regulated
          Length = 285

 Score = 84.0 bits (206), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 85/162 (52%), Gaps = 11/162 (6%)

Query: 54  DCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRFHSRVPPNISVYNY 113
           D    +L+ +I+ +L+ +I  ND     +  +++E  +  +  +  F+ +  P I+V  Y
Sbjct: 104 DFPTDELILMISALLNRIITANDETTDVSQQVSDETEDELLTPILAFYGKNVPEIAVVQY 163

Query: 114 LIRLTKYSSLEHCVLLSTVYYIDLLSSVYPE-----------FKINSLTVHRFLLTATTI 162
           L R+ KY    + + LS + Y D +S  Y             F ++S  +HR L+T  TI
Sbjct: 164 LERIQKYCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQLFVMDSGNIHRLLITGVTI 223

Query: 163 ASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRII 204
            +K L D F +NS Y+KVGG+   ELN LE +FL   +++++
Sbjct: 224 CTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKLL 265

>Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 83.6 bits (205), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 54/166 (32%), Positives = 88/166 (53%), Gaps = 17/166 (10%)

Query: 53  IDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLT---RFHSRVPPNIS 109
           +D    +L+ +++ +L+ +I +ND   A T+   + P +     LT    F+ +  P I 
Sbjct: 103 VDFPTDELIIMVSALLNKIITVND---ATTDISQQVPGDTEEKFLTPILAFYGKNVPEID 159

Query: 110 VYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVY---PE--------FKINSLTVHRFLLT 158
           V  YL R+ KY    + + LS + Y D +S  Y   PE        F ++S  +HR L+T
Sbjct: 160 VVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGHSPEENGHSKQLFVMDSGNIHRLLIT 219

Query: 159 ATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRII 204
             TI +K L D F +NS Y+KVGG+   ELN LE +FL   +++++
Sbjct: 220 GITICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 265

>Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W
           (REAL)
          Length = 286

 Score = 83.2 bits (204), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 88/163 (53%), Gaps = 11/163 (6%)

Query: 53  IDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRFHSRVPPNISVYN 112
           +D    +L+ +++ +L+ +++ ND     +  + E+  +  +  +  F+ +  P I+V  
Sbjct: 104 VDFPTDELILMVSALLNKIVKANDETTDPSQQVVEDGEDELLAPVLAFYGKNVPEIAVVQ 163

Query: 113 YLIRLTKYSSLEHCVLLSTVYYIDLLSSVY---PE--------FKINSLTVHRFLLTATT 161
           YL R+ KY    + + LS + Y D +S  Y   P+        F ++S  +HR L+T  T
Sbjct: 164 YLERIQKYCPTTNDIFLSLLVYFDRISKNYGSSPDRNGHVRQIFVMDSGNIHRLLITGIT 223

Query: 162 IASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRII 204
           I +K + D F +NS Y+KVGG+   ELN LE +FL   +++++
Sbjct: 224 ICTKFMSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 266

>ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL050W (PCL7) and
           YER059W (PCL6)
          Length = 207

 Score = 72.0 bits (175), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 84/151 (55%), Gaps = 8/151 (5%)

Query: 60  LVALIARMLSFLIEMNDN-DPANTNYLNEEPNNRSVMNLTRFHSRVPPNISVYNYLIRLT 118
           L+ ++  +L  +I+ ND   P +      + NN+ V ++  F  +  P I++ +Y  R+ 
Sbjct: 26  LLEMLTGLLYKIIKSNDRLKPFDQE--KHDINNKYVAHVLSFRGKHIPTITLGDYFARIQ 83

Query: 119 KYSSLEHCVLLSTVYYIDLLS----SVYPE-FKINSLTVHRFLLTATTIASKGLCDSFCT 173
           KY  + + V LS + Y D ++    ++ P+ F ++S  +HR ++ A T+++K   D F +
Sbjct: 84  KYCPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYNIHRLIIAAVTVSTKFFSDFFYS 143

Query: 174 NSHYSKVGGVHCSELNILETEFLRRVNYRII 204
           NS Y++VGG+   ELN LE +F    ++ +I
Sbjct: 144 NSRYARVGGISLEELNRLELQFSILCDFELI 174

>KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.240
           YIL050W
          Length = 438

 Score = 74.3 bits (181), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 94/183 (51%), Gaps = 25/183 (13%)

Query: 47  TLPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRFHSRVPP 106
           TLP   ID     L AL+ +++S   E+N+  P      +++ ++ ++  +T F+ +  P
Sbjct: 237 TLP---IDDILQMLTALLDKIVSSNDELNNGGPP-AGCEDKQQDHDTINAITSFYGKHVP 292

Query: 107 NISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLS--------------------SVYPEFK 146
            I++  YL+R+ KY    + + LS + + D +S                    + +  F 
Sbjct: 293 QITIEQYLLRIQKYCPTTNDIFLSLLVFFDRISKKFNIHQQKQQSNVSDSDEQAPHQTFV 352

Query: 147 INSLTVHRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYR-IIP 205
           ++S  +HR L+   T+++K   D F +N+ Y++VGG+   E+N LE +FL   +++ +IP
Sbjct: 353 MDSYNIHRLLIAGVTVSTKFFSDFFYSNARYARVGGISLQEMNHLELQFLILCDFKLLIP 412

Query: 206 RDD 208
            D+
Sbjct: 413 IDE 415

>NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {ON}
           Anc_7.240
          Length = 341

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 101/216 (46%), Gaps = 39/216 (18%)

Query: 52  FIDCSR---SDLVALIARMLSFLIEMNDN-DPANTNYLNEEPNN------RSVMNLTRFH 101
           FID ++     L+ +I+ +L  LI+ ND     N   LN+  ++      + V ++  F 
Sbjct: 126 FIDITKLSTKKLIKMISTILEKLIKSNDELRERNETSLNDRTDDDNSDESKLVRSIKSFR 185

Query: 102 SRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVY------------------- 142
            +  P I +  Y  R+ KY    + VLL+ + Y D +S V                    
Sbjct: 186 GKHIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTHHHLL 245

Query: 143 --------PEFKINSLTVHRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETE 194
                    +F ++S  +HR +++A T+++K   D F +NS Y+KVGG+   E+N LE +
Sbjct: 246 RNYDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLELQ 305

Query: 195 FLRRVNYRIIPRDDNIKLCKIEHQQNKFTMDFSDLS 230
           FL   N+ +I   + I+  +     +KF +  +DL+
Sbjct: 306 FLLISNFDLIISSEEIQ--RYSGLLSKFYISITDLT 339

>Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}
           similar to Ashbya gossypii ADL075W
          Length = 385

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 70/120 (58%), Gaps = 5/120 (4%)

Query: 90  NNRSVMNLTRFHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLS----SVYPE- 144
           N++ V ++  F  +  P I++ +Y  R+ KY  + + V LS + Y D ++    ++ P+ 
Sbjct: 224 NSKYVAHVLSFRGKHIPAITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNAMDPQL 283

Query: 145 FKINSLTVHRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRII 204
           F ++S  +HR ++ A T+++K   D F +NS Y++VGG+   ELN LE +F    ++ +I
Sbjct: 284 FVMDSYNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLHELNRLELQFSILCDFELI 343

>NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa]
           {ON} Anc_7.240
          Length = 448

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 66/130 (50%), Gaps = 15/130 (11%)

Query: 90  NNRSVMNLTRFHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLS-----SVYPE 144
           NN  V ++  F  +  P IS++ Y  R+ KY    + V LS + Y D +S     SV  +
Sbjct: 273 NNAYVGSILAFRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQ 332

Query: 145 ----------FKINSLTVHRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETE 194
                     F ++S  +HR ++   T+ +K   D F +NS Y++VGGV   ELN LE +
Sbjct: 333 GDSPTNKSQLFVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQ 392

Query: 195 FLRRVNYRII 204
           FL   ++ ++
Sbjct: 393 FLVLCDFELM 402

>SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 474

 Score = 68.2 bits (165), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 81/155 (52%), Gaps = 12/155 (7%)

Query: 60  LVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRFHSRVPPNISVYNYLIRLTK 119
           L+ ++  +L+ +++ ND    NTN + E   N     +  F  +  P IS+  Y  R+ K
Sbjct: 299 LLNMLTSLLNKIVKSNDQ-LRNTN-VQESAFNDYTSQVLSFRGKHVPAISLDQYFQRIQK 356

Query: 120 YSSLEHCVLLSTVYYIDLLS---SVYPE-------FKINSLTVHRFLLTATTIASKGLCD 169
           Y    + V LS + Y D ++   ++  E       F ++S  +HR ++ A T+++K   D
Sbjct: 357 YCPTTNDVFLSLLVYFDRIAKRCNINEEGEDGQQLFVMDSYNIHRLIIAAVTVSTKFFSD 416

Query: 170 SFCTNSHYSKVGGVHCSELNILETEFLRRVNYRII 204
            F +NS Y++VGG+   ELN LE +FL   ++ +I
Sbjct: 417 FFYSNSRYARVGGISLQELNRLELQFLILCDFELI 451

>KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {ON}
           similar to uniprot|P40186 Saccharomyces cerevisiae
           YIL050W PCL7 Pho85p cyclin of the Pho80p subfamily forms
           a functional kinase complex with Pho85p which
           phosphorylates Mmr1p and is regulated by Pho81p involved
           in glycogen metabolism expression is cell-cycle
           regulated and weakly similar to YER059W uniprot|P40038
           Saccharomyces cerevisiae YER059W PCL6 Pho85p cyclin of
           the Pho80p subfamily forms the major Glc8p kinase
           together with Pcl7p and Pho85p involved in the control
           of glycogen storage by Pho85p stabilized by Elongin C
           binding
          Length = 409

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 84/174 (48%), Gaps = 29/174 (16%)

Query: 60  LVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVM-NLTRFHSRVPPNISVYNYLIRLT 118
           L+ ++  +L+ +I+ ND+  +  N+   +  N  +M  +  F  +  P I++  Y  R+ 
Sbjct: 199 LLDMLTGLLTKIIKSNDSLGSTPNFETSQGKNIPLMREILSFRGKQVPGITLKQYFQRIQ 258

Query: 119 KYSSLEHCVLLSTVYYID---------------------------LLSSVYPE-FKINSL 150
           KY    + VLLS + + D                           L     P+ F ++S 
Sbjct: 259 KYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVSTPDKTTASLAHQSSPQLFVMDSH 318

Query: 151 TVHRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRII 204
            +HR ++ A T+++K + D F +NS Y++VGG+   ELN LE +FL   ++R+I
Sbjct: 319 NIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHLELQFLILCDFRLI 372

>Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL050W
           (PCL7) - PHO85 cyclin [contig 11] FULL
          Length = 465

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 81/159 (50%), Gaps = 14/159 (8%)

Query: 60  LVALIARMLSFLIEMNDNDPANTNYL-----NEEPNNRSVMNLTR----FHSRVPPNISV 110
           L AL+ +++    ++N + P + +        E+ +N +  N+      F  +  P I++
Sbjct: 275 LTALLDKIVKSNDQLNRDRPFDEDQFLASARTEDADNDTRPNIASEILSFRGKHVPAITL 334

Query: 111 YNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPE-----FKINSLTVHRFLLTATTIASK 165
             Y  R+ KY    + V LS + Y D ++          F ++S  +HR +++A T+++K
Sbjct: 335 QQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHGKEQLFVMDSYNIHRLIISAVTVSTK 394

Query: 166 GLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRII 204
              D F +NS Y++VGG+   ELN LE +FL   ++ +I
Sbjct: 395 FFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELI 433

>TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {ON}
           Anc_7.240 YIL050W
          Length = 385

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 89/194 (45%), Gaps = 38/194 (19%)

Query: 49  PPKFIDCSRSDLVALIARMLSFLIEMNDNDPANT--NYLNEEPNNRSVMNLTRFHSRVPP 106
           P    +     L+ +++ +L  ++  ND    NT  N ++E  ++  +  ++ F  +  P
Sbjct: 155 PENIAEFQTDKLLDMLSTLLDKIVLSNDRLHINTMDNTIDEHIDSTIIKPVSCFRGKHVP 214

Query: 107 NISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSS-------------------------- 140
            IS+  Y  R+ KY  + + V LS + Y D +S                           
Sbjct: 215 QISLEQYFQRIQKYCPITNDVFLSLLVYFDRISKKCNNINLEKENVISNDADESQNNVKQ 274

Query: 141 ---------VYPE-FKINSLTVHRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNI 190
                    V P+ F ++S  +HR ++TA T+++K   D F +NS Y++VGG+   ELN 
Sbjct: 275 MKDENNSSIVKPQVFVMDSFNIHRLIITAVTVSTKFFSDLFYSNSRYARVGGISLQELNH 334

Query: 191 LETEFLRRVNYRII 204
           LE +FL   +++++
Sbjct: 335 LELQFLILCDFQLM 348

>KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 580

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 61/110 (55%), Gaps = 5/110 (4%)

Query: 100 FHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPE-----FKINSLTVHR 154
           F  +  P I+++ Y  R+ KY    + V LS + Y D ++          F ++S  +HR
Sbjct: 435 FRGKHVPAITLHQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHAKEQLFVMDSYNIHR 494

Query: 155 FLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRII 204
            +++A T+++K   D F +NS Y++VGG+   ELN LE +FL   ++ +I
Sbjct: 495 LIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELI 544

>CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa]
           {ON} weakly similar to uniprot|P40038 Saccharomyces
           cerevisiae YER059w PCL6 cyclin like protein interacting
           with PHO85P
          Length = 457

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 63/126 (50%), Gaps = 14/126 (11%)

Query: 100 FHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLS-----------SVYPE---F 145
           F  +  P I++Y Y  R+ KY    + V LS + Y D +S              P    F
Sbjct: 305 FKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESADTSPADQLF 364

Query: 146 KINSLTVHRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIP 205
            ++S  +HR ++   T+ +K   D F +NS Y++VGG+  SELN LE +FL   ++ ++ 
Sbjct: 365 VMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVLCDFELLI 424

Query: 206 RDDNIK 211
             D ++
Sbjct: 425 SVDKLQ 430

>KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.240
           YIL050W
          Length = 325

 Score = 64.3 bits (155), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 61/118 (51%), Gaps = 10/118 (8%)

Query: 97  LTRFHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSS----------VYPEFK 146
           L  FH +  P+I++  Y  R+ KY    + V L  +   D ++               F 
Sbjct: 178 LLCFHGKHVPDITIEKYFNRIQKYCPTTNDVFLLLLIAFDRIAKRCNTDSFGNKSQQLFV 237

Query: 147 INSLTVHRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRII 204
           ++S  +HRF++   T+ +K L D F +NS Y+KVGG+   E+N LE +FL   ++++I
Sbjct: 238 MDSYNIHRFIIAGVTVCTKFLSDFFYSNSRYAKVGGISVHEMNNLELQFLVLCDFKLI 295

>KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.240
           YIL050W
          Length = 313

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 63/117 (53%), Gaps = 12/117 (10%)

Query: 100 FHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLL----SSVY-------PE-FKI 147
           F  +  P I++  Y  R+ KY    + V LS + Y D +    +S +       P+ F +
Sbjct: 175 FKGKHIPQINLEQYFKRIQKYCPTTNDVFLSLLIYFDRIFNKCNSKFDNYGHDNPQIFVM 234

Query: 148 NSLTVHRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRII 204
           +S  +HR ++   T+++K L D F +NS Y+KVGG+   ELN LE +FL   ++ ++
Sbjct: 235 DSYNIHRLIIAGVTVSTKFLSDFFYSNSRYAKVGGISLKELNYLELQFLILCDFNLL 291

>KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7.240
           YIL050W
          Length = 354

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 82/180 (45%), Gaps = 26/180 (14%)

Query: 51  KFIDCSRSDLVALIARMLSFLIEMNDN----DPANTNYLNEEPNN------RSVMNLTRF 100
           + I  S   L+ ++  +L  +++ ND     D A    +N++  +       +V  +  F
Sbjct: 152 RLIGLSSDKLIKMLTALLDKIVQANDRLETPDSATLLKVNDDARDTDGYYESAVNAILSF 211

Query: 101 HSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSS---VYPE------------- 144
             +  P I++  Y  R+ KY    + V LS + Y D +S      P              
Sbjct: 212 KGKHIPQITLEQYFHRIQKYCPTTNDVFLSLLIYFDRISEKCNSIPRGGDDDKVQDDTLL 271

Query: 145 FKINSLTVHRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRII 204
           F +NS  +HR ++    +++K   D F +N+ Y+KVGG+   E+N LE +FL   ++ ++
Sbjct: 272 FVMNSYNIHRLIIAGVAVSTKFSSDFFYSNARYAKVGGISLREMNYLELQFLVLCDFSLL 331

>TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {ON}
           Anc_7.240 YIL050W
          Length = 363

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 81/181 (44%), Gaps = 36/181 (19%)

Query: 60  LVALIARMLSFLIEMNDNDPANTNYLNEEP-----NNRSVMNLTRFHSRVPPNISVYNYL 114
           L+ ++  +L  +I+ ND   ++   LN+E      NN  + ++  F  +  P IS+ +Y 
Sbjct: 151 LLEMLTALLDKIIKSNDRLASSNPTLNQERELMNNNNVYLNSVLSFRGKHIPQISLEHYF 210

Query: 115 IRLTKYSSLEHCVLLSTVYYIDLLS-------------------------------SVYP 143
            R+ KY    + V LS + Y D +S                                   
Sbjct: 211 QRIQKYCPTTNDVFLSLLVYFDRISKRCNSNNNDTTNDNDLQYDMPAKQQQQTQQTQQQQ 270

Query: 144 EFKINSLTVHRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRI 203
            F ++S  +HR L+   T+++K   D F +NS Y++VGG+   ELN LE +FL   ++ +
Sbjct: 271 AFVMDSHNIHRLLIAGVTVSTKFFSDFFYSNSRYARVGGISLQELNHLELQFLVLCDFEL 330

Query: 204 I 204
           +
Sbjct: 331 L 331

>NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.240
           YER059W
          Length = 503

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 60/119 (50%), Gaps = 14/119 (11%)

Query: 100 FHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLS---SVYPE-----------F 145
           F  +  P I+++ Y  R+ KY    + V LS + Y D +S   +  P            F
Sbjct: 352 FKGKHVPQITLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSTPTTNSINDNNSQMF 411

Query: 146 KINSLTVHRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRII 204
            ++S  +HR ++   T+ +K   D F +NS Y++VGG+   ELN LE +FL   ++ ++
Sbjct: 412 VMDSYNIHRLIIAGITVCTKFFSDFFYSNSRYARVGGISLQELNHLELQFLILCDFELM 470

>ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 405

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/192 (21%), Positives = 81/192 (42%), Gaps = 47/192 (24%)

Query: 60  LVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMN------LTRFHSRVPPNISVYNY 113
           L+ ++  +L  +++ ND     + Y  ++  +  + N      +  F  +  P IS+ +Y
Sbjct: 188 LLEMLTALLDKIVKSNDKLIDTSFYHQQQEEHDGITNDSCLRSVLSFRGKHIPQISLEHY 247

Query: 114 LIRLTKYSSLEHCVLLSTVYYIDLLS---------------------------------- 139
             R+ KY    + V LS + Y D +S                                  
Sbjct: 248 FQRIQKYCPTSNDVFLSLLVYFDRISRKCNSSSRLHHENTSANDAGNNNNGHDNVKQQVH 307

Query: 140 -------SVYPEFKINSLTVHRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILE 192
                  +   +F ++S  +HR ++  TT+++K   D F +NS Y++VGG+   ELN LE
Sbjct: 308 NNQQPIPAPQQQFVMDSHNIHRLIIAGTTVSTKFFSDFFYSNSRYARVGGISLQELNYLE 367

Query: 193 TEFLRRVNYRII 204
            +FL   ++ ++
Sbjct: 368 LQFLILCDFELL 379

>YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p
           cyclin of the Pho80p subfamily; forms the major Glc8p
           kinase together with Pcl7p and Pho85p; involved in the
           control of glycogen storage by Pho85p; stabilized by
           Elongin C binding
          Length = 420

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 43/67 (64%), Gaps = 1/67 (1%)

Query: 139 SSVYPE-FKINSLTVHRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLR 197
           S  +P+ F ++S  +HR ++   T+++K L D F +NS YS+VGG+   ELN LE +FL 
Sbjct: 323 SRAHPQMFVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLV 382

Query: 198 RVNYRII 204
             ++ ++
Sbjct: 383 LCDFELL 389

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 39/91 (42%), Gaps = 11/91 (12%)

Query: 60  LVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLT-----------RFHSRVPPNI 108
           L+ ++  +L+ +I+ ND   A    L +E  N   + L+            F  +  P I
Sbjct: 172 LLKMLTALLTKIIKSNDRTAATNPSLTQEIENGRCLALSDNEKKYLSPVLGFRGKHVPQI 231

Query: 109 SVYNYLIRLTKYSSLEHCVLLSTVYYIDLLS 139
            +  Y  R+ KY    + V LS + Y D +S
Sbjct: 232 GLDQYFQRIQKYCPTTNDVFLSLLVYFDRIS 262

>TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa]
           {ON} Anc_7.240 YIL050W
          Length = 661

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 39/60 (65%)

Query: 145 FKINSLTVHRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRII 204
           F ++S  +HR ++   T+A+K   D F +N+ Y+KVGG+   ELN LE +FL   +++++
Sbjct: 578 FVMDSYNIHRLIIAGVTVATKFFSDYFYSNARYAKVGGITLQELNHLELQFLLLCDFKLL 637

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 50/109 (45%), Gaps = 16/109 (14%)

Query: 47  TLPPKFIDCSR---SDLVALIARMLSFLIEMNDN----DPANTNYLNEEPNNRSVMN--- 96
           ++PP  ++ +    + L+ ++  +L+ +I+ ND      P     +N  P N +  N   
Sbjct: 375 SVPPSSLNIAEFPTTKLLEMLTALLNKIIKSNDCLAGIQPDALTNVNTPPQNLTTNNGEV 434

Query: 97  ------LTRFHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLS 139
                 +  F  +  P I+++ Y  R+ KY  + + V LS + Y D +S
Sbjct: 435 PNYLSSILSFRGKHIPQITLFQYFQRIQKYCPISNDVFLSLLVYFDRIS 483

>Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W
           (REAL)
          Length = 415

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 39/60 (65%)

Query: 145 FKINSLTVHRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRII 204
           F ++S  +HR ++   T+++K L D F +NS YS+VGG+   ELN LE +FL   ++ ++
Sbjct: 325 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 384

 Score = 33.5 bits (75), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 39/91 (42%), Gaps = 11/91 (12%)

Query: 60  LVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTR-----------FHSRVPPNI 108
           L+ ++  +L+ +I+ ND   A    L +E  N   + LT            F  +  P I
Sbjct: 167 LLKMLTALLTKIIKSNDRTAATNPSLTQEIENGRCLTLTDDEKKYLSPVLGFRGKHVPQI 226

Query: 109 SVYNYLIRLTKYSSLEHCVLLSTVYYIDLLS 139
            +  Y  R+ KY    + V LS + Y D +S
Sbjct: 227 GLDQYFQRIQKYCPTTNDVFLSLLVYFDRIS 257

>Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W
           (REAL)
          Length = 424

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 39/60 (65%)

Query: 145 FKINSLTVHRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRII 204
           F ++S  +HR ++   T+++K L D F +NS YS+VGG+   ELN LE +FL   ++ ++
Sbjct: 334 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 393

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 38/91 (41%), Gaps = 11/91 (12%)

Query: 60  LVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLT-----------RFHSRVPPNI 108
           L+ ++  +L+ +I+ ND   A    L +E  N     LT            F  +  P I
Sbjct: 176 LLKMLTALLTKIIKSNDRTAAANPSLTQEIENGKSPTLTDNEKKYLSPVLGFRGKHVPQI 235

Query: 109 SVYNYLIRLTKYSSLEHCVLLSTVYYIDLLS 139
            +  Y  R+ KY    + V LS + Y D +S
Sbjct: 236 GLDQYFQRIQKYCPTTNDVFLSLLVYFDRIS 266

>Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON}
           (30454..31206) [753 nt, 251 aa]
          Length = 250

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 38/60 (63%)

Query: 145 FKINSLTVHRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRII 204
           F ++S  +HR ++   T+++K   D F +NS Y++VGG+   ELN LE +FL   ++ ++
Sbjct: 163 FVMDSYNIHRLIIAGVTVSTKFFSDLFYSNSRYARVGGISLQELNNLELQFLLMCDFHLL 222

 Score = 30.0 bits (66), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 38/81 (46%), Gaps = 4/81 (4%)

Query: 63  LIARMLSFLIEMNDN----DPANTNYLNEEPNNRSVMNLTRFHSRVPPNISVYNYLIRLT 118
           ++  +L  +I+ ND      P + N L    +N    ++  F  +  P IS+  Y  R+ 
Sbjct: 1   MLTALLDKIIKSNDRLALMGPDSNNDLLMNKDNSMAQSVLSFRGKHIPQISLEQYFQRIQ 60

Query: 119 KYSSLEHCVLLSTVYYIDLLS 139
           KY  + + V +S + Y D +S
Sbjct: 61  KYCPITNDVFISLLVYFDRIS 81

>Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W
           (REAL)
          Length = 420

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 42/64 (65%), Gaps = 1/64 (1%)

Query: 142 YPE-FKINSLTVHRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVN 200
           +P+ F ++S  +HR ++   T+++K L D F +NS YS+VGG+   ELN LE +FL   +
Sbjct: 326 HPQMFVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCD 385

Query: 201 YRII 204
           + ++
Sbjct: 386 FELL 389

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 39/91 (42%), Gaps = 11/91 (12%)

Query: 60  LVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLT-----------RFHSRVPPNI 108
           L+ ++  +L+ +I+ ND   A    L +E  N   + LT            F  +  P I
Sbjct: 172 LLKMLTALLTKIIKSNDRTAATNPSLTQEIENGKCLTLTDSERKYLSPVLGFRGKHVPQI 231

Query: 109 SVYNYLIRLTKYSSLEHCVLLSTVYYIDLLS 139
            +  Y  R+ KY    + V LS + Y D +S
Sbjct: 232 GLDQYFQRIQKYCPTTNDVFLSLLVYFDRIS 262

>NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7.240
           YER059W
          Length = 303

 Score = 51.6 bits (122), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%)

Query: 147 INSLTVHRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRI 203
           +NS TVHR +L   T++SK L D   +N  Y++  G+   ELN LE +FLR  N+ +
Sbjct: 227 VNSCTVHRLILAGITVSSKFLSDFTYSNKRYAQASGLTLEELNYLEFQFLRLTNFNL 283

>Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON}
           (24019..24951) [933 nt, 311 aa]
          Length = 310

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 61/109 (55%), Gaps = 5/109 (4%)

Query: 109 SVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPE--FKINSLTVHRFLLTATTIASKG 166
           S++ ++  L K+S+++   L+++  Y+  L S+ P   + I S T HR  L    +A+K 
Sbjct: 44  SIFEFIKGLIKHSNVQTSTLMASTVYLTKLRSILPANVYGIES-TKHRIFLGCLILAAKS 102

Query: 167 LCDSFCTNSHYSKV--GGVHCSELNILETEFLRRVNYRIIPRDDNIKLC 213
           L DS   N H++K   G ++ +++N +E E L  +N+  I + +++  C
Sbjct: 103 LNDSSPLNKHWTKYTNGLLNLADVNTIERELLAYLNWDTIIKQEDLIGC 151

>TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa]
           {ON} Anc_7.289 YDL179W
          Length = 368

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 53/99 (53%), Gaps = 8/99 (8%)

Query: 102 SRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPE--FKINSLTVHRFLLTA 159
           S +PP   +Y ++  L  +S+++   L++TV Y+  L ++ P   + I + T HR  L  
Sbjct: 48  SNIPP---LYTFIKNLVAHSNVQTPTLMTTVVYLKKLKAIIPSNVYGIET-TRHRMFLGC 103

Query: 160 TTIASKGLCDSFCTNSHYSKV--GGVHCSELNILETEFL 196
             IA+K L DS   N H++K   G +   E+N +E E L
Sbjct: 104 LIIAAKTLNDSSPLNKHWAKYTNGLLQLREVNTIEREIL 142

>ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {ON}
           some similarities with uniprot|P25693 Saccharomyces
           cerevisiae YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 56/116 (48%), Gaps = 8/116 (6%)

Query: 102 SRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPE--FKINSLTVHRFLLTA 159
           S  PP   +  ++  L  YS+++   L++T  Y+  L S+ P   F I + T HR  L  
Sbjct: 42  SPAPP---LMRFIKTLISYSNVQTPTLMATTVYLTKLRSIIPANVFGIET-TRHRIFLGC 97

Query: 160 TTIASKGLCDSFCTNSHYSKV--GGVHCSELNILETEFLRRVNYRIIPRDDNIKLC 213
             +A+K L DS   N H++    G +H  E+N +E E L   ++ +    + +  C
Sbjct: 98  LILAAKTLNDSSPLNKHWASYTDGLLHIREVNTIERELLEYFDWNVCITTEELVAC 153

>YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,
           forms a functional kinase complex with Pho85p
           cyclin-dependent kinase (Cdk), expressed in late M/early
           G1 phase, activated by Swi5p
          Length = 304

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 59/105 (56%), Gaps = 11/105 (10%)

Query: 105 PPNISVY--NYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPE--FKINSLTVHRFLLTAT 160
           PP++S++  N +I+    S+++   L++T  Y++ L SV P+  + IN+ T HR  L   
Sbjct: 46  PPDLSIFIKNVVIQ----SNVQTPTLMATSVYLNKLKSVIPKNVYGINT-TRHRIFLGCL 100

Query: 161 TIASKGLCDSFCTNSHYSKV--GGVHCSELNILETEFLRRVNYRI 203
            +A+K L DS   N H++    G +   E+N +E E L  +N+ +
Sbjct: 101 ILAAKTLNDSSPWNKHWTTYTEGLLRIREVNTIERELLEYLNWDV 145

>CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} similar
           to uniprot|P25693 Saccharomyces cerevisiae YDL127w PCL2
           and similar to uniprot|Q12477 Saccharomyces cerevisiae
           YDL179w PCL9
          Length = 297

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 52/95 (54%), Gaps = 5/95 (5%)

Query: 113 YLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPE--FKINSLTVHRFLLTATTIASKGLCDS 170
           ++ +L KYS+++   L++T  ++  L S+ P   + I + T HR  L    +++K L DS
Sbjct: 52  FIKKLVKYSNVQTPTLMATTVFLTKLRSIIPANVYGIET-TRHRIFLGCLILSAKTLNDS 110

Query: 171 FCTNSHYSKV--GGVHCSELNILETEFLRRVNYRI 203
              N H+++   G +H  E+N +E E L   ++ +
Sbjct: 111 SPLNKHWAQYTDGLLHLKEVNTIERELLEYFDWNL 145

>NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {ON}
           Anc_7.289
          Length = 312

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 56/106 (52%), Gaps = 5/106 (4%)

Query: 112 NYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYP--EFKINSLTVHRFLLTATTIASKGLCD 169
           N++  L K+S+++   L++T  Y+  L S+ P   + I + T HR  L    +A+K L D
Sbjct: 52  NFIKALIKHSNVQTPTLMATTVYLSKLKSIIPCNVYGIET-TRHRIFLGCLILAAKTLND 110

Query: 170 SFCTNSHYSKV--GGVHCSELNILETEFLRRVNYRIIPRDDNIKLC 213
           S   N H+++   G +   E+N +E E L   ++ +  +  ++ +C
Sbjct: 111 SSPMNKHWAQYTDGLLQIREVNTIERELLEYFDWDVTIKTKDLIIC 156

>SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 335

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 55/100 (55%), Gaps = 5/100 (5%)

Query: 108 ISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPE--FKINSLTVHRFLLTATTIASK 165
           +S+ +++  L  +S+++   L+STV Y+  L S+ P   + I + T HR  L    +A+K
Sbjct: 42  VSLVDFIKGLITHSNVQTPTLMSTVVYLTRLRSIIPATVYGIET-TRHRIFLGCLILAAK 100

Query: 166 GLCDSFCTNSHYSKV--GGVHCSELNILETEFLRRVNYRI 203
            L DS   N H+S+   G +   E+N +E E L   ++++
Sbjct: 101 NLNDSSPLNKHWSRYTNGLLDIREVNTIERELLEYFDWKL 140

>YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 308

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 5/112 (4%)

Query: 106 PNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPE--FKINSLTVHRFLLTATTIA 163
           P   +  ++ RL K+S+++   L++T  Y+  L S+ P   + I + T HR  L    +A
Sbjct: 45  PAPPLTKFINRLIKHSNVQTPTLMATSVYLAKLRSIIPSNVYGIET-TRHRIFLGCLILA 103

Query: 164 SKGLCDSFCTNSHYSKV--GGVHCSELNILETEFLRRVNYRIIPRDDNIKLC 213
           +K L DS   N H+++   G +   E+N +E E L   ++ +    D++  C
Sbjct: 104 AKTLNDSSPLNKHWAEYTDGLLILREVNTIERELLEYFDWDVTISTDDLITC 155

>Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 56/107 (52%), Gaps = 7/107 (6%)

Query: 101 HSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPE--FKINSLTVHRFLLT 158
           H   PP +S++  + ++   S+++   L++T  Y++ L S+ P+  + I + T HR  L 
Sbjct: 41  HGCPPPELSIF--IKKVVVQSNVQTPTLMATTVYLNKLKSIIPKNVYGIET-TRHRIFLG 97

Query: 159 ATTIASKGLCDSFCTNSHYSKV--GGVHCSELNILETEFLRRVNYRI 203
              +A+K L DS   N H++    G +   E+N +E E L   N+ +
Sbjct: 98  CLILAAKTLNDSSPWNKHWTTYTEGLLKVREVNTIERELLEYFNWDV 144

>CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar to
           uniprot|P24867 Saccharomyces cerevisiae YNL289w PCL1
           cyclin
          Length = 266

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 58/107 (54%), Gaps = 3/107 (2%)

Query: 109 SVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKIN-SLTVHRFLLTATTIASKGL 167
           S+  ++ RL +Y+++    LL+TV Y++ L  + P+       T+HR  L    ++SK  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLATVCYLNKLKRILPKDATGLPSTIHRLFLACLILSSKCH 113

Query: 168 CDSFCTNSHYSKV--GGVHCSELNILETEFLRRVNYRIIPRDDNIKL 212
            DS   N H+++   G     ++N++E + L+ +N+ I   +D++ L
Sbjct: 114 NDSSPKNVHWARYTDGLFSLEDINLMERQLLQLLNWDINVSEDDLIL 160

>TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.289
           YDL179W
          Length = 309

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 56/112 (50%), Gaps = 5/112 (4%)

Query: 106 PNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPE--FKINSLTVHRFLLTATTIA 163
           P  S+ N++  L  +S+++   L++T  Y+  L S+ P   + I + T HR  L    +A
Sbjct: 45  PAPSLTNFIKGLVLHSNVQTPTLMATAVYLAKLRSIIPGNVYGIET-TRHRIFLGCLILA 103

Query: 164 SKGLCDSFCTNSHYSKV--GGVHCSELNILETEFLRRVNYRIIPRDDNIKLC 213
           +K L DS   N H++    G +H  E+N +E E L   ++ +     ++  C
Sbjct: 104 AKTLNDSSPLNKHWALYTDGLLHIHEVNTIERELLEYFDWNVTVTTKDLITC 155

>TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {ON}
           Anc_7.289 YDL179W
          Length = 247

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 65/133 (48%), Gaps = 13/133 (9%)

Query: 84  YLNEEPNNRSVMN-LTRFHSRVPPNI---------SVYNYLIRLTKYSSLEHCVLLSTVY 133
           YL+++P +R ++  L      + PNI         S+ +++  + KYS ++   L+++  
Sbjct: 9   YLSKQPVSRDMVKFLVSSTEAIIPNIQQSGSLAIPSLTSFICDVVKYSKVKTPTLMASTV 68

Query: 134 YIDLLSSVYPEFKINSLTV-HRFLLTATTIASKGLCDSFCTNSHYSKV--GGVHCSELNI 190
           +++ L  + P +     T  HR  L    +ASK L DS   N H+ K   G +   E+N 
Sbjct: 69  FLNRLRCIIPGYVEGIATATHRLFLGCLILASKTLNDSSPFNKHWEKYCRGLLSLMEINT 128

Query: 191 LETEFLRRVNYRI 203
           +E E L  +++ +
Sbjct: 129 IERELLEYMSWNV 141

>Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 55/103 (53%), Gaps = 6/103 (5%)

Query: 102 SRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKIN-SLTVHRFLLTAT 160
           +R+P   S+  ++ RL +Y+++    LL+ V Y++ L  + P+       T+HR  L   
Sbjct: 50  ARLP---SLMTFITRLVRYTNVYTPTLLTAVCYLNKLKRILPKDATGLPSTIHRIFLACL 106

Query: 161 TIASKGLCDSFCTNSHYSKV--GGVHCSELNILETEFLRRVNY 201
            +++K   DS   N H++K   G     ++N++E + L+ +N+
Sbjct: 107 ILSAKFHNDSSPLNKHWAKYTDGLFTLEDINLMERQLLQLLNW 149

>Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W
           (REAL)
          Length = 309

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 57/112 (50%), Gaps = 9/112 (8%)

Query: 104 VPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPE--FKINSLTVHRFLLTATT 161
            PP +   N   RL K+S+++   L++T  Y+  L S+ P   + I + T HR  L    
Sbjct: 46  APPLVKFIN---RLIKHSNVQTPTLMATSVYLVKLRSIIPSNVYGIET-TRHRIFLGCLI 101

Query: 162 IASKGLCDSFCTNSHYSKV--GGVHCSELNILETEFLRRVNYRI-IPRDDNI 210
           +A+K L DS   N H+++   G +   E+N +E E L   ++ + I  DD I
Sbjct: 102 LAAKTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLGYFDWDVTISTDDLI 153

>KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70
           YNL289W
          Length = 262

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 55/107 (51%), Gaps = 3/107 (2%)

Query: 98  TRFHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYP-EFKINSLTVHRFL 156
           T    + P   S+  ++ +L +Y+++    LL+TV Y++ L  + P + K    T+HR  
Sbjct: 48  TELSGKEPRLPSLRTFITKLVRYTNVYTPTLLTTVCYLNKLKRILPKDAKGLPSTIHRLF 107

Query: 157 LTATTIASKGLCDSFCTNSHYSKV--GGVHCSELNILETEFLRRVNY 201
           L    +++K   DS   N H++K   G     ++N++E + L  +N+
Sbjct: 108 LACLILSAKYHNDSSPLNKHWAKYTDGLFSLEDINLMERQLLNLLNW 154

>Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {ON}
           YDL127W (PCL2) - G1 cyclin [contig 12] FULL
          Length = 304

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 52/109 (47%), Gaps = 3/109 (2%)

Query: 108 ISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKIN-SLTVHRFLLTATTIASKG 166
           +S+ N++  L   S+++   L+ST  Y+  L S+ P   +    T HR  L    IA+K 
Sbjct: 45  VSLENFIKGLVVQSNVQTPTLMSTAVYLAKLRSIIPANVLGIETTRHRMFLGCLIIAAKN 104

Query: 167 LCDSFCTNSHYSKV--GGVHCSELNILETEFLRRVNYRIIPRDDNIKLC 213
           L DS   N H++    G +   E+N +E E L   ++ +      + +C
Sbjct: 105 LNDSSPMNKHWASYTNGLLDTREVNTIERELLEYFDWNLQFSTQELAIC 153

>Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 57/112 (50%), Gaps = 5/112 (4%)

Query: 106 PNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPE--FKINSLTVHRFLLTATTIA 163
           P   +  ++ RL K+S+++   L++T  Y+  L S+ P   + I + T HR  L    +A
Sbjct: 45  PAPPLTEFINRLIKHSNVQTPTLMATSVYLAKLRSLIPSKVYGIET-TRHRIFLGCLILA 103

Query: 164 SKGLCDSFCTNSHYSKV--GGVHCSELNILETEFLRRVNYRIIPRDDNIKLC 213
           +K L DS   N H+++   G +   E+N +E E L   ++ +    +++  C
Sbjct: 104 AKTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLEYFDWDVTISTEDLITC 155

>NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289
          Length = 330

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 54/105 (51%), Gaps = 8/105 (7%)

Query: 103 RVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPE--FKINSLTVHRFLLTAT 160
            +PP   + N++  L  +S+++   L++T  Y+  L  + P+  + + + T HR  L   
Sbjct: 49  EIPP---LSNFIKNLVMHSNVQTPTLMATSVYLSKLRLIIPKNVYGMET-TRHRIFLGCL 104

Query: 161 TIASKGLCDSFCTNSHYSKV--GGVHCSELNILETEFLRRVNYRI 203
            +A+K L DS   N H++K   G +H  E+N +E E L    + +
Sbjct: 105 ILAAKTLNDSSPLNKHWTKYTDGLLHIREVNTIERELLEYFEWNV 149

>TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {ON}
           Anc_7.289 YDL179W
          Length = 363

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 113 YLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKIN-SLTVHRFLLTATTIASKGLCDSF 171
           ++ RL  +S+++   L+ST+ Y+  L  + P   +    T HR  +    +A+K L DS 
Sbjct: 50  FIKRLIVHSNVQTPTLMSTLVYLTKLREIIPSDVVGIETTRHRIFIGCLILAAKSLNDSS 109

Query: 172 CTNSHYSKV--GGVHCSELNILETEFLRRVNYRI 203
             N H+++   G     E+N +E E L   N+ +
Sbjct: 110 PLNRHWTQYTNGLFKIQEINTIERELLEYFNWDV 143

>Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON}
           (18215..19105) [891 nt, 297 aa]
          Length = 296

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 57/116 (49%), Gaps = 6/116 (5%)

Query: 106 PNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPE--FKINSLTVHRFLLTATTIA 163
           P   +  ++  L   S+++   L++T  Y+  L ++ P   + I S T HR  L    +A
Sbjct: 45  PPPPLVKFITNLCLKSNVQTPTLMATTVYLKKLKNIIPPNVYGIES-TRHRIFLGCLILA 103

Query: 164 SKGLCDSFCTNSHYSKV--GGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEH 217
           SK L DS   N H+++   G +   E+N +E E L   ++ I    D++ +  +EH
Sbjct: 104 SKTLNDSSPLNKHWARYTSGILQLREVNTIERELLEYFDWNIQITTDDL-VSSLEH 158

>AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL127W
           (PCL2) and YDL179W (PCL9)
          Length = 308

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 56/106 (52%), Gaps = 7/106 (6%)

Query: 108 ISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPE--FKINSLTVHRFLLTATTIASK 165
           +S+ +++  L K S+++   L+STV Y+  L S+ P   + I + + HR  L    +A+K
Sbjct: 43  LSLVDFIKGLVKRSNVQTPTLMSTVVYLARLRSIIPANVYGIET-SRHRMFLGCLILAAK 101

Query: 166 GLCDSFCTNSHYSKV--GGVHCSELNILETEFLRRVNY--RIIPRD 207
            L DS   N H+ +   G +   E+N +E E L   N+  RI  +D
Sbjct: 102 NLNDSSPMNKHWCRYTDGLLSLREVNTIERELLEYFNWNLRITNQD 147

>KLTH0H03674g Chr8 (333755..335209) [1455 bp, 484 aa] {ON} weakly
           similar to uniprot|P53124 Saccharomyces cerevisiae
           YGL134W PCL10 Pho85p cyclin recruits activates and
           targets Pho85p cyclin-dependent protein kinase to its
           substrate
          Length = 484

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 61/122 (50%), Gaps = 6/122 (4%)

Query: 86  NEEPNNRSVMNLTRFHSRVPPNISVYNYLIRL-TKYS-----SLEHCVLLSTVYYIDLLS 139
           +E+P   ++ +   F     P ++  +YL RL  K+S      L    LL T++   +  
Sbjct: 338 SEDPKQEALPSFATFVMESVPTLAYEDYLKRLHCKFSFAPIVYLTAAHLLQTLFLTRVDE 397

Query: 140 SVYPEFKINSLTVHRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRV 199
            ++ +  ++   VHR ++ +  +A+K L D   ++S++S++ G+    L  LE  FL  +
Sbjct: 398 ELHCKHHLDPRQVHRLVIASIRLATKLLEDCVHSHSYFSRICGISKKLLTKLEVAFLECL 457

Query: 200 NY 201
           N+
Sbjct: 458 NF 459

>TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70
           YNL289W
          Length = 289

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 61/113 (53%), Gaps = 8/113 (7%)

Query: 102 SRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSL--TVHRFLLTA 159
           S++P   S+  ++ +L +Y+++    LL+T  Y+  L  + P+   N L  T+HR  L  
Sbjct: 53  SKLP---SLKTFITKLVRYTNVYTSTLLTTACYLKKLQRILPK-DANGLPSTIHRIFLAC 108

Query: 160 TTIASKGLCDSFCTNSHYSKV--GGVHCSELNILETEFLRRVNYRIIPRDDNI 210
             +++K   DS   N H+++   G     ++N++E + L  +N+ I  +++++
Sbjct: 109 LILSAKFHNDSSPLNKHWAEYTDGLFSLEDVNLMEVQLLALLNWDIRIKEEDL 161

>Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON}
           similar to Ashbya gossypii AFR159C
          Length = 314

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 5/112 (4%)

Query: 106 PNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSL--TVHRFLLTATTIA 163
           P +S+ +++  L   S+++   L+STV Y+  L S+ P   ++ +  T HR  L    +A
Sbjct: 41  PILSLVDFIKGLINKSNVQTPTLMSTVVYLTRLRSIIPP-NVHGIETTRHRIFLGCLILA 99

Query: 164 SKGLCDSFCTNSHYSKVGG--VHCSELNILETEFLRRVNYRIIPRDDNIKLC 213
           SK L DS   N H+ +     +   E+N +E E L   N+ ++  + ++  C
Sbjct: 100 SKNLNDSSPMNKHWCQYTNSLLSLREVNTVERELLEYFNWDLLITNKDLITC 151

>Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 56/112 (50%), Gaps = 9/112 (8%)

Query: 104 VPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPE--FKINSLTVHRFLLTATT 161
            PP     N LI   K+S+++   L++T  Y+  L S+ P   + I + T HR  L    
Sbjct: 46  APPLTKFINGLI---KHSNVQTPTLMATSVYLAKLRSIIPSNVYGIET-TRHRIFLGCLI 101

Query: 162 IASKGLCDSFCTNSHYSKV--GGVHCSELNILETEFLRRVNYRI-IPRDDNI 210
           +A+K L DS   N H+++   G +   E+N +E E L   ++ + I  DD I
Sbjct: 102 LAAKTLNDSSPLNKHWAEYTDGLLVLREVNTIERELLEYFDWDVTISTDDLI 153

>Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 54/103 (52%), Gaps = 6/103 (5%)

Query: 102 SRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKIN-SLTVHRFLLTAT 160
           +R+P   S+  ++ RL +Y+++    LL+   Y++ L  + P+       T+HR  L   
Sbjct: 50  ARLP---SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPSTIHRIFLACL 106

Query: 161 TIASKGLCDSFCTNSHYSKV--GGVHCSELNILETEFLRRVNY 201
            +++K   DS   N H+++   G     ++N++E + L+ +N+
Sbjct: 107 ILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 54/103 (52%), Gaps = 6/103 (5%)

Query: 102 SRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKIN-SLTVHRFLLTAT 160
           +R+P   S+  ++ RL +Y+++    LL+   Y++ L  + P+       T+HR  L   
Sbjct: 50  ARLP---SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPSTIHRIFLACL 106

Query: 161 TIASKGLCDSFCTNSHYSKV--GGVHCSELNILETEFLRRVNY 201
            +++K   DS   N H+++   G     ++N++E + L+ +N+
Sbjct: 107 ILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 301

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 55/110 (50%), Gaps = 5/110 (4%)

Query: 108 ISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSL--TVHRFLLTATTIASK 165
           +S+ +++  L   S+++   L+ST  Y+  L S+ P   ++ +  T HR  L    IA+K
Sbjct: 43  VSLVDFIKGLVVQSNVQTPTLMSTAVYLSKLRSIIPA-NVHGMETTRHRVFLGCLIIAAK 101

Query: 166 GLCDSFCTNSHYSKV--GGVHCSELNILETEFLRRVNYRIIPRDDNIKLC 213
            L DS   N H++    G ++  E+N +E E L   ++ +     ++  C
Sbjct: 102 NLNDSSPMNKHWASYTNGLLNTREVNTIERELLEYFDWNLRISTQDLVTC 151

>YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 279

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 53/103 (51%), Gaps = 6/103 (5%)

Query: 102 SRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKIN-SLTVHRFLLTAT 160
           +R+P   S+  ++ RL +Y+++    LL+   Y++ L  + P        T+HR  L   
Sbjct: 50  TRLP---SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPRDATGLPSTIHRIFLACL 106

Query: 161 TIASKGLCDSFCTNSHYSKV--GGVHCSELNILETEFLRRVNY 201
            +++K   DS   N H+++   G     ++N++E + L+ +N+
Sbjct: 107 ILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} similar
           to uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 282

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 52/104 (50%), Gaps = 6/104 (5%)

Query: 101 HSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKIN-SLTVHRFLLTA 159
           H+ VP   S+  ++ RL +Y+++    LL+TV Y++ L  + P        T HR  L  
Sbjct: 53  HNGVP---SLMTFISRLVRYTNVYTSTLLTTVVYLNRLRELLPSDAAGLPTTCHRIFLAC 109

Query: 160 TTIASKGLCDSFCTNSHYSKV--GGVHCSELNILETEFLRRVNY 201
             +++K   DS   N H++K   G     ++N++E + L+   +
Sbjct: 110 LILSAKYHNDSSPLNKHWTKYTDGMFTLRDVNLMERQLLQLFEW 153

>Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON}
           complement(33477..34325) [849 nt, 283 aa]
          Length = 282

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 52/104 (50%), Gaps = 6/104 (5%)

Query: 101 HSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKIN-SLTVHRFLLTA 159
             R+P   S+  ++ +L +Y+++    LL+T  Y+  L  + P+       T+HR  L  
Sbjct: 49  QQRLP---SLMTFITKLVRYTNVYTSTLLTTTCYLKKLQRILPKDATGLPSTIHRMFLAC 105

Query: 160 TTIASKGLCDSFCTNSHYSKV--GGVHCSELNILETEFLRRVNY 201
             I++K   DS   N H+++   G     ++N++E + L  +N+
Sbjct: 106 LIISAKYHNDSSPLNKHWAEYTDGLFSLEDVNLMEMQLLALLNW 149

>Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W
           (REAL)
          Length = 309

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 51/98 (52%), Gaps = 5/98 (5%)

Query: 110 VYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPE--FKINSLTVHRFLLTATTIASKGL 167
           ++ ++ ++   S+++   L++T  Y++ L ++ P   + I + T HR  L    +A+K L
Sbjct: 48  LFTFIKKVVIQSNVQTPTLMATTVYLNKLKNIIPTNVYGIET-TRHRIFLGCLILAAKTL 106

Query: 168 CDSFCTNSHYSKV--GGVHCSELNILETEFLRRVNYRI 203
            DS   N H+S    G +   E+N +E E L   N+ +
Sbjct: 107 NDSSPWNKHWSTYTEGLLKVREVNTIERELLEYFNWDV 144

>TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3.70
           YNL289W
          Length = 361

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 53/103 (51%), Gaps = 3/103 (2%)

Query: 104 VPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKIN-SLTVHRFLLTATTI 162
           +P   S+  ++ R+ +Y++++   LL TV Y++ L  + P   +    T+HR  L    +
Sbjct: 55  IPKLPSLMTFITRIVRYTNVQVSTLLMTVCYLNKLKKLLPADAVGIPSTIHRLFLACLIL 114

Query: 163 ASKGLCDSFCTNSHYSKV--GGVHCSELNILETEFLRRVNYRI 203
           ++K   DS   N H++    G     ++N++E + L  +++ +
Sbjct: 115 SAKFHNDSSPLNVHWANYTNGLFSVKDVNLMERQLLSLLDWNL 157

>KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {ON}
           Anc_3.70 YNL289W
          Length = 241

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 59/123 (47%), Gaps = 14/123 (11%)

Query: 94  VMNLTRFHSRVPPNISVYN----------YLIRLTKYSSLEHCVLLSTVYYIDLLSSVYP 143
           VM+L R +   PP+  +Y+          ++ +L +Y+ +    LL T+ Y++ L  + P
Sbjct: 31  VMDLKRTYP-TPPSSPLYDEEDELPTLREFICKLVEYTHVYTPTLLMTISYLNRLRRILP 89

Query: 144 EFKIN-SLTVHRFLLTATTIASKGLCDSFCTNSHYSKV--GGVHCSELNILETEFLRRVN 200
           +       T+HR  L    I++K   DS   N H++K   G     ++N++E   L  +N
Sbjct: 90  KGAAGIPSTLHRIFLACLIISAKNHNDSSPLNRHWTKYTDGLFTLEDVNLMERHLLDLLN 149

Query: 201 YRI 203
           + +
Sbjct: 150 WNL 152

>Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 55/105 (52%), Gaps = 11/105 (10%)

Query: 105 PPNISVY--NYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPE--FKINSLTVHRFLLTAT 160
           PP++S +  N +I+    S+++   L++T  Y++ L ++ P   + I + T HR  L   
Sbjct: 47  PPDLSTFIKNVVIQ----SNVQTPTLMATSVYLNKLRNIIPRNVYGIET-TRHRIFLGCL 101

Query: 161 TIASKGLCDSFCTNSHYSKV--GGVHCSELNILETEFLRRVNYRI 203
            +A+K L DS   N H++    G +   E+N +E E L   N+ +
Sbjct: 102 ILAAKTLNDSSPWNKHWTTYTEGLLRVREVNTIERELLEYFNWDV 146

>NCAS0D04070 Chr4 (764711..766132) [1422 bp, 473 aa] {ON} Anc_6.236
          Length = 473

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 49/111 (44%), Gaps = 8/111 (7%)

Query: 94  VMNLTRFHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPE--------F 145
           ++  + F  + PP++S  +++ R+      +  V L   Y +  L  +  E        F
Sbjct: 334 MIAFSNFKMKSPPSLSYADFIQRIQNKCEYDPHVYLIATYLLQTLLLIREEHSRKLKLRF 393

Query: 146 KINSLTVHRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFL 196
           K     VHR ++    IA+K L D   ++ ++ KV G+    L+ LE   L
Sbjct: 394 KFEKSDVHRLIIATVRIATKLLEDHVHSHEYFCKVSGISKKLLSKLEVSLL 444

>KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.289
           YDL179W
          Length = 312

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 48/102 (47%), Gaps = 3/102 (2%)

Query: 105 PPNISVYNYLIRLTKYSSLEHCVLL-STVYYIDLLSSVYPEFKINSLTVHRFLLTATTIA 163
           PP  ++  ++  L   S +    L+ STVY + L   + P       T HR  L    IA
Sbjct: 44  PPIPTLVEFIAGLVTNSKVGTPTLMASTVYLVRLKDILPPNIIGIETTRHRLFLGCLIIA 103

Query: 164 SKGLCDSFCTNSHYSKVGG--VHCSELNILETEFLRRVNYRI 203
           +K L D+   N H+SK     +   E+NI+E E L  + +R+
Sbjct: 104 AKTLNDNSPLNKHWSKHTNNLLPNREINIIERELLSYLRWRV 145

>KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON}
           Anc_3.70 YNL289W
          Length = 267

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 50/93 (53%), Gaps = 6/93 (6%)

Query: 103 RVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYP-EFKINSLTVHRFLLTATT 161
           R+P   S+  ++ RL +Y+++    LL+TV Y++ L  + P + K    T+HR  L    
Sbjct: 56  RLP---SLRTFITRLVRYTNVYTPTLLTTVCYLNKLKRILPKDAKGLPSTIHRLFLACLI 112

Query: 162 IASKGLCDSFCTNSHYSKV--GGVHCSELNILE 192
           I++K   DS   N H+++   G     ++N++E
Sbjct: 113 ISAKFHNDSSPLNKHWTRYTDGLFSLEDINLME 145

>SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa]
           {ON} similar to gnl|GLV|CAGL0E02233g Candida glabrata
           CAGL0E02233g and some similarites with YNL289W
           uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 314

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 51/96 (53%), Gaps = 3/96 (3%)

Query: 109 SVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKIN-SLTVHRFLLTATTIASKGL 167
           S+  ++ +L +Y+++    LL+TV Y+  L ++ P        T HR  L    +++K  
Sbjct: 55  SLMTFITKLVRYTNVYTSTLLTTVCYLSKLKTILPRDATGLPSTTHRIFLACLILSAKFH 114

Query: 168 CDSFCTNSHYSKV--GGVHCSELNILETEFLRRVNY 201
            DS   N+H+S+   G     ++N++E + L+ +++
Sbjct: 115 NDSSPLNAHWSRYTDGLFSLEDVNLMERQLLQLLHW 150

>ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {ON}
           similar to uniprot|P24867 Saccharomyces cerevisiae
           YNL289W PCL1 Pho85 cyclin of the Pcl1 2-like subfamily
           involved in entry into the mitotic cell cycle and
           regulation of morphogenesis localizes to sites of
           polarized cell growth
          Length = 330

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 63/115 (54%), Gaps = 8/115 (6%)

Query: 102 SRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSL--TVHRFLLTA 159
           S++P   S+ +++ RL +++++    LL T  Y++ L  + P+   + L  T+HR  L  
Sbjct: 83  SKLP---SLMSFISRLVRHTNVYTSTLLVTACYLNRLKCILPK-DASGLPSTIHRMFLAC 138

Query: 160 TTIASKGLCDSFCTNSHYSKV--GGVHCSELNILETEFLRRVNYRIIPRDDNIKL 212
             +++K   DS   N H++K   G     ++N++E + ++ +N+ +   +D++ L
Sbjct: 139 LILSAKFHNDSSPLNKHWAKYTDGLFSVEDVNLMERQLVQLLNWDLRVTNDDLIL 193

>NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {ON}
           Anc_3.70
          Length = 294

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 48/93 (51%), Gaps = 6/93 (6%)

Query: 103 RVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKIN-SLTVHRFLLTATT 161
           R+P   S+  ++ RL +Y+++    LL+TV Y++ L  + P+       T+HR  L    
Sbjct: 51  RLP---SLMTFITRLVRYTNVYTPTLLTTVCYLNKLKRILPKDATGLPSTIHRIFLACLI 107

Query: 162 IASKGLCDSFCTNSHYSKV--GGVHCSELNILE 192
           +++K   DS   N H+ K   G     ++N++E
Sbjct: 108 LSAKFHNDSSPLNKHWVKYTDGLFTLEDVNLME 140

>KNAG0F01870 Chr6 (356849..358300) [1452 bp, 483 aa] {ON} Anc_6.236
           YGL134W
          Length = 483

 Score = 37.7 bits (86), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 53/107 (49%), Gaps = 12/107 (11%)

Query: 89  PNNRSVMN----LTRFHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLL------ 138
           P N +V +     +RF  +  P++S  +++ R+      +  V LS  Y + +L      
Sbjct: 336 PENSAVKSEHDLCSRFIMKNIPSLSFVDFIKRIHDKCHFDTPVYLSATYLLQILFLERSA 395

Query: 139 --SSVYPEFKINSLTVHRFLLTATTIASKGLCDSFCTNSHYSKVGGV 183
             +S+  +FK+    +HR ++    I++K L D   ++ ++SKV GV
Sbjct: 396 ESNSLELKFKLQRDGLHRLIIALVRISTKLLEDQIHSHDYFSKVCGV 442

>NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {ON}
           Anc_3.70
          Length = 286

 Score = 37.4 bits (85), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 48/96 (50%), Gaps = 6/96 (6%)

Query: 100 FHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKIN-SLTVHRFLLT 158
           +  R+P   S+  ++  L +Y+++    LL+TV Y++ L  + P+       T+HR  L 
Sbjct: 48  YQPRLP---SLMTFITNLVRYTNVYTPTLLTTVCYLNKLKRLLPKDATGLPSTIHRIFLA 104

Query: 159 ATTIASKGLCDSFCTNSHYSKV--GGVHCSELNILE 192
              +++K   DS   N H+ K   G     ++N++E
Sbjct: 105 CLILSAKFHNDSSPLNKHWVKYTDGLFTLEDVNLME 140

>Skud_7.139 Chr7 (260060..261364) [1305 bp, 434 aa] {ON} YGL134W
           (REAL)
          Length = 434

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 32/150 (21%), Positives = 68/150 (45%), Gaps = 14/150 (9%)

Query: 56  SRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRFHSRVPPNISVYNYLI 115
           S  D +A  +  +  L++++D++    +      N+        F+ +  P++S  ++L 
Sbjct: 261 SVDDALANFSETIELLLKLSDDEKCTIS-----KNDVEKKEYANFYMKSKPSLSSVDFLR 315

Query: 116 RLTKYSSLEHCVLLSTVYYIDLL---------SSVYPEFKINSLTVHRFLLTATTIASKG 166
           R+      E  V L   + +D L         +++  + K+    VHR ++ +  +++K 
Sbjct: 316 RIQDKCEYEPAVYLVATFLMDTLFLTRNERNNNALQLKLKLQEKEVHRVIIASVRLSTKL 375

Query: 167 LCDSFCTNSHYSKVGGVHCSELNILETEFL 196
           L D   ++ ++SKV GV    L+ LE   L
Sbjct: 376 LEDFVHSHEYFSKVCGVSKRLLSKLEISLL 405

>TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.289
           YDL179W
          Length = 289

 Score = 36.6 bits (83), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 59/121 (48%), Gaps = 12/121 (9%)

Query: 92  RSVMNLTRFHSRV-----PPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPE-- 144
            S++N+   +S V     PP ++   ++  +   S+++   L++T   ++ L  + P   
Sbjct: 28  ESIINIKNSNSMVSIALPPPPLA--KFIKNICVKSNVQTPTLMATTVLLEKLKKIIPSNV 85

Query: 145 FKINSLTVHRFLLTATTIASKGLCDSFCTNSHYSKVGG--VHCSELNILETEFLRRVNYR 202
           + I S T HR  L    +++K L DS   N H++K     +H  E+N +E E L   ++ 
Sbjct: 86  YGIES-TRHRIFLGCLILSAKSLNDSSPLNKHWAKYTESYIHLREVNTIERELLNYFDWN 144

Query: 203 I 203
           +
Sbjct: 145 V 145

>TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70
           YNL289W
          Length = 254

 Score = 36.2 bits (82), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 53/97 (54%), Gaps = 5/97 (5%)

Query: 109 SVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSL--TVHRFLLTATTIASKG 166
           S+ +++ RL +++++    LL+T  Y++ L  + P+   + L  TVHR  L    +++K 
Sbjct: 51  SLMSFISRLVRHTNVYTSTLLTTACYLNKLKCILPK-DASGLPSTVHRIFLACLILSAKF 109

Query: 167 LCDSFCTNSHYSKVGG--VHCSELNILETEFLRRVNY 201
             DS   N H++K         ++N++E + ++ +N+
Sbjct: 110 HNDSSPLNRHWAKYTDELFTLEDINLMERQLIQLLNW 146

>Smik_7.138 Chr7 (249640..250953) [1314 bp, 437 aa] {ON} YGL134W
           (REAL)
          Length = 437

 Score = 36.6 bits (83), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 50/106 (47%), Gaps = 9/106 (8%)

Query: 100 FHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLL---------SSVYPEFKINSL 150
           F+ +  P++S  ++L R+      E  V L  ++ I++L           +  + K+   
Sbjct: 302 FYMKSKPSLSSVDFLKRIQDKCKYEPTVYLVAMFLIEMLFLTRNKNGDDGLQLKRKLKEK 361

Query: 151 TVHRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFL 196
            VHR ++ A  +++K L D   ++ ++SKV G+    L  LE   L
Sbjct: 362 EVHRVIIAAVRLSTKLLEDYVHSHEYFSKVCGISKRLLTKLEVSLL 407

>KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 55/114 (48%), Gaps = 3/114 (2%)

Query: 93  SVMNLTRFHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKIN-SLT 151
           SV+++     R    +S+ +++  L ++S+++   L++T  Y+  L S+ P        T
Sbjct: 29  SVISINDTDVRHGSTVSLVDFIKSLIRHSNVQTPTLMATTVYLTKLRSILPHDVCGIETT 88

Query: 152 VHRFLLTATTIASKGLCDSFCTNSHYSKV--GGVHCSELNILETEFLRRVNYRI 203
            HR  +    +A+K L DS   N H++    G     ++N +E E L   ++ +
Sbjct: 89  RHRIFIGCLILAAKNLNDSSPLNKHWTNYTDGLFTLEDVNTIERELLSLFSWNL 142

>NDAI0C01980 Chr3 complement(445212..445892) [681 bp, 226 aa] {ON}
           Anc_5.347 YHR071W
          Length = 226

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%), Gaps = 16/106 (15%)

Query: 109 SVYNYLIRLTKYS-SLEHCVLLSTVYYIDLLSSVY------PEFKINSLTVH---RFLLT 158
           S+  YL+ + K S S  + V++++ Y+  L +SV       PEF      VH   R  L+
Sbjct: 87  SIKTYLMEILKRSQSSRNNVIVASFYFQKLYNSVQLNQDPNPEF------VHCSKRIFLS 140

Query: 159 ATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRII 204
              ++ K L D   +   +S + G+   +L+ILE   L R+NY ++
Sbjct: 141 CLILSHKFLNDKTFSMKAWSLISGISKRDLSILERWCLMRLNYHLV 186

>KLLA0B02024g Chr2 (176585..178168) [1584 bp, 527 aa] {ON} some
           similarities with uniprot|P53124 Saccharomyces
           cerevisiae YGL134W PCL10 Pho85p cyclin recruits
           activates and targets Pho85p cyclin-dependent protein
           kinase to its substrate
          Length = 527

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 58/130 (44%), Gaps = 15/130 (11%)

Query: 72  IEMNDNDPANTNYLNEEPNNRSVMNLTRFHSRVPPNISVYNYLIRLTKYSSLEHCVLLST 131
           IEM  +  ++ N L E  N R++     F  +  P +S+  YL R+    S    + L+ 
Sbjct: 370 IEMEIDHWSHEN-LEETSNIRAI-----FQMKSAPTLSISQYLDRIESKCSFPPIIYLTA 423

Query: 132 ----VYYIDLL-----SSVYPEFKINSLTVHRFLLTATTIASKGLCDSFCTNSHYSKVGG 182
               V Y D+         + E  I     HR L+    +A+K L D   ++S++SKV G
Sbjct: 424 SFLLVTYCDIKFDTGSGKFHLENPITESMTHRLLIAFIRLAAKLLEDHVHSHSYFSKVCG 483

Query: 183 VHCSELNILE 192
           +    L+ LE
Sbjct: 484 ISKKLLSKLE 493

>KAFR0L01200 Chr12 complement(225099..225938) [840 bp, 279 aa] {ON}
           Anc_7.289 YDL179W
          Length = 279

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 48/96 (50%), Gaps = 5/96 (5%)

Query: 112 NYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSL--TVHRFLLTATTIASKGLCD 169
           +++  L   S +    L+ST  +++ L  + P   ++ +  T HR  L    +++K L D
Sbjct: 49  DFICNLVIRSRVNTSTLMSTTVFLNKLKEILPR-NVSGMETTRHRIFLGCLILSAKTLND 107

Query: 170 SFCTNSHYSK--VGGVHCSELNILETEFLRRVNYRI 203
              TN ++S+   G +   E+N +E E L+  N+ +
Sbjct: 108 CSPTNKYWSQHCDGLISVREINKIERELLKYFNWDV 143

>Suva_7.130 Chr7 (251870..253198) [1329 bp, 442 aa] {ON} YGL134W
           (REAL)
          Length = 442

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 48/104 (46%), Gaps = 7/104 (6%)

Query: 100 FHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLL-------SSVYPEFKINSLTV 152
           F+ +  P++S  ++L R+      E  V L   + +D +         +  + K+    +
Sbjct: 309 FYMKSKPSLSSVDFLKRIQDKCEYESTVYLVATFLMDTIYLTRNDNDVLQLKLKLQEKEI 368

Query: 153 HRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFL 196
           HR ++    +++K L D   ++ ++SKV GV    L+ LE   L
Sbjct: 369 HRMIIATVRLSTKLLEDFVHSHEYFSKVCGVSKRLLSKLEVSLL 412

>AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL289W (PCL1)
          Length = 237

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 56/117 (47%), Gaps = 9/117 (7%)

Query: 109 SVYNYLIRLTKYSSLEHCVLLST-VYYIDLLSSVYPEFKINSLTVHRFLLTATTIASKGL 167
           S++ ++ RL +Y+++    LL+T VY   L   +  +      T HR  L    +++K  
Sbjct: 53  SIHMFITRLVRYTNVYTATLLTTAVYLERLRLLLPRDATGIPSTAHRIFLACLILSAKFH 112

Query: 168 CDSFCTNSHYSKV--GGVHCSELNILETEFLR------RVNYRIIPRDDNIKLCKIE 216
            DS   N H++K   G     ++N++E + LR      RV +R + RD    L  I+
Sbjct: 113 NDSSPLNKHWTKYTDGLFTTQDVNLMERQLLRLFDWNVRVGHRDLCRDLAPLLAPIK 169

>CAGL0H08998g Chr8 (877952..879595) [1644 bp, 547 aa] {ON} weakly
           similar to uniprot|Q08966 Saccharomyces cerevisiae
           YPL219w PCL8
          Length = 547

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 22/105 (20%), Positives = 48/105 (45%), Gaps = 8/105 (7%)

Query: 100 FHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLL--------SSVYPEFKINSLT 151
           F  +  P++S   +L R+         + L+  Y + +L        S++    K+    
Sbjct: 414 FTMKSKPSVSAEIFLGRIQNKCEFGPIIYLAAAYLLQILFLTRDNPDSNIRVRLKLRENE 473

Query: 152 VHRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFL 196
           +HR +++   +++K + D   ++ ++SKV GV    L+ LE   +
Sbjct: 474 IHRLIISTVRVSAKLVEDFVHSHEYFSKVCGVSKKLLSKLEVSLI 518

>YGL134W Chr7 (255663..256964) [1302 bp, 433 aa] {ON}  PCL10Pho85p
           cyclin; recruits, activates, and targets Pho85p
           cyclin-dependent protein kinase to its substrate
          Length = 433

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 47/104 (45%), Gaps = 7/104 (6%)

Query: 100 FHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLL-------SSVYPEFKINSLTV 152
           F+ +  P +S  ++L R+      +  V L   + ID L       + +  +  +    V
Sbjct: 300 FYMKSKPTLSSADFLKRIQDKCEYQPTVYLVATFLIDTLFLTRDGNNILQLKLNLQEKEV 359

Query: 153 HRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFL 196
           HR ++ A  +++K L D   ++ ++SKV G+    L  LE   L
Sbjct: 360 HRMIIAAVRLSTKLLEDFVHSHEYFSKVCGISKRLLTKLEVSLL 403

>NDAI0F00460 Chr6 complement(106641..108614) [1974 bp, 657 aa] {ON}
           Anc_5.677 YOR073W
          Length = 657

 Score = 34.3 bits (77), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%)

Query: 246 NILDIYYHKIVQLVGSFSASSDKSRKANYTLLLSGNNMEKEVSNNIKEN 294
           N+ D  Y K+  L  S+S  +++  K N TL L  N MEK++S  I+EN
Sbjct: 36  NLTDQEYSKLATLRSSYSQQNNQLAKENSTLKLKINEMEKKLSQLIQEN 84

>ZYRO0E07326g Chr5 complement(560064..561350) [1287 bp, 428 aa] {ON}
           weakly similar to uniprot|P53124 Saccharomyces
           cerevisiae YGL134W PCL10 Pho85p cyclin recruits
           activates and targets Pho85p cyclin-dependent protein
           kinase to its substrate
          Length = 428

 Score = 33.9 bits (76), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 22/112 (19%), Positives = 49/112 (43%), Gaps = 9/112 (8%)

Query: 89  PNNRSVMNLTRFHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLL--------SS 140
           PN R   +  +F  +  P ++   ++ R+    +    V L++ + +  L          
Sbjct: 281 PNPRD-WDFNQFSMKSMPTVTYQEFITRIQTKCTYSPAVFLASAFLLQTLCLMRNDNNGE 339

Query: 141 VYPEFKINSLTVHRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILE 192
           +    ++    +HR ++    IA+K + D   ++ ++SKV G+    L+ LE
Sbjct: 340 LCLRHRLQDSQIHRLVIACVRIATKIMEDHVHSHQYFSKVCGISKRLLSRLE 391

>TPHA0E02750 Chr5 (574999..576816) [1818 bp, 605 aa] {ON} Anc_6.236
           YGL134W
          Length = 605

 Score = 33.9 bits (76), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 46/108 (42%), Gaps = 14/108 (12%)

Query: 100 FHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYI-----------DLLSSVYPEFKIN 148
           F  +  P ++  N++ R+      +  + L T+  +           +L+   YP   + 
Sbjct: 469 FKMKSTPTVTYQNFIERIQSKCLFDETIYLGTIVLLQSLFLVREKETNLIKLKYP---LE 525

Query: 149 SLTVHRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFL 196
              VHR L+ +  ++SK L D   ++ + SKV GV    L  LE   L
Sbjct: 526 ESYVHRLLIASIRVSSKVLQDFVHSHEYISKVFGVSKRLLTKLEVSLL 573

>KLLA0D17358g Chr4 complement(1477523..1483069) [5547 bp, 1848 aa]
            {ON} similar to uniprot|P11075 Saccharomyces cerevisiae
            YDR170C SEC7 Guanine nucleotide exchange factor (GEF) for
            ADP ribosylation factors involved in proliferation of the
            Golgi intra-Golgi transport and ER-to-Golgi transport
            found in the cytoplasm and on Golgi-associated coated
            vesicles
          Length = 1848

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 263  SASSDKSRKANYTLLLSGN-NMEKEVSNNIKENSNGQNIGESEQAISSKLSRDPPPKRNF 321
            +A +D +   N T   S N N+E+EV   I E  NGQ++G  +  IS+      PP+R  
Sbjct: 1568 TAGTDSTTPTNNTTKESNNSNVEEEVERAIAE-ENGQDVGNEQGTISNGDIDALPPRRLV 1626

Query: 322  ET 323
            ET
Sbjct: 1627 ET 1628

>Ecym_1201 Chr1 (406247..407581) [1335 bp, 444 aa] {ON} similar to
           Ashbya gossypii AER440C
          Length = 444

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 51/114 (44%), Gaps = 22/114 (19%)

Query: 93  SVMNLTRFHSRVPPNISVYNYLIRLTKY-SSLEHCVLLSTVYYIDLLSSVYPEFKINSLT 151
           SV+N TR      P+ ++Y  L  L+KY   L H V                    +S+ 
Sbjct: 184 SVLNATRL-----PSTTIYFALDYLSKYLGKLPHGVE---------------SIGGDSVN 223

Query: 152 V-HRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRII 204
           V ++ L+ A  +A+K   D   TN  +S+  G+ CS +N  E E+L    +R+ 
Sbjct: 224 VIYQNLMVAFVLANKFNDDKTFTNKSWSQATGMKCSVINTYEREWLAVFEWRLF 277

>KAFR0K02385 Chr11 complement(491679..492905) [1227 bp, 408 aa] {ON}
          Length = 408

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/92 (21%), Positives = 47/92 (51%), Gaps = 5/92 (5%)

Query: 95  MNLTRFHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLL---SSVYPEFKINSLT 151
           M + + HS   P+++  ++L R+         + +++ Y +  L    S   + K + ++
Sbjct: 277 MEVYKMHS--IPSLTYRSFLNRVQSKCEFRSTIYVASCYLLQQLFLDDSQNLKSKFDEIS 334

Query: 152 VHRFLLTATTIASKGLCDSFCTNSHYSKVGGV 183
           VHR ++    ++SK + D   ++ ++SKV G+
Sbjct: 335 VHRIIIAVIRLSSKLIEDKVHSHEYFSKVAGI 366

>NDAI0C04300 Chr3 (981107..981829) [723 bp, 240 aa] {ON} 
          Length = 240

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 48/107 (44%), Gaps = 11/107 (10%)

Query: 109 SVYNYLIRLTKYSSLEHCVLLSTVYYIDLL--------SSVYPEFKINSLTVHRFLLTAT 160
           S+ +++  +TK S  +  +LL   YY   L         S  PEF   +    R  LT  
Sbjct: 94  SLKSFINEITKRSKSKRNILLLATYYFQKLYTSLSTCPVSTIPEF---AFCAKRSFLTCI 150

Query: 161 TIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRD 207
            IA K L DS  +   +S + G++   L+ +E   L +++Y +   D
Sbjct: 151 IIAHKYLNDSTFSMESWSLISGLNKKALSTIERWCLGKLDYNLFVDD 197

>YHR071W Chr8 (237004..237693) [690 bp, 229 aa] {ON}  PCL5Cyclin,
           interacts with and phosphorylated by Pho85p
           cyclin-dependent kinase (Cdk), induced by Gcn4p at level
           of transcription, specifically required for Gcn4p
           degradation, may be sensor of cellular protein
           biosynthetic capacity
          Length = 229

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 4/70 (5%)

Query: 140 SVYPEFKINSLTVHRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRV 199
           S  PEF   S    R  L    ++ K L D+  +  ++  + G+H  +L+++E   L ++
Sbjct: 118 SSLPEF---SHCSRRIFLCCLILSHKFLNDNTYSMKNWQIISGLHAKDLSLMERWCLGKL 174

Query: 200 NYRI-IPRDD 208
           NY + IP D+
Sbjct: 175 NYELAIPYDE 184

>NCAS0H01650 Chr8 complement(316598..317230) [633 bp, 210 aa] {ON}
           Anc_5.347 YHR071W
          Length = 210

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 42/98 (42%), Gaps = 10/98 (10%)

Query: 113 YLIRLTKYSSLEHCVLLSTVYYIDLLSSVY-------PEFKINSLTVHRFLLTATTIASK 165
           YL  + K S     V+     Y+D + S +       P+F   +  V R  L+   IA K
Sbjct: 81  YLKEVCKRSRSTKTVVFLAAIYLDKIYSNWEPMLGDIPKF---ARCVKRVFLSCLIIAHK 137

Query: 166 GLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRI 203
              D   +   +S + G+   EL I+E + L  +NY +
Sbjct: 138 FANDKTFSMRSWSSISGLGRKELTIMEKKCLLEINYEL 175

>Skud_8.129 Chr8 (210309..210971) [663 bp, 220 aa] {ON} YHR071W
           (REAL)
          Length = 220

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 42/89 (47%), Gaps = 10/89 (11%)

Query: 127 VLLSTVYYIDLL------SSVYPEFKINSLTVHRFLLTATTIASKGLCDSFCTNSHYSKV 180
            +L+T Y+  +        S  PEF   S    R  L    ++ K L D+  +  ++  +
Sbjct: 98  AILATFYFQRIYRSRAQNESSLPEF---SRCSKRIFLCCLILSHKFLNDNTYSMKNWQII 154

Query: 181 GGVHCSELNILETEFLRRVNYRI-IPRDD 208
            G+H  +L+++E   L ++NY + IP  D
Sbjct: 155 SGLHAKDLSLMERWCLGKLNYELAIPCSD 183

>SAKL0A03938g Chr1 (367076..368581) [1506 bp, 501 aa] {ON} weakly
           similar to uniprot|Q6B153 Saccharomyces cerevisiae
           YPL219W PCL8 Cyclin interacts with Pho85p
           cyclin-dependent kinase (Cdk) to phosphorylate and
           regulate glycogen synthase also activates Pho85p for
           Glc8p phosphorylation
          Length = 501

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 40/85 (47%), Gaps = 7/85 (8%)

Query: 106 PNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLL-------SSVYPEFKINSLTVHRFLLT 158
           P++S   YL R+         V L+  Y +  L       S +   F +    +HR ++ 
Sbjct: 374 PSLSYEEYLERIHSKLMFSPVVYLTATYLLHELTLTRQQDSKLALSFPLKITQIHRIIIA 433

Query: 159 ATTIASKGLCDSFCTNSHYSKVGGV 183
           +  +A+K L D   +++++SKV GV
Sbjct: 434 SIRLAAKLLEDFVHSHAYFSKVCGV 458

>CAGL0J06336g Chr10 complement(602954..603898) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12477 Saccharomyces cerevisiae
           YDL179w PCL9 or uniprot|P25693 Saccharomyces cerevisiae
           YDL127w
          Length = 314

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 56/114 (49%), Gaps = 5/114 (4%)

Query: 93  SVMNLTRFHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKIN-SLT 151
           S++ + + +S  P  +S++  +  L   S ++   L++T  Y+D LS + P        T
Sbjct: 40  SMIKIKKTNSPKPVELSLF--VEELVASSKVQASTLMATAVYLDRLSRIIPSNVCGIETT 97

Query: 152 VHRFLLTATTIASKGLCDSFCTNSHYSKV--GGVHCSELNILETEFLRRVNYRI 203
            HR  L    ++SK L DS   N H++K   G +   E+N +E E L   N+ I
Sbjct: 98  KHRMFLGCLILSSKSLDDSSLFNKHWTKYCNGLLTLKEVNSIERELLSYFNWDI 151

>KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.234
           YER169W
          Length = 890

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 17/69 (24%)

Query: 184 HCSELNILETEFLRRVNYRIIP---RDDNIKLCKIEHQQNKFTMDFSDLSMVGMTVQSNH 240
           HCSE       FLR  +  I P   RD+ I++ K+ H QN+F + F      G       
Sbjct: 293 HCSE-------FLRHKSILISPKLLRDNGIRVNKVVHYQNEFIITFPYGYHAGF------ 339

Query: 241 QNSGFNILD 249
            N G+N+ +
Sbjct: 340 -NYGYNLAE 347

>Skud_16.280 Chr16 (516846..518315) [1470 bp, 489 aa] {ON} YPL003W
           (REAL)
          Length = 489

 Score = 30.4 bits (67), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 36/62 (58%), Gaps = 2/62 (3%)

Query: 130 STVYYIDLLSSVYPEFKINSLTVHRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELN 189
           +TV Y +L S    + + +   V + L+++    SKG+ ++FC  SHY +V G+  SE +
Sbjct: 347 TTVNYTELKSIYEVKAEFDRSCVKKSLVSSGKKVSKGVLNTFC--SHYGEVRGILPSESD 404

Query: 190 IL 191
           +L
Sbjct: 405 LL 406

>CAGL0J10846g Chr10 complement(1058824..1059513) [690 bp, 229 aa]
           {ON} similar to uniprot|P38794 Saccharomyces cerevisiae
           YHR071w PCL5 cyclin like protein interacting with PHO85P
          Length = 229

 Score = 30.0 bits (66), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 50/101 (49%), Gaps = 9/101 (8%)

Query: 109 SVYNYLIRLTKYSSLEH-CVLLSTVYYIDLLSSV-----YPEFKINSLTVHRFLLTATTI 162
           S+ N+L  +TK + +    +LL+++Y+  L+ S       PEF   +    R LL    +
Sbjct: 72  SIANFLKEVTKRAHISRDILLLASIYFDKLIKSHEGAINVPEF---AYCGKRLLLVCIIL 128

Query: 163 ASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRI 203
           A K   D   +   +++V G+    + I+E   L+++NY +
Sbjct: 129 AHKFSNDITFSMRVWTQVSGLPTRSIAIMERWCLKQLNYGL 169

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,104,623
Number of extensions: 1519679
Number of successful extensions: 7810
Number of sequences better than 10.0: 155
Number of HSP's gapped: 7982
Number of HSP's successfully gapped: 164
Length of query: 367
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 256
Effective length of database: 40,753,473
Effective search space: 10432889088
Effective search space used: 10432889088
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)