Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1037.296.25ON74674637020.0
TPHA0J003706.25ON74373619400.0
KAFR0G026606.25ON73572718890.0
SAKL0E01452g6.25ON73772718770.0
NCAS0H008606.25ON75574318550.0
Suva_15.1766.25ON74572718530.0
KNAG0M012306.25ON73873718430.0
ZYRO0C07678g6.25ON74172818170.0
Smik_15.1706.25ON77372917920.0
NDAI0D008506.25ON79076017930.0
TDEL0G044406.25ON73573117810.0
YOR001W (RRP6)6.25ON73372917290.0
TBLA0A071706.25ON77176017310.0
CAGL0E02585g6.25ON73773817280.0
Skud_15.1626.25ON73472917230.0
KLLA0D01309g6.25ON74473717180.0
ACL001C6.25ON74573116950.0
Ecym_30306.25ON74774316790.0
KLTH0C11066g6.25ON73572516080.0
Kwal_56.224476.25ON73572715670.0
KLLA0F02431g7.58ON95688752.3
KAFR0C052005.499ON249149706.1
KLLA0B13112g4.202ON73067708.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1037.29
         (746 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {O...  1430   0.0  
TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON...   751   0.0  
KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.2...   732   0.0  
SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} simila...   727   0.0  
NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {O...   719   0.0  
Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001...   718   0.0  
KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {...   714   0.0  
ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} simila...   704   0.0  
Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001...   694   0.0  
NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {O...   695   0.0  
TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.2...   690   0.0  
YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nucle...   670   0.0  
TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6...   671   0.0  
CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} simila...   670   0.0  
Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001...   668   0.0  
KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} simila...   666   0.0  
ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON} S...   657   0.0  
Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to ...   651   0.0  
KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {...   624   0.0  
Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001...   608   0.0  
KLLA0F02431g Chr6 (220848..223718) [2871 bp, 956 aa] {ON} highly...    33   2.3  
KAFR0C05200 Chr3 complement(1034417..1035166) [750 bp, 249 aa] {...    32   6.1  
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    32   8.7  

>Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {ON}
           complement(68981..71221) [2241 nt, 747 aa]
          Length = 746

 Score = 1430 bits (3702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 700/746 (93%), Positives = 700/746 (93%)

Query: 1   MSEDINKEXXXXXXXXXXXXXXXXXQDVDFYRNLDKEISTSLNESSKEITNMXXXXXXXX 60
           MSEDINKE                 QDVDFYRNLDKEISTSLNESSKEITNM        
Sbjct: 1   MSEDINKELLSSVVSTVRAASSLAAQDVDFYRNLDKEISTSLNESSKEITNMINTLLLSI 60

Query: 61  XXXXXXXXXGKEGLEQYWKDFSNVMDNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQ 120
                    GKEGLEQYWKDFSNVMDNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQ
Sbjct: 61  NENNEELESGKEGLEQYWKDFSNVMDNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQ 120

Query: 121 SDSNPSKRVTKPQLQFSRPVDNSESKPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYA 180
           SDSNPSKRVTKPQLQFSRPVDNSESKPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYA
Sbjct: 121 SDSNPSKRVTKPQLQFSRPVDNSESKPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYA 180

Query: 181 HPYEVEIDKQEYNASVLQVAEPLKSQPWNSESTWVDTSEALQSMLDKLKECTEIAVDLEH 240
           HPYEVEIDKQEYNASVLQVAEPLKSQPWNSESTWVDTSEALQSMLDKLKECTEIAVDLEH
Sbjct: 181 HPYEVEIDKQEYNASVLQVAEPLKSQPWNSESTWVDTSEALQSMLDKLKECTEIAVDLEH 240

Query: 241 HDYRSYYGIVCLMQISTRKEDFLVDTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQ 300
           HDYRSYYGIVCLMQISTRKEDFLVDTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQ
Sbjct: 241 HDYRSYYGIVCLMQISTRKEDFLVDTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQ 300

Query: 301 RDLGLYVVSLFDTYHASRALGFPRHSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAY 360
           RDLGLYVVSLFDTYHASRALGFPRHSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAY
Sbjct: 301 RDLGLYVVSLFDTYHASRALGFPRHSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAY 360

Query: 361 ARADTHFLLNIYDQIRNQLIRENKLAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEK 420
           ARADTHFLLNIYDQIRNQLIRENKLAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEK
Sbjct: 361 ARADTHFLLNIYDQIRNQLIRENKLAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEK 420

Query: 421 EEPWRTLVYQYNVPSTKIELLKRIWEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPA 480
           EEPWRTLVYQYNVPSTKIELLKRIWEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPA
Sbjct: 421 EEPWRTLVYQYNVPSTKIELLKRIWEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPA 480

Query: 481 GVISVSNVMTDHVRSNSKVIANLIKKSLEDMKSVPAGALTAFQNIDYKIGQKFASDKLTI 540
           GVISVSNVMTDHVRSNSKVIANLIKKSLEDMKSVPAGALTAFQNIDYKIGQKFASDKLTI
Sbjct: 481 GVISVSNVMTDHVRSNSKVIANLIKKSLEDMKSVPAGALTAFQNIDYKIGQKFASDKLTI 540

Query: 541 SQIQNMTALFKEIASNPSIIEKDVSKKIDPILFSNIFLSKNEIVLYDHDKRHVVTNEQLA 600
           SQIQNMTALFKEIASNPSIIEKDVSKKIDPILFSNIFLSKNEIVLYDHDKRHVVTNEQLA
Sbjct: 541 SQIQNMTALFKEIASNPSIIEKDVSKKIDPILFSNIFLSKNEIVLYDHDKRHVVTNEQLA 600

Query: 601 GRAEEVEGFMNEANNTTLAINIESSAEMHVEEPEAKEKNALFSPPISNVENASSSNTDGF 660
           GRAEEVEGFMNEANNTTLAINIESSAEMHVEEPEAKEKNALFSPPISNVENASSSNTDGF
Sbjct: 601 GRAEEVEGFMNEANNTTLAINIESSAEMHVEEPEAKEKNALFSPPISNVENASSSNTDGF 660

Query: 661 EDMNDIIVLKDVKKRTNIKDHKKKQGMPNKEVIDYSKLDTILXXXXXXXXXXXXGDPFGE 720
           EDMNDIIVLKDVKKRTNIKDHKKKQGMPNKEVIDYSKLDTIL            GDPFGE
Sbjct: 661 EDMNDIIVLKDVKKRTNIKDHKKKQGMPNKEVIDYSKLDTILSKEKRENSKKRKGDPFGE 720

Query: 721 ENGLEGPKAAKKRKQINRGKNVSFKR 746
           ENGLEGPKAAKKRKQINRGKNVSFKR
Sbjct: 721 ENGLEGPKAAKKRKQINRGKNVSFKR 746

>TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON}
           Anc_6.25 YOR001W
          Length = 743

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/736 (51%), Positives = 512/736 (69%), Gaps = 30/736 (4%)

Query: 26  QDVDFYRNLDKEISTSLNESSKEITNMXXXXXXXXXXXXXXXXXGKEGLEQYWKDFSNVM 85
           QDVDFYR+LDKEI++SL  +S+++T+M                 GKE L++ WKD  N++
Sbjct: 23  QDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEGLVEGKENLDESWKDIGNLL 82

Query: 86  DNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQSDSNPSKRVTKPQLQFSRPVDNSES 145
           D+LFE +D S+D ++++   + N  + +YL+DS   +S+   R++KPQL FS PVDNSE+
Sbjct: 83  DSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESDNVTRLSKPQLNFSVPVDNSET 142

Query: 146 KPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAHPYEVEIDKQEYNASVLQVAEPLKS 205
            PF PLL DKP+++    + L I+  +E+ P HY  PYE EIDKQEYN  VLQ ++P+ S
Sbjct: 143 HPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYETEIDKQEYNEQVLQFSDPIPS 202

Query: 206 QPWN-SESTWVDTSEALQSMLDKLKECTEIAVDLEHHDYRSYYGIVCLMQISTRKEDFLV 264
           + W  +E+ WVD  E+L +ML++LK  TE+AVDLEHHD+RSYYGI CLMQISTR  D+LV
Sbjct: 203 KVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFRSYYGITCLMQISTRNTDYLV 262

Query: 265 DTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQRDLGLYVVSLFDTYHASRALGFPR 324
           DT+ALRD+L +LN VF DP I K+LHGAFMDIIWLQRDLGLY+VSLFDTYHASRALGFPR
Sbjct: 263 DTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLGLYIVSLFDTYHASRALGFPR 322

Query: 325 HSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAYARADTHFLLNIYDQIRNQLIRENK 384
           HSLAYLLE++A+FKTSK+YQLADWR RPLSK M+AYARADTHFLLNI+DQ+RN LI+E+K
Sbjct: 323 HSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARADTHFLLNIFDQLRNMLIQEDK 382

Query: 385 LAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEKEEPWRTLVYQYNVPSTKIELLKRI 444
           LA +L ESR VAKRRFEYS+++P +PS AVF+P E + PWR+++YQYN+PS K+EL+KR+
Sbjct: 383 LASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMPWRSMIYQYNIPSQKVELVKRL 442

Query: 445 WEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAGVISVSNVMTDHVRSNSKVIANLI 504
           WEWRD IARRDDESPRYIMPNQL+ SLVEY P +PAGVISV+ +MTD VRSN+K IANLI
Sbjct: 443 WEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVISVNRMMTDPVRSNAKAIANLI 502

Query: 505 KKSLEDMKSVPAGALTAFQNIDYKIGQKFASDK------LTISQIQNMTALFKEI----A 554
           K +LEDMK+          NI   +    A DK      L+ SQI+ + + F+ I    +
Sbjct: 503 KSTLEDMKN---------NNISTTVVSTTAKDKETSSNDLSTSQIKFIVSQFENILEKYS 553

Query: 555 SNPSIIEKDVSKK-IDPILFSNIFLSKNEIVLYDHDKRHVVTNEQLAGRAEEVEGFMNEA 613
           SN S +    SK+  D ++FS IF S+++I+ YD   +H++T +QL+ R +EV+  M +A
Sbjct: 554 SNNSNLNDVTSKEGKDSLVFSKIFNSRDDIITYDKGTKHLITEQQLSDRQKEVDAAMKQA 613

Query: 614 NNTTLAINIESSAEMHVEEPEAKEKNALFSPPISNVENASSSNTDGFEDMNDIIVLKDVK 673
                ++ ++ + +  +++P  + +  +    +   E+         ED+++IIVLKD K
Sbjct: 614 EEIAFSMEVQDTHKESMKQPFPEPEEVISQSHLPAFEDKEEQ-----EDLDEIIVLKDTK 668

Query: 674 KRTNIKDHKKKQGMPNKE--VIDYSKLDTILXXXXXXXXXXXXG-DPFGEENGLEGPKAA 730
            R N + H+ +    + +  VIDYSK D IL              DPF  +N     + A
Sbjct: 669 DRRN-RQHRGRGRSADSDHTVIDYSKGDKILSQDNRRRTPNKRKYDPFSADNNENALQGA 727

Query: 731 KKRKQINRGKNVSFKR 746
           K+R+   + +NVSFKR
Sbjct: 728 KRRRPTAKNRNVSFKR 743

>KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/727 (51%), Positives = 495/727 (68%), Gaps = 24/727 (3%)

Query: 26  QDVDFYRNLDKEISTSLNESSKEITNMXXXXXXXXXXXXXXXXXGKEGLEQYWKDFSNVM 85
           QDVDFYR+LD E+S S+NE + E+ +M                 GKE L + WK  SN++
Sbjct: 26  QDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSIDENYETLDEGKEELTESWKSLSNIV 85

Query: 86  DNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQSDSNPSKRVTKPQLQFSRPVDNSES 145
           DNLFEKSDRSLDI+            F+Y  ++  +++ P KR+ KPQL+F  P+DNSES
Sbjct: 86  DNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATTTENIPQKRINKPQLKFVPPIDNSES 145

Query: 146 KPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAHPYEVEIDKQEYNASVLQVAEPLKS 205
            PF+PLL +KP+++K+  +S  +I   E +P HYAHPYE EID Q YN S+LQV EP+ S
Sbjct: 146 HPFIPLLKEKPNALKTIDESTKLINSDENVPEHYAHPYEYEIDNQPYNDSILQVREPIPS 205

Query: 206 QPWN-SESTWVDTSEALQSMLDKLKECTEIAVDLEHHDYRSYYGIVCLMQISTRKEDFLV 264
           + W+ +E  WVD  E+L  ML+ +K+ TEIA+DLEHHDYR+YYGIVCLMQISTR+ D+LV
Sbjct: 206 KSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLEHHDYRTYYGIVCLMQISTRETDYLV 265

Query: 265 DTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQRDLGLYVVSLFDTYHASRALGFPR 324
           DT+ALR++L +LNEVF DP+++KVLHGAFMDIIWLQRDLGLY+VSLFDT+HASRALGFPR
Sbjct: 266 DTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWLQRDLGLYIVSLFDTFHASRALGFPR 325

Query: 325 HSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAYARADTHFLLNIYDQIRNQLIRENK 384
           HSLAYLLE++ANFKTSKKYQLADWRVRPLSK M AYARADTHFLLNIYDQ+RN+L+  NK
Sbjct: 326 HSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTAYARADTHFLLNIYDQLRNRLVETNK 385

Query: 385 LAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEKEEPWRTLVYQYNVPSTKIELLKRI 444
           L  VL ESRNVAKRRFEYS+FRP+VPSP V++ +EKE+PWRTL++QYN+PS + +LLK +
Sbjct: 386 LVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALEKEDPWRTLMFQYNIPSEREDLLKGL 445

Query: 445 WEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAGVISVSNVMTDHVRSNSKVIANLI 504
           +EWRDMIARRDDESPRYIMPNQLM++LV YTP DPAGVIS S V+TD+VRSNSK+IANLI
Sbjct: 446 FEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDPAGVISASQVVTDYVRSNSKIIANLI 505

Query: 505 KKSLEDMKSVPAGALTAFQNIDYKIGQKFASDKLTISQIQNMTALFKEIASNPSIIEKDV 564
           K +L   K         F   ++      ++DK+T+SQI+   ++F +IA        D 
Sbjct: 506 KNALTRAKD--QNRQLQFVADNHTRESYRSTDKMTVSQIKETASVFIQIAEKLGTCNND- 562

Query: 565 SKKIDPILFSNIFLS---KNEIVLYDHDKRHVVTNEQLAGRAEEVEGFMNEANNTTLAIN 621
            ++      SN F S   K +I+ Y + ++H V  +QL  R       +NE  N    + 
Sbjct: 563 QQQSKSFARSNYFGSLSKKLDIIEYKNGEKHSVKQQQLVSRFNTYTKQVNELTNVRYELP 622

Query: 622 IESSAEMHVEEPEAKEKNALFSPPISNVENASSSNTDGFEDMNDIIVLKDVKKRTNIKDH 681
           +      H E P+ ++ +      +     A S       D+++++VLK V ++ N    
Sbjct: 623 V------HKEPPQLQKDDV---EEVKKTIIADSIPAKPEIDLDEVVVLKKVNRQPNKTKL 673

Query: 682 KKKQGMPNKEVIDYSKLDTILXXXXXXXXXXXXG---DPFGEENGLEGPKAAKKRKQINR 738
           ++ + +   + IDYSK + IL                DPF   N  EGPKAA+KRK   R
Sbjct: 674 EENEKI---DFIDYSKSEKILKGDKQRKKRESKKRQFDPFAASN--EGPKAARKRKSGTR 728

Query: 739 GKNVSFK 745
           G+N+S+K
Sbjct: 729 GRNLSYK 735

>SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 737

 Score =  727 bits (1877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/727 (51%), Positives = 494/727 (67%), Gaps = 23/727 (3%)

Query: 26  QDVDFYRNLDKEISTSLNESSKEITNMXXXXXXXXXXXXXXXXXGKEGLEQYWKDFSNVM 85
           QD+DF+++LD  IS S+  SS ++ N+                 GK+  ++ WKD  ++M
Sbjct: 26  QDLDFFKSLDSGISKSVEGSSSKLLNLINEVLLSIDENNDTIEYGKDNFQESWKDIGDIM 85

Query: 86  DNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQSDSNPSKRVTKPQLQFSRPVDNSES 145
           DNLFEKSD + D + R+  +  N S  QYL DS++S+ NPSKR+ KPQL F  P+DN+ES
Sbjct: 86  DNLFEKSDHAFDALKRNSINQGN-SNVQYLDDSSRSNLNPSKRIEKPQLNFKTPIDNTES 144

Query: 146 KPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAHPYEVEIDKQEYNASVLQVAEPLKS 205
            PF PLL +KPH+++  ++ L   PE+E +PSHY HPY  EID QEYN S+LQ+ +P+ S
Sbjct: 145 HPFKPLLENKPHALRPLSEILKQTPETENIPSHYPHPYGYEIDTQEYNESILQIRDPIPS 204

Query: 206 QPW-NSESTWVDTSEALQSMLDKLKECTEIAVDLEHHDYRSYYGIVCLMQISTRKEDFLV 264
           QPW +++  WVDT E+LQ +L++L+   EIAVDLEHHDYRSYYGIVCLMQISTR+ D+LV
Sbjct: 205 QPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLEHHDYRSYYGIVCLMQISTRERDWLV 264

Query: 265 DTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQRDLGLYVVSLFDTYHASRALGFPR 324
           DT+ALR+ELH+LNE+F DP++LKV HGAFMDIIWLQRDLG+YVVSLFDTYHASR+LG PR
Sbjct: 265 DTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWLQRDLGIYVVSLFDTYHASRSLGLPR 324

Query: 325 HSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAYARADTHFLLNIYDQIRNQLIRENK 384
           HSLAYLLEK+A FKTSKKYQLADWR+RPL+KPM AYARADTHFLLNIYDQ+RN LI +NK
Sbjct: 325 HSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRAYARADTHFLLNIYDQLRNSLIEQNK 384

Query: 385 LAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEKEEPWRTLVYQYNVPSTKIELLKRI 444
           LA VL +SRNVAKRRFEY+ FRPK+ S  VF+PIEK+EPWR L+YQYN+P ++  L++++
Sbjct: 385 LAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIEKDEPWRNLMYQYNIPLSREPLMRKL 444

Query: 445 WEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAGVISVSNVMTDHVRSNSKVIANLI 504
           +EWRD IARRDDESPRY+MPNQL++SLV   P DPAGV+SVSN +TD+VRSNSK+++NLI
Sbjct: 445 YEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDPAGVLSVSNFITDYVRSNSKMLSNLI 504

Query: 505 KKSLEDMKSVPAGALTAFQNIDYKIGQKFASDKLTISQIQNMTALFKEIASNPSIIEKDV 564
           KK+LE +K+   G ++       ++ +K  S  L+ISQIQNM   F  +AS         
Sbjct: 505 KKTLESLKN---GDVSTNNAGSSQLEEKDLSQVLSISQIQNMCLQFNSLASKVKKANSAT 561

Query: 565 SK--KIDPILFSNIFLSKNEIVLYDHDKRHVVTNEQLAGRAEEVEGFMNEANNTTLAINI 622
           +   K+  +   +   S +  VLY  + + V+   QL  R  EV   + E       +++
Sbjct: 562 NSMPKVSILFDGDHIFSNDRAVLYSKNSKIVIDENQLQERKLEVSEKLKEVQEPDFRLHV 621

Query: 623 ESSAEMHVEEPEAKEKNALFSPPISNVENAS-SSNTDGFEDMNDIIVLKDVKKRTNIKDH 681
                 +V   E  E     S  +S  ++ + +S TD  E   D I++   KKR   +D 
Sbjct: 622 ------NVTTKETDE----VSKDVSEKDDVNRASETDPLETNKDEIIVLKKKKRHEPQDR 671

Query: 682 KKKQGMPNKEVIDYSKLDTILXXXXXXXXXXXXG---DPFGEENGLEGPKAAKKRKQINR 738
           KK     + E +DY   + +L                DP+  EN   GP++AKKRK+   
Sbjct: 672 KKVGNSTDVEPMDYKNAEKLLGNSKKSSKQKTTKRRFDPYTSENV--GPQSAKKRKKPTP 729

Query: 739 GKNVSFK 745
           GKN+SFK
Sbjct: 730 GKNMSFK 736

>NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {ON}
           Anc_6.25 YOR001W
          Length = 755

 Score =  719 bits (1855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/743 (50%), Positives = 491/743 (66%), Gaps = 38/743 (5%)

Query: 26  QDVDFYRNLDKEISTSLNESSKEITNMXXXXXXXXXXXXXXXXXGKEGLEQYWKDFSNVM 85
           QDVDFYR++DK+I+ SL +SS +I +M                  KE LE  WKDF N+M
Sbjct: 29  QDVDFYRSIDKDIAHSLEQSSNQIADMINSVLLSIDENSEQVDGTKENLEDIWKDFGNLM 88

Query: 86  DNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQSDSNPSKRVTKPQLQFSRPVDNSES 145
           DNLFEKSDRS+DIITR    ++ +S  QY+ + +  D  P K++ KPQL+F+ P+DN+ES
Sbjct: 89  DNLFEKSDRSIDIITRGHGGSNGQSGMQYIDEFSGRDLTPGKQILKPQLKFTTPIDNTES 148

Query: 146 KPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAHPYEVEIDKQEYNASVLQVAEPLKS 205
            PF+PLL +KP ++K   +S+ +IPE E  P HY  PYE EID QEYN  +LQ  +P+ S
Sbjct: 149 HPFIPLLKEKPFALKPLEESMQMIPEDETSPMHYPQPYEYEIDHQEYNDLILQKKDPIPS 208

Query: 206 QPW-NSESTWVDTSEALQSMLDKLKECTEIAVDLEHHDYRSYYGIVCLMQISTRKEDFLV 264
             W ++E  WVDT   LQS++  L+  TEIAVDLEHHDYR+YYGI CLMQISTRK D+L+
Sbjct: 209 TSWTDNEPIWVDTVSQLQSIMPDLEASTEIAVDLEHHDYRTYYGITCLMQISTRKNDYLI 268

Query: 265 DTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQRDLGLYVVSLFDTYHASRALGFPR 324
           DTLALR++L ILN VFA+P I KV HGAFMDIIWLQRDLGLYVV LFDT+HASRA+G P+
Sbjct: 269 DTLALREDLQILNNVFANPMITKVFHGAFMDIIWLQRDLGLYVVGLFDTFHASRAMGLPK 328

Query: 325 HSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAYARADTHFLLNIYDQIRNQLIRENK 384
           HSLAYLLEK+A FKTSKKYQLADWR+RPLSK MHAYARADTHFLLNI+DQ+RN LI +NK
Sbjct: 329 HSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMHAYARADTHFLLNIFDQMRNSLIEQNK 388

Query: 385 LAEVLFESRNVAKRRFEYSRFRPKV--PSPAVFTPIEKEEPWRTLVYQYNVPSTKIELLK 442
           LA VL ESRNVAKRRFEYS FRPKV   +  V++PIEK++PW+T+++QYN+P  K  LLK
Sbjct: 389 LAGVLKESRNVAKRRFEYSSFRPKVLQTNGLVYSPIEKDDPWKTIMFQYNIPPQKEPLLK 448

Query: 443 RIWEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAGVISVSNVMTDHVRSNSKVIAN 502
            +++WRD IARRDDESPR++MPNQL++SLV YTPID  GV+SVSN +TD+VRSNSK++AN
Sbjct: 449 ELYQWRDKIARRDDESPRFVMPNQLLVSLVAYTPIDAPGVVSVSNSVTDYVRSNSKILAN 508

Query: 503 LIKKSLEDMK-------SVPAGALTAFQNIDYKIGQKFASDKLTISQIQNMTALFKEIAS 555
           LIK  L  MK       +V    ++      + + Q     KLTI Q+QN+ + F+ ++ 
Sbjct: 509 LIKNCLAKMKDNKFLDNNVAEEGISVVPETGHDLSQ-----KLTIHQLQNLKSKFQLLSD 563

Query: 556 --NPSIIEKDVSKKIDPILFSNIFLSKNEIVLYDHDKRHVVTNEQLAGRAEEVEGFMNEA 613
             N S+  + +S      LF  I  + +  + Y  D +   T EQ   R+E+ +  M + 
Sbjct: 564 KFNNSVKTR-LSNHDQLYLFDGISFADDVTIKYFADGKIQTTAEQYKERSEQFDDAMKQL 622

Query: 614 NNTTLAINIESSAEMHVEEPEAKEKNALFSPPISNVENASSSNTDGF---EDMNDIIVLK 670
                 I +        E  + ++++ +  PPI+   NA     +     ED++++IVL+
Sbjct: 623 EEVEYCIPVIE------ENKQTQDQDNI--PPITVATNAEGQVNEMIEKPEDLDEVIVLR 674

Query: 671 DVKKRTNIKDHKKKQGMPNKEVIDYSKLDTILXXXXXXXXXXXXG-------DPFGEENG 723
              K  +IK+  K +  P  E+IDY K   +L                    DP+   N 
Sbjct: 675 KTNKNKSIKNKPKNREEPELEIIDYFKTAKVLTNDKNSRGGRNNNGNKRKRFDPYSAAN- 733

Query: 724 LEGPKAAKKRKQINRGKNVSFKR 746
            EGP A KKRK + RGKNVSFKR
Sbjct: 734 -EGPAAPKKRKNVTRGKNVSFKR 755

>Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001W
           (REAL)
          Length = 745

 Score =  718 bits (1853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/727 (51%), Positives = 478/727 (65%), Gaps = 31/727 (4%)

Query: 26  QDVDFYRNLDKEISTSLNESSKEITNMXXXXXXXXXXXXXXXXXGKEGLEQYWKDFSNVM 85
           QDVDFYRNLD++ S  L   S ++T M                  +E +   WKDF N+M
Sbjct: 44  QDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSIDEHHDSLELKEEEISDLWKDFGNIM 103

Query: 86  DNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQSDSNPSKRVTKPQLQFSRPVDNSES 145
           DNL EKSD SLD + R+  SN++ ++ QYL D +  DS P+KRV KPQL+F  P+DNSES
Sbjct: 104 DNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFSGKDSQPTKRVEKPQLKFKTPIDNSES 163

Query: 146 KPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAHPYEVEIDKQEYNASVLQVAEPLKS 205
            PF+PLL +KP+++K  +DSL +I   E  P HY HPYE EID QEYN ++LQ+   + S
Sbjct: 164 HPFIPLLKEKPNALKPLSDSLRMIETEENSPGHYPHPYEYEIDHQEYNPNILQIKPEIPS 223

Query: 206 QPWN-SESTWVDTSEALQSMLDKLKECTEIAVDLEHHDYRSYYGIVCLMQISTRKEDFLV 264
           +PW+ SE  W+++   L+SML+ LK   EIAVDLEHHDYRSYYG+VCLMQ+STR+ D+LV
Sbjct: 224 KPWDASEPIWINSKATLKSMLEDLKNAHEIAVDLEHHDYRSYYGVVCLMQVSTRERDYLV 283

Query: 265 DTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQRDLGLYVVSLFDTYHASRALGFPR 324
           DTL LR++LHILNEVF +P+I+KV HGAFMDIIWLQRDLGLYVV LFDTYHAS+A+G PR
Sbjct: 284 DTLELREDLHILNEVFTNPSIVKVFHGAFMDIIWLQRDLGLYVVGLFDTYHASKAIGLPR 343

Query: 325 HSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAYARADTHFLLNIYDQIRNQLIRENK 384
           HSLAYLLE +ANFKTSKKYQLADWR+RPLSKPM AYARADTHFLLNIYDQ+RN+LI  NK
Sbjct: 344 HSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAYARADTHFLLNIYDQLRNKLIESNK 403

Query: 385 LAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEKEEPWRTLVYQYNVPSTKIELLKRI 444
           LA VL+ESRNVAKRRFEYS++RP  PS  V++P EKE PWR L+YQYN+   + EL+K +
Sbjct: 404 LAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPTEKENPWRVLMYQYNIAPEREELVKDL 463

Query: 445 WEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAGVISVSNVMTDHVRSNSKVIANLI 504
           +EWRD+IARRDDESPR+IMPNQL+ +LV YTPID  GV+S+SN +TDHVR N+K++ANLI
Sbjct: 464 YEWRDVIARRDDESPRFIMPNQLLAALVAYTPIDVIGVVSLSNGVTDHVRQNAKILANLI 523

Query: 505 KKSLEDMKSVPAGALTAFQNIDYKIGQKFAS---DKLTISQIQNMTALFKEIASNPSIIE 561
           K +L  MK     +          +  KF S   + +T+SQI+++   F   +SN    +
Sbjct: 524 KSALRSMKDTHKESAEI-------VSSKFKSASLEAITVSQIRDIMDRFSVFSSNSVTED 576

Query: 562 KDVSKKIDPILFSNIF-LSKNEIVLYDHDKRHVVTNEQLAGRAEEVEGFMNEANNTTLAI 620
           + +      ILF  I    + +IV  D    H V  E +  RA+      N A      I
Sbjct: 577 RSMDSTASSILFGKILPYEEGDIVYEDSGLPHKVKVEDMRDRAQR----FNSALVGLEDI 632

Query: 621 NIESSAEMHVEEPEAKEKNALFSPPISNVENASSSNTDGFEDMNDIIVLKDVKKRTNIKD 680
             E    ++VE+ E  +      PP               ED ++++VLK  KKR + K 
Sbjct: 633 KFEVEKPVNVEKSEMVKIETTPEPPTK------------IEDPDEVVVLK--KKRIHKKQ 678

Query: 681 HKKKQGMPNKEVIDYSKLDTILXXXXXXXXXXXXGDPFGEE-NGLEGPKAAKKRKQINRG 739
             K+  +  +E +DYSK+  +L               F    N  EGP+A KK++   RG
Sbjct: 679 VAKRSDVAAEEAVDYSKIPNVLSSKPGQNNKQQRKRRFDPSFNDSEGPRAPKKKRPTTRG 738

Query: 740 KNVSFKR 746
           KNVSFKR
Sbjct: 739 KNVSFKR 745

>KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {ON}
           Anc_6.25 YOR001W
          Length = 738

 Score =  714 bits (1843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/737 (51%), Positives = 486/737 (65%), Gaps = 40/737 (5%)

Query: 26  QDVDFYRNLDKEISTSLNESSKEITNMXXXXXXXXXXXXXXXXXGKEGLEQYWKDFSNVM 85
           QDV F+ NLD  +++S+ E   E+  M                   E + + W+DF+N+ 
Sbjct: 26  QDVQFFSNLDANVASSVKELGNEVLEMINDILFSIDENSKPFAESAEQVGESWRDFTNLT 85

Query: 86  DNLFEKSDRSLDIITRSKTSNDNK-SEFQYLSDSAQSDSNPSKRVTKPQLQFSRPVDNSE 144
           DNLFEKSDRS+DII +    N    SE QYL D   +DS+  KR+TKPQL FSRPVDNSE
Sbjct: 86  DNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLVGNDSSSGKRITKPQLHFSRPVDNSE 145

Query: 145 SKPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAHPYEVEIDKQEYNASVLQVAEPLK 204
           S+PF PLL +KP+++K   +SL ++P +E +PSHY +PY+ EI  QEYN  +L+   P+ 
Sbjct: 146 SQPFKPLLTEKPNALKPLKESLQMVPATENIPSHYPNPYDYEISNQEYNNDILETRAPIP 205

Query: 205 SQPWN-SESTWVDTSEALQSMLDKLKECTEIAVDLEHHDYRSYYGIVCLMQISTRKEDFL 263
           S PW+ SE  WVD++E LQS+L  LK+  E+A+DLEHHDYRSYYGIVCLMQISTR  D+L
Sbjct: 206 STPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDLEHHDYRSYYGIVCLMQISTRDTDYL 265

Query: 264 VDTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQRDLGLYVVSLFDTYHASRALGFP 323
           VDT+ALRDELHILN+VF DP + KV HGAFMDIIWLQRDLGLY+VSLFDT+HAS+ALGFP
Sbjct: 266 VDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIWLQRDLGLYIVSLFDTFHASKALGFP 325

Query: 324 RHSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAYARADTHFLLNIYDQIRNQLIREN 383
           +HSLAYLLE  ANFKTSKKYQLADWR+RPLSKPM  YARADTHFLLNI+DQ+RNQLI++N
Sbjct: 326 KHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMSVYARADTHFLLNIFDQMRNQLIKDN 385

Query: 384 KLAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEKEEPWRTLVYQYNVPSTKIELLKR 443
           KLA VL ESR VAKRRFEYS+FRPK+  P VFTPIEKE PWRTL++QYNV   K EL+K 
Sbjct: 386 KLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPIEKESPWRTLMFQYNVTPEKEELVKA 445

Query: 444 IWEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAGVISVSNVMTDHVRSNSKVIANL 503
           ++EWRD IARRDDESPRYIMPNQL+ISL  YTP DP  ++SV++ +TD VRSNSKV+ANL
Sbjct: 446 LYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTDPVSLVSVNSYVTDCVRSNSKVLANL 505

Query: 504 IKKSLEDMKSVPAGALTAFQNIDYKIGQKFASDKLTISQIQNMTALFKEIASNPSIIEKD 563
           IK  +E  K  P  + T   N +      F    LT+SQI+++   F ++  N    +  
Sbjct: 506 IKSFVESSKLGPQSSYTP--NTE-NTSTPFV---LTLSQIKDIGMRFTKLTEN---FQSS 556

Query: 564 VSKKIDPILFSNIF--LSKNEI-VLYDHDKRHVVTNEQLAGRAEEVEGFMNEANNTTLAI 620
             +KI P+  S+ F  LSK ++ V Y+  K   V+   L  R+++   +M    +    I
Sbjct: 557 SCQKISPLQRSSFFGDLSKGKVTVSYNDAKTTPVSQSVLESRSKQFNEYMKAFGDIEYKI 616

Query: 621 NIESSAEMHVEEP------EAKEKNALFSPPISNVENASSSNTDGFEDMNDIIVLKDVKK 674
                  M +  P      E+ +   +  PP  N++          EDM++I+VLK VK+
Sbjct: 617 PSIVEPVMDLPIPSGTTSTESADSKTVEKPP-KNIK----------EDMDEIVVLKKVKR 665

Query: 675 RTNIKDHKKKQGMPNKEVIDYSKLDTILXXXXXXXXXXXXG-----DPFGEENGLEGPKA 729
              +   K       +E++DYSK D +L                  DPF   +  EGPKA
Sbjct: 666 E--LPKPKGNDEDAEREIVDYSKEDKVLVQRQFDKKKKNNNNKKRFDPFSAIS--EGPKA 721

Query: 730 AKKRKQINRGKNVSFKR 746
            KKRK + +GKN SFKR
Sbjct: 722 PKKRKAVTKGKNASFKR 738

>ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 741

 Score =  704 bits (1817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/728 (51%), Positives = 491/728 (67%), Gaps = 19/728 (2%)

Query: 26  QDVDFYRNLDKEISTSLNESSKEITNMXXXXXXXXXXXXXXXXXGKEGLEQYWKDFSNVM 85
           QDVDFYR+LDK ++ SL+++S E+ +M                 GKE LE   KDFSN+M
Sbjct: 26  QDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCIDQNSRLLEGGKEKLEDSRKDFSNLM 85

Query: 86  DNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQSDSNPSKRVTKPQLQFSRPVDNSES 145
           DNLFEKSDRSLDI+ R +  +   +   YL D+A+SD  P+KR+ KPQ++F RP+DN+E+
Sbjct: 86  DNLFEKSDRSLDIL-RGRAPDRKGAALMYLDDAARSDMIPAKRILKPQVRFQRPIDNTET 144

Query: 146 KPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAHPYEVEIDKQEYNASVLQVAEPLKS 205
            PF PLL +KPH+++  +D + ++   E++P HY  PYE EI+ QEYN S+L++AEP+ S
Sbjct: 145 HPFKPLLENKPHALRPLSDCVRLVQADEDIPEHYPQPYEYEIENQEYNESILKIAEPIPS 204

Query: 206 QPWN-SESTWVDTSEALQSMLDKLKECTEIAVDLEHHDYRSYYGIVCLMQISTRKEDFLV 264
           +PW+ SE  WVD  E+L SML  LK+ TEIAVDLEHHDYRSYYGIVCLMQ+STR+ D+LV
Sbjct: 205 KPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLEHHDYRSYYGIVCLMQVSTRQTDYLV 264

Query: 265 DTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQRDLGLYVVSLFDTYHASRALGFPR 324
           DTLALRD+L +LNEVFA+P I+KV HGAFMDIIWLQRDLGLY+VSLFDTYHASRALGFPR
Sbjct: 265 DTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWLQRDLGLYIVSLFDTYHASRALGFPR 324

Query: 325 HSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAYARADTHFLLNIYDQIRNQLIRENK 384
           HSLAYLLE +A+FKTSKKYQLADWRVRPLSK M AYARADTHFLLNIYDQ+RN+LI ENK
Sbjct: 325 HSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSAYARADTHFLLNIYDQLRNKLIIENK 384

Query: 385 LAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEKEEPWRTLVYQYNVPSTKIELLKRI 444
           LA VL ESRNVAKR F+YS++RPKVP+ +V++P+++ + W+ L+ QYN+P  K  L+K +
Sbjct: 385 LAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVDRADGWKVLMNQYNIPLEKEILVKNL 444

Query: 445 WEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAGVISVSNVMTDHVRSNSKVIANLI 504
           +EWRD IARRDDESPRY+MPNQL+  LV+YTP+DP GVISVS  +TDHVR+N+K +ANLI
Sbjct: 445 YEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDPTGVISVSPTVTDHVRTNAKALANLI 504

Query: 505 KKSLEDMKSVPAGALTAFQNIDYKIGQKFASDKLTISQIQNMTALFKEIASNPSIIEKDV 564
            KSL+ +    AG+    +++ +K  Q   S  LT+ QI++  + F +++     + +  
Sbjct: 505 VKSLQQIAD--AGSDIKVESVQHK-DQHDLSQVLTVGQIESQVSQFHDLSKAFKGLSQGT 561

Query: 565 --SKKIDPILFSNIFLSKNEIVLYDHDKRHVVTNEQLAGRAEEVE---GFMNEANNTTLA 619
             S     I+F NI  +    V Y    +  VT++Q+  R  E+     F++    TT+ 
Sbjct: 562 NSSNSSSSIIFGNILHAPCGFVGYGRSLKKPVTDKQIEKRKLELSEALEFIDAETATTIQ 621

Query: 620 INIESSAEMHVEEPEAKEKNALFSPPISNVENASSSNTDGFEDMNDIIVLKDVKKRTNIK 679
                S   H  EP   +K +         +   +  T+  ED N+II LK VK R   K
Sbjct: 622 EEDRGSELTH--EPADDKKVS----ENDESKKEEAKETEPEEDKNEIITLKKVKDRG--K 673

Query: 680 DHKKKQGMPNKEVIDYSKLDTILXXXXXXXXXXXXG-DPFGEENGLEGPKAAKKRKQINR 738
             K+      +E IDY K   IL              DP+   N        KK++++ R
Sbjct: 674 KSKRSNESEPEEPIDYKKSKKILETEKKSKSTKKRAFDPYAASNDAGNAPKPKKKRRMAR 733

Query: 739 GKNVSFKR 746
           GK+ SFKR
Sbjct: 734 GKSASFKR 741

>Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001W
           (REAL)
          Length = 773

 Score =  694 bits (1792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/729 (50%), Positives = 485/729 (66%), Gaps = 29/729 (3%)

Query: 26  QDVDFYRNLDKEISTSLNESSKEITNMXXXXXXXXXXXXXXXXXGKEGLEQYWKDFSNVM 85
           QDVDFY+NLD+E    L   S ++ +M                   E +   W DF N+M
Sbjct: 66  QDVDFYKNLDREFGKVLKSKSDKLADMANEIILSIDEHHESFELKDEDISGLWNDFGNIM 125

Query: 86  DNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQSDSNPSKRVTKPQLQFSRPVDNSES 145
           DNL E SD SLD + R+ TS  N ++ QYL D ++ + +P+KRV KPQL+F  P+DNSES
Sbjct: 126 DNLLEMSDHSLDKLNRAVTSKPNGADLQYLGDFSEKNLSPAKRVEKPQLKFKTPIDNSES 185

Query: 146 KPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAHPYEVEIDKQEYNASVLQVAEPLKS 205
            PF+PLL +KP+++K  +DSL +I E +  PSHY HPYE EID QEY +++LQ+ + + S
Sbjct: 186 HPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYPHPYEYEIDHQEYGSNILQIRKEIPS 245

Query: 206 QPWN-SESTWVDTSEALQSMLDKLKECTEIAVDLEHHDYRSYYGIVCLMQISTRKEDFLV 264
           + WN SE  W+DT   L+SML++LK   EIAVDLEHHDYRSYYGIVCLMQISTR++D+LV
Sbjct: 246 KSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLEHHDYRSYYGIVCLMQISTREKDYLV 305

Query: 265 DTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQRDLGLYVVSLFDTYHASRALGFPR 324
           DTL LR+ LHILNEVF DP+I+KV HGAFMDIIWLQRDLGLYVV LFDTYHAS+A+G PR
Sbjct: 306 DTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWLQRDLGLYVVGLFDTYHASKAIGLPR 365

Query: 325 HSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAYARADTHFLLNIYDQIRNQLIRENK 384
           HSLAYLLE +ANFKTSKKYQLADWR+RPLSKPM AYARADTHFLLNIYDQ+RN+LI  NK
Sbjct: 366 HSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIAYARADTHFLLNIYDQLRNKLIESNK 425

Query: 385 LAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEKEEPWRTLVYQYNVPSTKIELLKRI 444
           LA VL+ESRNVAKRRFEYS++RP++PS  V++PIEKE PWR L+YQYN+ S K EL+K +
Sbjct: 426 LAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPIEKEAPWRVLMYQYNITSEKEELVKDL 485

Query: 445 WEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAGVISVSNVMTDHVRSNSKVIANLI 504
           ++WRD+IARRDDESPR++MPNQL+ +LV YTPID  GVIS++N +T+HVR N+KV+ NLI
Sbjct: 486 YQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDVIGVISLTNGITEHVRQNAKVLVNLI 545

Query: 505 KKSLEDMK-SVPAGALTAFQNIDYKIGQKFASDKLTISQIQNMTALFKEIASNPSIIEKD 563
           K SL  +K +    +   F      +  + + + +TI QI+++   F  + SN ++    
Sbjct: 546 KNSLRHIKDTYKEDSPVTFSE---SMTNEVSLEAITIPQIRDIMERF-SVLSNSNVSNCR 601

Query: 564 VSKKIDP-ILFSNIF-LSKNEIVLYDHDKRHVVTNEQLAGRAEEVEGFMNEANNTTLAIN 621
                 P IL   I  L +N+I   ++   + V  E +  RA+          N+ L+ N
Sbjct: 602 AKNGATPSILLGRILPLEENDIAYKNNGLPNRVKFEDIRARAQSF--------NSALS-N 652

Query: 622 IESSAEMHVEEPEAKEKNALFSPPISNVENASSSNTDGFEDMNDIIVLKDVK-KRTNIKD 680
           +E    + VE+P     N      I+  +    S T   E+ +DI+VLK     RT   +
Sbjct: 653 LEDCM-LEVEKPHILPTNVKKIERINTEDVPKHSAT--IENPDDIVVLKKKNIHRTQSMN 709

Query: 681 HKKKQGMPNKEVIDYSKLDTILXXXX---XXXXXXXXGDPFGEENGLEGPKAAKKRKQIN 737
            K   G   ++ IDYSK+  +L                DP    N  +GP+AAKK++   
Sbjct: 710 AKDTMG---EKAIDYSKIPNVLSSKSDQNRRQQKKRRSDPLF--NDSDGPRAAKKKRPAT 764

Query: 738 RGKNVSFKR 746
           RG+NVSFKR
Sbjct: 765 RGRNVSFKR 773

>NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {ON}
           Anc_6.25 YOR001W
          Length = 790

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/760 (49%), Positives = 500/760 (65%), Gaps = 53/760 (6%)

Query: 26  QDVDFYRNLDKEISTSLNESSKEITNMXXXXXXXXXXXXXXXXXGKEGLEQYWKDFSNVM 85
           QDVDFYR++DK  + +L E++ ++ +M                  KE LE  WKDFSN+M
Sbjct: 45  QDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSETLDGTKENLEDNWKDFSNLM 104

Query: 86  DNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQSDSNPSKR--VTKPQLQFSRPVDNS 143
           DNL EKSDRS+D++ RSK +N N S  QYL + +  D   SKR  + KPQL+F  PVDN+
Sbjct: 105 DNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEYSGRDDTSSKRRAIGKPQLEFDVPVDNT 164

Query: 144 ESKPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAHPYEVEIDKQEYNASVLQVAEPL 203
           E+ PF+PLL  KP+++KS  +S+ ++P  E +P HYA PYE EID Q YN  +LQ+++P+
Sbjct: 165 ETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPYEYEIDNQPYNDKILQLSDPI 224

Query: 204 KSQPW-NSESTWVDTSEALQSMLDKLKECTEIAVDLEHHDYRSYYGIVCLMQISTRKEDF 262
            SQPW  + + WVDT E+LQSM+  L  CTE AVDLEHHDYR+YYGIVCLMQISTR +D+
Sbjct: 225 PSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHDYRTYYGIVCLMQISTRTQDY 284

Query: 263 LVDTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQRDLGLYVVSLFDTYHASRALGF 322
           +VDTL LR  L  LNE F +P I KVLHGAFMDIIWLQRDLGLY+VSLFDT+HASRALGF
Sbjct: 285 IVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRDLGLYIVSLFDTFHASRALGF 344

Query: 323 PRHSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAYARADTHFLLNIYDQIRNQLIRE 382
           P++SLAYLLEK++NFKTSKKYQ+ADWR+RPLSK M++YAR+DTHFLLNI+DQ+RN+L+++
Sbjct: 345 PKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYARSDTHFLLNIFDQMRNKLVQD 404

Query: 383 NKLAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEKEEPWRTLVYQYNVPSTKIELLK 442
            KLA VL ESRNVAKRRFEY ++RP + S AV++PIEK +PW+TL+YQYN+P  K  LLK
Sbjct: 405 GKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKIDPWKTLMYQYNIPLAKELLLK 464

Query: 443 RIWEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAGVISVSNVMTDHVRSNSKVIAN 502
            +++WRD IARRDDESPRYIMPNQL++SLV Y P++PAGV+SVSN++TDHVRSNSK++AN
Sbjct: 465 ELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGVVSVSNMVTDHVRSNSKILAN 524

Query: 503 LIKKSLEDMKSVP-------------AGALTAFQNIDYKIGQKFASDKLTISQIQNMTAL 549
           LIK  L  +K                 G  T   N+D        S++L+I Q+  + + 
Sbjct: 525 LIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTNVDL-------SEQLSIHQLNTLKSQ 577

Query: 550 FKEIASNPSIIEKDV-----SKKIDPILFSNIFLSKNE-----IVLY--DHDKRHVVTNE 597
           F  + S  + IE        ++K +  L     +S N+      + Y    DK+  +T E
Sbjct: 578 FLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMSFNDEDGKNFIKYSVSPDKKDKITTE 637

Query: 598 QLAGRAEEVEGFMNEANNTTLAINIESSAEMHVEEPEAKEKNALFSPPISNVENASSSNT 657
           +L  R E  +  M +      +I I  + E+ V E E +E     S P +N E  ++  +
Sbjct: 638 ELLKREEMFDQAMEQLQQVEYSIPIPEN-EIVVVESEQQEP----SIPAANAEITTAVAS 692

Query: 658 DGFEDMNDIIVLKDVKKRTNIKDHKKKQGMPNK---EVIDYSKLDTILXXXXXXXXXXXX 714
              ED+++IIVLK   +    K  +K     ++   EVIDYSK++ +L            
Sbjct: 693 RKKEDLDEIIVLKKTNRNKGKKRERKHSDDDDEGEIEVIDYSKMEKVLDNSNTKRNQNKN 752

Query: 715 G--------DPFGEENGLEGPKAAKKRKQINRGKNVSFKR 746
                    DP+   N  EGP+A KKRK + RGKNVSFKR
Sbjct: 753 NNGNKRKRFDPYNVNN--EGPRAPKKRKAMTRGKNVSFKR 790

>TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  690 bits (1781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/731 (49%), Positives = 487/731 (66%), Gaps = 31/731 (4%)

Query: 26  QDVDFYRNLDKEISTSLNESSKEITNMXXXXXXXXXXXXXXXXXGKEGLEQYWKDFSNVM 85
           QDVDF+R+L + I  SL+E+S  + ++                 GKE L +YWKDFSN+M
Sbjct: 26  QDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSIDQNSEPLVEGKETLNEYWKDFSNMM 85

Query: 86  DNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQSDSNPSKRVTKPQLQFSRPVDNSES 145
           DNLFE SD S DI+TR+  S  +  + ++L +S+ +DS PSKR++KPQL F  PV+N+E 
Sbjct: 86  DNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSSNDSIPSKRISKPQLNFKNPVNNTEI 145

Query: 146 KPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAHPYEVEIDKQEYNASVLQVAEPLKS 205
           +PF+PLL +KP +++       I+P ++ +P HYA PYE EI+ QEY  SV+  +EP+ S
Sbjct: 146 QPFVPLLKEKPFALRPLISD--IVPGNDAVPEHYAQPYEYEIEHQEYGESVIVKSEPIPS 203

Query: 206 QPW-NSESTWVDTSEALQSMLDKLKECTEIAVDLEHHDYRSYYGIVCLMQISTRKEDFLV 264
           +PW  +E+ WVD  E L++M+  LK  TEIAVDLEHHDYRSYYGIVCLMQISTR+ D+L+
Sbjct: 204 KPWETTEALWVDNIEVLKTMISDLKSVTEIAVDLEHHDYRSYYGIVCLMQISTRERDYLI 263

Query: 265 DTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQRDLGLYVVSLFDTYHASRALGFPR 324
           DT+ALRD+L ILNEVFA+P ILKV HGAFMDIIWLQRDLGLYVVSLFDT+HASRA+G PR
Sbjct: 264 DTIALRDDLQILNEVFANPKILKVFHGAFMDIIWLQRDLGLYVVSLFDTFHASRAIGLPR 323

Query: 325 HSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAYARADTHFLLNIYDQIRNQLIRENK 384
           HSLAYLLEK+ANFKTSKKYQLADWR+RPLSK M+AYARADTHFLLNIYDQ+RN LI +NK
Sbjct: 324 HSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMNAYARADTHFLLNIYDQLRNTLIEQNK 383

Query: 385 LAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEKEEPWRTLVYQYNVPSTKIELLKRI 444
           LA VL ESRNVAKRRFEYS+FRP  PSP V+ PI+K +PW+ L++QY++   + EL+K++
Sbjct: 384 LAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCPIDKPDPWKVLMFQYSISPNREELVKKL 443

Query: 445 WEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAGVISVSNVMTDHVRSNSKVIANLI 504
           ++WRD IARRDDESPRY+MPNQL++ L    P +P  VISV++++TDHVRSNS V+A+LI
Sbjct: 444 YDWRDTIARRDDESPRYVMPNQLLVELARQAPTEPINVISVNSIVTDHVRSNSLVLAHLI 503

Query: 505 KKSLEDM-KSVPAGALTAFQNIDYKIGQKFASDKLTISQIQNMTALFKEIASNPSIIEKD 563
           K +L    K    G   A  N         A+  LT+ QIQ + A F  ++   +I++ +
Sbjct: 504 KNTLASSDKESDKGTFEADNN------STDAASLLTVPQIQKLAACFAGVSRAFTILQNE 557

Query: 564 VSKKIDPILFSNIFLSKNEIVLYDHDKRHVVTNEQLAGRAEEVEGFMNEANNTTLAINIE 623
                   +F++I  S+++ V Y  +    +T ++L  RA +    M + +  T      
Sbjct: 558 YKDGRSSSIFTDILTSEDDAVNYVGNNMDHITKKELGKRAAKALQSMEQFDEAT------ 611

Query: 624 SSAEMHVEEPE-AKEKNAL--FSPPISNVENASSSNTDGFEDMNDIIVLKDVKKRTNIKD 680
                ++  PE AKE N +    PP    E    S +   EDM++II LK  K +     
Sbjct: 612 ---SYYMPIPEIAKESNTMEEIRPPAP--EEVKESPSPPKEDMDEIITLK--KIKKQKSQ 664

Query: 681 HKKKQGMPNKEV--IDYSKLDTILXXXX--XXXXXXXXGDPFGEEN-GLEGPKAAKKRKQ 735
             K+ G+  +E+  +DY+K   +L               DP+   N   + P+A KKRK 
Sbjct: 665 SPKELGISEREIPAVDYTKTKKVLATNQDKNKDKKKRKFDPYAASNHSSDAPRAPKKRKP 724

Query: 736 INRGKNVSFKR 746
           +NR +NVSFKR
Sbjct: 725 VNRERNVSFKR 735

>YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nuclear
           exosome exonuclease component; has 3'-5' exonuclease
           activity; involved in RNA processing, maturation,
           surveillance, degradation, tethering, and export; has
           similarity to E. coli RNase D and to human PM-Sc1 100
           (EXOSC10); mutant displays reduced transcription
           elongation in the G-less-based run-on (GLRO) assay
          Length = 733

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/729 (48%), Positives = 481/729 (65%), Gaps = 29/729 (3%)

Query: 26  QDVDFYRNLDKEISTSLNESSKEITNMXXXXXXXXXXXXXXXXXGKEGLEQYWKDFSNVM 85
           QDVDFY+NLD+  S  L   + ++ +M                  +E +   W +F N+M
Sbjct: 26  QDVDFYKNLDRGFSKDLKSKADKLADMANEIILSIDEHHESFELKEEDISDLWNNFGNIM 85

Query: 86  DNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQSDSNPSKRVTKPQLQFSRPVDNSES 145
           DNL E SD SLD +  +  S    S+ QYL + +  + +P+KRV KPQL+F  P+DNSES
Sbjct: 86  DNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSGKNFSPTKRVEKPQLKFKSPIDNSES 145

Query: 146 KPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAHPYEVEIDKQEYNASVLQVAEPLKS 205
            PF+PLL +KP+++K  ++SL ++ + E  PSHY HPYE EID QEY+  +LQ+ E + S
Sbjct: 146 HPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYPHPYEYEIDHQEYSPEILQIREEIPS 205

Query: 206 QPWN-SESTWVDTSEALQSMLDKLKECTEIAVDLEHHDYRSYYGIVCLMQISTRKEDFLV 264
           + W+ S   WVDTS  L+SML+ LK   EIAVDLEHHDYRSYYGIVCLMQISTR+ D+LV
Sbjct: 206 KSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLEHHDYRSYYGIVCLMQISTRERDYLV 265

Query: 265 DTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQRDLGLYVVSLFDTYHASRALGFPR 324
           DTL LR+ LHILNEVF +P+I+KV HGAFMDIIWLQRDLGLYVV LFDTYHAS+A+G PR
Sbjct: 266 DTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWLQRDLGLYVVGLFDTYHASKAIGLPR 325

Query: 325 HSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAYARADTHFLLNIYDQIRNQLIRENK 384
           HSLAYLLE +ANFKTSKKYQLADWR+RPLSKPM AYARADTHFLLNIYDQ+RN+LI  NK
Sbjct: 326 HSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAYARADTHFLLNIYDQLRNKLIESNK 385

Query: 385 LAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEKEEPWRTLVYQYNVPSTKIELLKRI 444
           LA VL+ESRNVAKRRFEYS++RP  PS  V++PIEKE PW+ L+YQYN+P  +  L++ +
Sbjct: 386 LAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIEKESPWKILMYQYNIPPEREVLVREL 445

Query: 445 WEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAGVISVSNVMTDHVRSNSKVIANLI 504
           ++WRD+IARRDDESPR++MPNQL+ +LV YTP D  GV+S++N +T+HVR N+K++ANLI
Sbjct: 446 YQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDVIGVVSLTNGVTEHVRQNAKLLANLI 505

Query: 505 KKSLEDMKSVPAGALTAFQNIDYKIGQKFASDKLTISQIQNMTALFKEIASNPSIIEKDV 564
           + +L ++K+    A T   + + K       + +++ QI+++   F  + +  S I K  
Sbjct: 506 RDALRNIKNTNEEA-TPIPSSETK-ADGILLETISVPQIRDVMERFSVLCN--SNISKSR 561

Query: 565 SKKI--DPILFSNIFLSKNEIVLYDHDKR-HVVTNEQLAGRAEEVEGFMNEANNTTLAIN 621
           +K +    IL   I   +   + Y  D   + V  E +  RA+  +  +  AN   +   
Sbjct: 562 AKPVTNSSILLGKILPREEHDIAYSKDGLPNKVKTEDIRIRAQNFKSAL--ANLEDIIFE 619

Query: 622 IESSAEMHVEEPEAKEKNALFSPPISNVENASSSN-TDGFEDMNDIIVLKDVKKRTNIKD 680
           IE    + V+  E           I  V+ AS+ N +   ++++D++VLK  KK    K 
Sbjct: 620 IEKPLVVPVKLEE-----------IKTVDPASAPNHSPEIDNLDDLVVLK--KKNIQKKQ 666

Query: 681 HKKKQGMPNKEVIDYSKLDTILXXXXXXXXXXXXG---DPFGEENGLEGPKAAKKRKQIN 737
             K++G+  K+ +DYSK+  IL                DP   ++   GP+AAKKR+   
Sbjct: 667 PAKEKGVTEKDAVDYSKIPNILSNKPGQNNRQQKKRRFDPSSSDSN--GPRAAKKRRPAA 724

Query: 738 RGKNVSFKR 746
           +GKN+SFKR
Sbjct: 725 KGKNLSFKR 733

>TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6.25
           YOR001W
          Length = 771

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/760 (46%), Positives = 493/760 (64%), Gaps = 28/760 (3%)

Query: 1   MSEDINKEXXXXXXXXXXXXXXXXXQDVDFYRNLDKEISTSLNESSKEITNMXXXXXXXX 60
           MSED  +E                 QDVDFY++LDK++S SLN+++ +  ++        
Sbjct: 26  MSEDNCEELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSI 85

Query: 61  XXXXXXXXXGKEGLEQYWKDFSNVMDNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQ 120
                    GK+ +  +W  FSN+MDNL EKSD  +D +++    N   +E  +L ++++
Sbjct: 86  DENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETTFLDNNSR 145

Query: 121 SDSNPSKRVTKPQLQFSRPVDNSESKPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYA 180
           ++SNPSKR+ KPQL FS+PVDN++S+PF PLL +KP+++K   DSL+++PES  +P+HY 
Sbjct: 146 TNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYL 205

Query: 181 HPYEVEIDKQEYNASVLQVAEPLKSQPWNSEST-WVDTSEALQSMLDKLKECTEIAVDLE 239
            PYE EID QEYN  V+++ +P   +PW + S  W+DT E+L  +L  L++ +EIAVDLE
Sbjct: 206 QPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLE 265

Query: 240 HHDYRSYYGIVCLMQISTRKEDFLVDTLALRDELHILNEVFADPNILKVLHGAFMDIIWL 299
           HHD RSYYGI CLMQISTR++D++VDT++LRD+L +LNE+F +PNI KV HGA MDIIWL
Sbjct: 266 HHDLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWL 325

Query: 300 QRDLGLYVVSLFDTYHASRALGFPRHSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHA 359
           QRDLGLY+VSLFDT+HAS+ALG  RHSLAYLLE YA+FKTSKKYQLADWR RPL+  M A
Sbjct: 326 QRDLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLA 385

Query: 360 YARADTHFLLNIYDQIRNQLIRENKLAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIE 419
           YAR+DTHFLLNI+DQ+RN LI++NKLA VL ESRNVAKRRFEY +FRP VP P ++T IE
Sbjct: 386 YARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLIE 445

Query: 420 KEEPWRTLVYQYNVPSTKIELLKRIWEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDP 479
           KE PW++L+ QYN+   K  L++++WEWRDMIARRDDESPRYIMP Q++ISL+ YTP D 
Sbjct: 446 KEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDS 505

Query: 480 AGVISVSNVMTDHVRSNSKVIANLIKKSLEDMKSVPAGALTAFQNIDYKIGQKFASDKLT 539
           +GVISVSN++T+HVRSNS  +ANLIKK+LE  KS+P  + ++      +     AS  ++
Sbjct: 506 SGVISVSNMVTEHVRSNSTTLANLIKKALESTKSIPNSSDSSSTFNMSRTDTNVAS-LIS 564

Query: 540 ISQIQNMTALFKEIASNPSIIEKDVSK-KIDPILFSNIFLSKNEIVLYDHDKRHVVTNEQ 598
           I++I N+   F  ++ + +  +   S  ++  +LFSNI  S  +I  Y  DK     +E 
Sbjct: 565 ITEINNICLKFNSLSKHYNTSKFLTSGIEVSSLLFSNIMTSSPKISDYSKDKTTSFKSED 624

Query: 599 LAGR----AEEVEGFMNEANNTTL---AINIESSAEMHVEEPEAKEKNALFSPPISNVEN 651
           +  R    +E ++G    ANN+ +    +    S E+  E P          P +     
Sbjct: 625 MIARHIRLSEGLKGL--SANNSFIYQPPVEDIKSIEITTENP---------IPTLEPKST 673

Query: 652 ASSSNTDGFEDMNDIIVLKDVKKRTNIKDHKKKQGMPNKEVIDYSKLDTILXXXXXX--- 708
              +  +  ED  +IIVLK V ++   +  KK     +  V+DYSK   I          
Sbjct: 674 QKKTTKEINEDNEEIIVLKKVNRK--YQKGKKDADKDSTVVVDYSKAKKIFQKKDETING 731

Query: 709 -XXXXXXGDPFGEENGLEG-PKAAKKRKQINRGKNVSFKR 746
                   DP+  +   +  P+A KKR+   RGKN+S+KR
Sbjct: 732 NSKKRKSFDPYNNDGDTDKVPRALKKRQTNTRGKNISYKR 771

>CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001w RRP6
          Length = 737

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/738 (48%), Positives = 484/738 (65%), Gaps = 43/738 (5%)

Query: 26  QDVDFYRNLDKEISTSLNESSKEITNMXXXXXXXXXXXXXXXXXGKEGLEQYWKDFSNVM 85
           QDV+F++++D  ++ SL +S K + ++                   E LE+  K+FSNVM
Sbjct: 26  QDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEKLDGTNENLEEVCKEFSNVM 85

Query: 86  DNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQSDSNPSKRVTKPQLQFSRPVDNSES 145
           D LFEK+DRSLDI+ R  ++NDNK   Q+L D   ++++PS+R++KPQL F  PVDNSES
Sbjct: 86  DVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPSRRISKPQLNFKTPVDNSES 145

Query: 146 KPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAHPYEVEIDKQEYNASVLQVAEPLKS 205
            PF PLL +KP+++KS  +S  ++  +E++P H+  PYE EI  QEYN  +L+  EP+ S
Sbjct: 146 HPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYEYEILNQEYNNDILEKKEPIPS 205

Query: 206 QPW-NSESTWVDTSEALQSMLDKLKECTEIAVDLEHHDYRSYYGIVCLMQISTRKEDFLV 264
             W ++ + WVD   +LQ M+ +LK+ +EIAVDLEHHD+RSYYG+VCLMQISTR +D++V
Sbjct: 206 TSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEHHDFRSYYGLVCLMQISTRTQDYIV 265

Query: 265 DTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQRDLGLYVVSLFDTYHASRALGFPR 324
           DT+ALRD+L +LNEVF +P I KV HGAFMDIIWLQRDLGLY+VSLFDT+HAS+ALG P+
Sbjct: 266 DTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWLQRDLGLYIVSLFDTFHASKALGLPK 325

Query: 325 HSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAYARADTHFLLNIYDQIRNQLIRENK 384
           HSLAYLLEKYANFKTSKKYQLADWR RPLSK M AYARADTHFLLNI+DQ+RN LI   K
Sbjct: 326 HSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMAYARADTHFLLNIFDQMRNGLISSGK 385

Query: 385 LAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEKEEPWRTLVYQYNVPSTKIELLKRI 444
           LA VL ESRNVA RRFEYS+++PK+P   +FTP+EKE PWRTL+YQYN+P  K  L++ +
Sbjct: 386 LAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVEKESPWRTLMYQYNIPVDKEPLIREL 445

Query: 445 WEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAGVISVSNVMTDHVRSNSKVIANLI 504
           +EWRDM+ARRDDESPRY+MPNQL++SLV Y P+DP  V+SVS+V+TDHVR NSK +ANLI
Sbjct: 446 YEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDPISVVSVSSVVTDHVRRNSKTLANLI 505

Query: 505 KKSLEDMKSVPAGALTAFQNIDYKIGQKF--ASDKLTI---SQIQNMTALFKEIASNPSI 559
           KK LE++K      L   ++I+ ++      + D+L      +I+ MT  FKEI +  + 
Sbjct: 506 KKKLEEIK------LGEVKSINNRLPSSLDVSQDELQFLPSHKIELMTGAFKEIENQLTQ 559

Query: 560 IEKDVSKKIDPILFSNIFLSKNEIVLYDHDKRHVVTNEQLAGRAEEVEGFMNEANNTTLA 619
             K        ++ S I L     V Y +     V   +L  R      +++    T LA
Sbjct: 560 ATKSKQAMTSSVVLSEILLHPEHAVKYHNGSACSVEESELKDR------YLSYIKATLLA 613

Query: 620 ----INI-----ESSAEMHVEEPEAKEKNALFSPPISNVENASSSNTDGFEDMNDIIVLK 670
               IN+      S+A +  EE   K+ + +   P            +  EDM++I+VLK
Sbjct: 614 ASKNINMVLETSNSNAPLETEETHNKKSDQIQVIP------------EKQEDMDEIVVLK 661

Query: 671 DVKKRTNIKDHKKKQGMPNKEVIDYSKLDTILXXXXXXXXXXXXG--DPFGEENGLEGPK 728
             K  +N +  K   G   +E +DYSK + +                DP+      EGPK
Sbjct: 662 KKKIHSNDQKAKHDDGDIVEEPVDYSKANILASDNREVKKKDKKRVFDPYSSTG--EGPK 719

Query: 729 AAKKRKQINRGKNVSFKR 746
           AAKKR+ + +GK +SFK+
Sbjct: 720 AAKKRRLVTKGKKISFKK 737

>Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001W
           (REAL)
          Length = 734

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/729 (49%), Positives = 474/729 (65%), Gaps = 28/729 (3%)

Query: 26  QDVDFYRNLDKEISTSLNESSKEITNMXXXXXXXXXXXXXXXXXGKEGLEQYWKDFSNVM 85
           QDVDFY+NL++E S  L   S ++T+M                  ++ +   WKDF N+M
Sbjct: 26  QDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSIDEHHESFELKEDEISGLWKDFGNIM 85

Query: 86  DNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQSDSNPSKRVTKPQLQFSRPVDNSES 145
           DNL E SD SLD +  +  S  + +E QYL D +  DS  +KR+ KPQL+F + +DNSES
Sbjct: 86  DNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSGKDSLSTKRLEKPQLKFKKSIDNSES 145

Query: 146 KPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAHPYEVEIDKQEYNASVLQVAEPLKS 205
            PF+PLL +KP+++K  ++SL +    E  PSHY HPY  EID QEY++ VLQ+ + + S
Sbjct: 146 HPFIPLLKEKPNALKPLSESLRLAEAEENNPSHYLHPYAYEIDHQEYSSDVLQIKKEIPS 205

Query: 206 QPWN-SESTWVDTSEALQSMLDKLKECTEIAVDLEHHDYRSYYGIVCLMQISTRKEDFLV 264
           + W+ SE  W+DT   L  ML+ LK  +EIAVDLEHHDYRSYYGIVCLMQ+STR+ D+LV
Sbjct: 206 KSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLEHHDYRSYYGIVCLMQVSTRERDYLV 265

Query: 265 DTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQRDLGLYVVSLFDTYHASRALGFPR 324
           DT+ LRD LHILNEVF DP I+KV HGAFMDIIWLQRDLGLYVV LFDTYHAS+A+G PR
Sbjct: 266 DTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWLQRDLGLYVVGLFDTYHASKAIGLPR 325

Query: 325 HSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAYARADTHFLLNIYDQIRNQLIRENK 384
           HSLAYLLE +ANFKTSKKYQLADWR RPLSKPM AYARADTHFLLNIYDQ+RN+LI  NK
Sbjct: 326 HSLAYLLENFANFKTSKKYQLADWRARPLSKPMTAYARADTHFLLNIYDQLRNKLIESNK 385

Query: 385 LAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEKEEPWRTLVYQYNVPSTKIELLKRI 444
           LA VL+ESRNVAKRRFEYS+ RP+ PS  V++PIEKE PWR L+YQYN+ S K EL+K +
Sbjct: 386 LAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIEKENPWRVLMYQYNITSEKEELVKDL 445

Query: 445 WEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAGVISVSNVMTDHVRSNSKVIANLI 504
           + WRD IARRDDESPR++MPNQL+ +LV Y PID  GV+S++N +T+HVR N+KV+ANLI
Sbjct: 446 YLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDVIGVVSLTNGVTEHVRQNAKVLANLI 505

Query: 505 KKSLEDMKSVPAGALTAFQNIDYKIGQKFASDKLTISQIQNMTALFKEIASNPSIIEKDV 564
           + +L ++K       +   +     G   + + +TISQI+++   F  + SN  +I  + 
Sbjct: 506 ENALGNIKDTNKKTTSITSSESKPDG--ISLEVITISQIRDIMERF-SLLSNSGVI-NNR 561

Query: 565 SKKIDPILFSNIFLSKN---EIVLYDHDKRHV---VTNEQLAGRAEEVEGFMNEANNTTL 618
           +K  D    S+I L K    E     + K+     V  E +  RA++    +    N   
Sbjct: 562 TKTGDST--SSILLGKTLPFEECGISYGKKGTPNKVKVEDIKARAQKFNSALAGLENIMF 619

Query: 619 AINIESSAEMHVEEPEAKEKNALFSPPISNVENASSSNTDGFEDMNDIIVLKDVKKRTNI 678
            +    +    VE+ EA E           +E+A    +   E  +DIIVLK  KK+ + 
Sbjct: 620 ELEKPVTVPASVEKGEAVE-----------IESAPELPSKA-ESFDDIIVLK--KKKMHK 665

Query: 679 KDHKKKQGMPNKEVIDYSKLDTILXXXXXXXXXXXXGDPFG-EENGLEGPKAAKKRKQIN 737
           K   K + M  KE +DYSK+ ++L               F    N  EGP+AAKK++   
Sbjct: 666 KQPAKGKDMTVKEAVDYSKMPSVLSSKPGQNRKQQRKRRFDPSSNDSEGPRAAKKKRPAP 725

Query: 738 RGKNVSFKR 746
           RGKN+SFKR
Sbjct: 726 RGKNMSFKR 734

>KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 744

 Score =  666 bits (1718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/737 (48%), Positives = 484/737 (65%), Gaps = 34/737 (4%)

Query: 26  QDVDFYRNLDKEISTSLNESSKEITNMXXXXXXXXXXXXXXXXXGKEGLEQYWKDFSNVM 85
           QD+DFY++LD  I+ SL ++S  I ++                 GK+     WK  SN+M
Sbjct: 26  QDIDFYKSLDSNINASLEDTSTNILSLINDLLLSIDPNNDVIQQGKDSFVDSWKSISNIM 85

Query: 86  DNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQSDSNPSKRVTKPQLQFSRPVDNSES 145
           DNLFEKSD +LD I      N      +YL+D  +S++ PSKR+ KPQL F  PVDN+E 
Sbjct: 86  DNLFEKSDHALDNIRAGNGGNAGGPSLKYLNDDDRSNNKPSKRIEKPQLSFKTPVDNTEL 145

Query: 146 KPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAHPYEVEIDKQEYNASVLQVAEPLKS 205
            PF PLL  KPHS++ F  SL ++PE E +PSHY HPYE EID Q+YN S+L   EP+ S
Sbjct: 146 HPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYPHPYEYEIDHQKYNDSILVATEPIPS 205

Query: 206 QPWN-SESTWVDTSEALQSMLDKLKECTEIAVDLEHHDYRSYYGIVCLMQISTRKEDFLV 264
           + W+ +E+ WVDT E L  M D+L + TE+A+DLEHHDYRSYYGIVCLMQIS R+ D++V
Sbjct: 206 KDWDETEAIWVDTVEGLNKMKDELSKATELAIDLEHHDYRSYYGIVCLMQISDREHDWIV 265

Query: 265 DTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQRDLGLYVVSLFDTYHASRALGFPR 324
           DT+ALR+EL+ILN++F DPN+ KVLHGAFMDIIWLQRDLGLY+V LFDTYHASR LGFP+
Sbjct: 266 DTIALREELYILNDIFTDPNVTKVLHGAFMDIIWLQRDLGLYIVGLFDTYHASRMLGFPK 325

Query: 325 HSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAYARADTHFLLNIYDQIRNQLIRENK 384
           HSLAYLLE++ANFKTSKKYQLADWR+RPL+KPM AYARADTHFLLNI+D++RN L+ +NK
Sbjct: 326 HSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLAYARADTHFLLNIFDKLRNSLLEQNK 385

Query: 385 LAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEKEEPWRTLVYQYNVPSTKIELLKRI 444
           +++VL ESR VAKRRFEYS FRPKVPS AVF+PIEK+EPW+ +++QYN+P++K  LL+R+
Sbjct: 386 MSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIEKDEPWKNIMFQYNIPASKELLLRRL 445

Query: 445 WEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAGVISVSNVMTDHVRSNSKVIANLI 504
           +EWRD IARRDDESPRY+MPNQL++SLV   P +P  V+SVS+ +++H+R+NSKVIANLI
Sbjct: 446 YEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEPINVLSVSSYVSEHLRTNSKVIANLI 505

Query: 505 KKSLEDMKSVPAGALTAFQNIDYKIGQKFASDKLTISQIQNMTALFKEIAS--NPSIIEK 562
           K++LED+K     +           G   A + +T SQI+++  +F  +AS  N   +  
Sbjct: 506 KRTLEDLKGNSNSSAIPLLESAESNGTDLA-NIITTSQIKSIQNIFHSLASEINSQKLNN 564

Query: 563 DVSKKIDPILFSNIF-LSKNEIVLYDHDKRHVVTNEQLAGRAEEVEGFM------NEANN 615
           + + +   +LF+ I  L  N  V Y    R ++   +L  R  E+   +       +A +
Sbjct: 565 EQNSE-KSVLFNGISNLDVNTAVRYTPKTRTLIPQHELLKRQHEITRTLEQEYTDRQAQS 623

Query: 616 TTLAINIESSAEMHVEEPEAKEKNALFSPPISNVENASSSNTDGFEDMNDIIVLKDVKKR 675
             L  N E  A   V   E + +     P    +E          E+ +++I L   +KR
Sbjct: 624 IVLPSN-EDEAPTQVSNDENRNEVITSDPSQEEIE----------ENKDEVITL---RKR 669

Query: 676 TNIKDHKKKQGMP--NKEVIDYSKLDTILXXXXXXXXXXXXG----DPFGEENGLEGPKA 729
            +  ++K+K   P  + E++DY+    +L                 DP+  E+   GP+ 
Sbjct: 670 QSQSNNKRKTISPPASHEIMDYAAGSDLLNSTKNNTNSQKHKKRRFDPYSVEHV--GPQP 727

Query: 730 AKKRKQINRGKNVSFKR 746
            KK+ +  +GKNVSFKR
Sbjct: 728 IKKKSKPAKGKNVSFKR 744

>ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR001W
           (RRP6)
          Length = 745

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/731 (47%), Positives = 474/731 (64%), Gaps = 22/731 (3%)

Query: 26  QDVDFYRNLDKEISTSLNESSKEITNMXXXXXXXXXXXXXXXXXGKEGLEQYWKDFSNVM 85
           QD+DFYR+L   +   L+++S  + ++                 G++  E  WK+ SNVM
Sbjct: 26  QDIDFYRSLHPSVGQELDDTSATVVSLINELLLSVDENNNELKPGRDNFEDSWKELSNVM 85

Query: 86  DNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQSDSNPSKRVTKPQLQFSRPVDNSES 145
           DN+FEKSD + D I    +S +     QYL+DS+  DS PSKR+ KPQL F  PVDN+E 
Sbjct: 86  DNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSHDDSTPSKRIEKPQLLFKTPVDNTEL 145

Query: 146 KPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAHPYEVEIDKQEYNASVLQVAEPLKS 205
            PF PLL +KPH++K   +SL++ PE E +P+HY HPYE EIDKQ YN SVL+V E +  
Sbjct: 146 HPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYPHPYEYEIDKQPYNDSVLEVRERIDP 205

Query: 206 QPWN-SESTWVDTSEALQSMLDKLKECTEIAVDLEHHDYRSYYGIVCLMQISTRKEDFLV 264
           QPW  +E  WVD  E+L  MLD+LKE  E+AVDLEHHDYRSYYGIVCLMQIS+R +D+LV
Sbjct: 206 QPWEATEPIWVDNVESLSQMLDELKEVKELAVDLEHHDYRSYYGIVCLMQISSRSKDWLV 265

Query: 265 DTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQRDLGLYVVSLFDTYHASRALGFPR 324
           DT+ALRD+LH+LN +  DP ++KV HGAFMD+IWLQRDLGLYVVSLFDTYHASRALGFP+
Sbjct: 266 DTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWLQRDLGLYVVSLFDTYHASRALGFPK 325

Query: 325 HSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAYARADTHFLLNIYDQIRNQLIRENK 384
           HSLAYLLE +A FKTSKKYQLADWRVRPL KP+  YAR+DTHFLL+IYD +RN L++  K
Sbjct: 326 HSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRDYARSDTHFLLSIYDDLRNALVKAGK 385

Query: 385 LAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEKEEPWRTLVYQYNVPSTKIELLKRI 444
           LAEVL  SRNVAKRRFEY+ FRP++P   V++PIE  EPWR L+YQYN+P +K  LLK++
Sbjct: 386 LAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIESTEPWRKLMYQYNLPPSKEPLLKKL 445

Query: 445 WEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAGVISVSNVMTDHVRSNSKVIANLI 504
           +EWRD +ARRDDES RY+MPNQL++SLV  +P + AGV+SVS  +TD+VRSN++ +ANLI
Sbjct: 446 YEWRDTVARRDDESVRYVMPNQLLVSLVSLSPSETAGVLSVSTYVTDYVRSNARTLANLI 505

Query: 505 KKSLEDMKSVPAGALTAFQNIDYKIGQKFASDKLTISQIQNMTALFKEIASNPSIIEKDV 564
           K++LE +K+  A ++  F + +  +    A+  L++  IQN+   F+ +          +
Sbjct: 506 KRTLETIKAGTA-SVAEFSSSERALSNPAAT--LSLHMIQNLDDHFRSLLMEAQKQSGSI 562

Query: 565 -SKKIDPILFSNIFLSKNEIVLYDHDKRHVVTNEQLAGRAEE-VEGFMNEANNTTLAINI 622
            S+    +LF++   +    V Y + ++HV+ +  L  R    ++ F ++       I  
Sbjct: 563 CSQHSSSLLFNSDLATGPSAVEYTNGQKHVIGDNVLQTRKHALLQKFTSQPVEPVTDIEA 622

Query: 623 ESSAEMHVEEPEAKEKNALFSPPISNVENASSSNTDGFEDMNDIIVLKDVKKRTNIKDHK 682
            S  +   E P+  E  +   P  S  +N    +   FE  ++I+VL+  KK+ + +  K
Sbjct: 623 PSH-QSSSENPQVSEDISPSEPQES--QNEVQKDEPDFEK-SEIVVLRK-KKKAHAQKPK 677

Query: 683 KKQGMPNKEVIDYSKLDTILXXXXXXXXXXXXG--------DPFGEENGLEGPKAAKKRK 734
                P  E +DYS    +L                     DP+G++N    P   KK+ 
Sbjct: 678 GTSSSPT-ETVDYSNAKEVLGKGTSSTAKRGDKDRPRKRKFDPYGQDNN--APSGVKKKN 734

Query: 735 QINRGKNVSFK 745
           + ++GK++SFK
Sbjct: 735 KPSKGKSISFK 745

>Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to
           Ashbya gossypii ACL001C
          Length = 747

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/743 (47%), Positives = 488/743 (65%), Gaps = 43/743 (5%)

Query: 26  QDVDFYRNLDKEISTSLNESSKEITNMXXXXXXXXXXXXXXXXXGKEGLEQYWKDFSNVM 85
           QD+DF R+LD  +   L+E+S+ I ++                 GK+ LE  WKD SN++
Sbjct: 26  QDIDFCRHLDASVGELLDETSQYIVSLLNEVILSTSKANNDLEVGKDNLEAAWKDLSNII 85

Query: 86  DNLFEKSDRSLDIITRSKTSNDNKSE--FQYLSDSAQSDSNPSKRVTKPQLQFSRPVDNS 143
           DNLFEKSD SLD++ +  +S+ ++ +   QYL+  +Q D   S+R+ KPQLQF  PVDNS
Sbjct: 86  DNLFEKSDHSLDVLQKLLSSSSSQLDTNMQYLNVDSQRDGKLSQRIVKPQLQFKIPVDNS 145

Query: 144 ESKPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAHPYEVEIDKQEYNASVLQVAEPL 203
           E  PF PLL  KPH++K   +   +  E+E +P+HY HPYE EID Q Y+ SVL + EP+
Sbjct: 146 ECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAHYPHPYEYEIDNQPYDDSVLTIKEPI 205

Query: 204 KSQPWN-SESTWVDTSEALQSMLDKLKECTEIAVDLEHHDYRSYYGIVCLMQISTRKEDF 262
           +   W+ +E  WVD   AL  ML+ LK   EIAVDLEHHDYRSYYG+VCLMQISTR+ D+
Sbjct: 206 EPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVDLEHHDYRSYYGLVCLMQISTRESDW 265

Query: 263 LVDTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQRDLGLYVVSLFDTYHASRALGF 322
           LVDT+ALR +L +LNE+F DP+ILKV HGAFMDIIWLQRDLGLYVVSLFDTYHASRALGF
Sbjct: 266 LVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDIIWLQRDLGLYVVSLFDTYHASRALGF 325

Query: 323 PRHSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAYARADTHFLLNIYDQIRNQLIRE 382
           P+HSLAYLLE +ANFKTSKKYQLADWR+RPLSKPM  YARADTHFLLNIYD++RN LI+E
Sbjct: 326 PKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPMKTYARADTHFLLNIYDKLRNSLIKE 385

Query: 383 NKLAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEKEEPWRTLVYQYNVPSTKIELLK 442
           +KL+ VL  SRNVAKRRFEY+ FRPKV SP VF+PIEK++PWRTL+ QYNVP  K  L++
Sbjct: 386 DKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSPIEKDDPWRTLMSQYNVPDIKEPLMR 445

Query: 443 RIWEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAGVISVSNVMTDHVRSNSKVIAN 502
           ++++WRDM+AR+DDES RY+MPNQL++SLV   P DP+G+++V + + DHVR+N++V+ N
Sbjct: 446 KLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPSDPSGLLTVKSYIPDHVRANARVLCN 505

Query: 503 LIKKSLEDMKSVPAGALTAFQNIDYKIGQKFASDK---LTISQIQNMTALFKEI------ 553
           +I K++E++KS   G+    Q+I+  +   + S +   +++S I+ M   FK +      
Sbjct: 506 IINKTMEEIKS---GSHEG-QSIE-NVTTTYVSAQDPEMSVSLIKTMDRHFKFLLDEVQS 560

Query: 554 -ASNPSIIEKDVSKKIDPILFSNIFLSKNEIVLYDHDKRHVVTNEQLAGRAEEV-EGFMN 611
            A  PS + +      D +LF      K + V Y+   + +V + +L  R  ++ + F  
Sbjct: 561 HAVEPSSVCE------DSLLFKGFLFDKPKAVAYNSVGKRLVNDRELLDRKSDLSQKFSK 614

Query: 612 EANNTTLAINIESSAEMHVEEPEAKEKNALFSPPISNVENA----SSSNTDGF-EDMNDI 666
                 +AI        H+E+  +  +  L +   SNVE+     S +N+D   ED ++I
Sbjct: 615 VFKAAGIAIG------SHIEKLSSNSE--LPADTTSNVESPSKEESKNNSDDLKEDKHEI 666

Query: 667 IVLKDVKKRTNIKDHKKKQGMPNKEVIDYSKLDTILXXXXXXXX--XXXXGDPFGEENGL 724
           IVLK  +KR    + K     P KE +DY+ +++IL               D     + L
Sbjct: 667 IVLK--RKRDYGSNTKSTSKQPKKEHVDYNNVNSILDNTSQQDKPNSGRHVDKRKFHSDL 724

Query: 725 EGP-KAAKKRKQINRGKNVSFKR 746
           +G   AA  +K  ++GK VS+K+
Sbjct: 725 QGSIGAAAIKKPRSKGKTVSYKK 747

>KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {ON}
           similar to uniprot|Q12149 Saccharomyces cerevisiae
           YOR001W RRP6 Exonuclease component of the nuclear
           exosome contributes to the quality-control system that
           retains and degrades aberrant mRNAs in the nucleus
          Length = 735

 Score =  624 bits (1608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/725 (46%), Positives = 461/725 (63%), Gaps = 24/725 (3%)

Query: 26  QDVDFYRNLDKEISTSLNESSKEITNMXXXXXXXXXXXXXXXXXGKEGLEQYWKDFSNVM 85
           QDV FY+NLD  I+TS+N  S  +  +                 G EGLE  W +   VM
Sbjct: 29  QDVSFYKNLDPSIATSVNNISARLLGLINDILLSVDENNDIIEQGSEGLESAWSNVGEVM 88

Query: 86  DNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQSDSNPSKRVTKPQLQFSRPVDNSES 145
           D LFEKS+ +L    +      +K+  QYL DS        K++ KPQL F RP+DNSES
Sbjct: 89  DLLFEKSEHALAAGEKRDNGELSKT-VQYLDDSPSLHDGAPKKILKPQLLFKRPIDNSES 147

Query: 146 KPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAHPYEVEIDKQEYNASVLQVAEPLKS 205
            PF PLL  KPH+++S  +SL +  E E++P+HY  PYE EID QEYN SVLQ++EP+ S
Sbjct: 148 HPFKPLLKKKPHALRSLDESLRLTAEQEDVPAHYPQPYEYEIDHQEYNESVLQISEPVPS 207

Query: 206 QPWN-SESTWVDTSEALQSMLDKLKECTEIAVDLEHHDYRSYYGIVCLMQISTRKEDFLV 264
            PW+ +E+ WVD ++AL+ ML++L    EIA+DLEHHDYR+YYGI CLMQISTR++D+L+
Sbjct: 208 LPWDETEAEWVDNTDALKLMLNELLLANEIAIDLEHHDYRTYYGITCLMQISTREKDWLI 267

Query: 265 DTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQRDLGLYVVSLFDTYHASRALGFPR 324
           DT+ALRD+L ILNEVF DP I KVLHGAFMDIIWLQRDLGLY+VSLFDTYHASR LG P+
Sbjct: 268 DTIALRDDLWILNEVFTDPKITKVLHGAFMDIIWLQRDLGLYIVSLFDTYHASRLLGSPK 327

Query: 325 HSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAYARADTHFLLNIYDQIRNQLIRENK 384
           HSLAYLLE+YA+FKTSKKYQL+DWRVRPL K + AYARADTHFLLNIYD +RN LI +NK
Sbjct: 328 HSLAYLLERYAHFKTSKKYQLSDWRVRPLPKALKAYARADTHFLLNIYDNMRNSLIEQNK 387

Query: 385 LAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEKEEPWRTLVYQYNVPSTKIELLKRI 444
           L++VL +SRNVAKRRFE++ FRPK+ +  VF+PIE+E+PWRTL++QYN+P +K  L++R+
Sbjct: 388 LSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSPIEREDPWRTLMFQYNIPQSKSLLVRRL 447

Query: 445 WEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAGVISVSNVMTDHVRSNSKVIANLI 504
           +EWRDM+ARRDDESPRY++PNQL++SL    P  PA +++ S  +T+H+R N+K +A LI
Sbjct: 448 YEWRDMVARRDDESPRYVIPNQLLVSLAVNAPTTPALIMATSTFVTEHIRQNAKSLALLI 507

Query: 505 KKSLEDMKSVPAGALTAFQNIDYKIGQKFASDKLTISQIQNMTALFKEIASNPSIIEK-- 562
           KKSLE   +     L +   +     Q  +  K++   I+  + +F++   + S  EK  
Sbjct: 508 KKSLESSSNEFGQLLNSANTV-----QNSSPTKMSSEDIEKNSRMFEKFLEDFS-YEKAA 561

Query: 563 DVSKKIDPILFSNIFLSKNEIVLYDHDKRHVVTNEQLAGRAEEV-EGFMNEANNTTLAIN 621
           D    +   LF   F+   E V Y   +  +V +  L  R  +V + +  E +     ++
Sbjct: 562 DCGISLGSSLFQKKFVPCEEYVSYQESRASLVDHNSLENRRHQVSKKYEAERDIARPQVH 621

Query: 622 IESSAEMHVEEPEAKEKNALFSPPISNVENASSSNTDGFEDMNDIIVLKDVKKRTNIKDH 681
           I +++   V + EA  ++          E+A   N    E+M+++IVLK  K   + +  
Sbjct: 622 IRAASSHAVCDKEAGAEDN---------ESAEEENKARKEEMDEVIVLKQRKTLADKEQR 672

Query: 682 KKKQGMPNKEVIDYSKLDTILXX-XXXXXXXXXXGDPFGEENGLEGPKAAKKRKQINRGK 740
              +  P+ E +D      IL              DP+       GP + KKRK+  +G 
Sbjct: 673 AVDKATPSIEPLDLQSARKILEAPSNNVRRPKKRFDPYATLAA--GPPSVKKRKK-TKGL 729

Query: 741 NVSFK 745
             SF+
Sbjct: 730 QKSFR 734

>Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001W
           (RRP6) - involved in 5.8S rRNA processing [contig 185]
           FULL
          Length = 735

 Score =  608 bits (1567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/727 (45%), Positives = 452/727 (62%), Gaps = 27/727 (3%)

Query: 26  QDVDFYRNLDKEISTSLNESSKEITNMXXXXXXXXXXXXXXXXXGKEGLEQYWKDFSNVM 85
           QDVDFY++LD  IS SL+E+S ++ ++                 G+ GLE  W +   VM
Sbjct: 29  QDVDFYKSLDSTISESLDETSAKLLSLINDVVISIDDNNDLIEPGRAGLENSWNNIGEVM 88

Query: 86  DNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQSDSNPSKRVTKPQLQFSRPVDNSES 145
           D LFEKS+ +L  + + K SN   +  QYL DS         ++TKPQ  FSRPVDN+ES
Sbjct: 89  DLLFEKSEHALAAM-KKKGSNIIGNNLQYLDDSQPLTDTTLTKITKPQASFSRPVDNTES 147

Query: 146 KPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAHPYEVEIDKQEYNASVLQVAEPLKS 205
            PF PLL  KP++++   D L +  E E +P+HY HPYE EID QEY+ SVL++  P+ S
Sbjct: 148 HPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAHYPHPYEYEIDHQEYDESVLEIRPPIPS 207

Query: 206 QPWN-SESTWVDTSEALQSMLDKLKECTEIAVDLEHHDYRSYYGIVCLMQISTRKEDFLV 264
           +PW  +++TWVD    L  M+ +L +  E+A+DLEHHDYR+YYGI CLMQISTR+ D+LV
Sbjct: 208 KPWEETDATWVDNLGTLNDMIRELSKAKELAIDLEHHDYRTYYGITCLMQISTRENDWLV 267

Query: 265 DTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQRDLGLYVVSLFDTYHASRALGFPR 324
           DT+ALRD L +LNE+F +P ++KV HGAFMD+IWLQRDLGLY+VSLFDT+HASR LGFP+
Sbjct: 268 DTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVIWLQRDLGLYLVSLFDTFHASRLLGFPK 327

Query: 325 HSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAYARADTHFLLNIYDQIRNQLIRENK 384
           HSLAYLLE+YA+FKTSKKYQLADWR+RPLSKP+ AYARADTHFLLNIYDQ+RN LI + K
Sbjct: 328 HSLAYLLERYAHFKTSKKYQLADWRIRPLSKPLKAYARADTHFLLNIYDQMRNSLIEQGK 387

Query: 385 LAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEKEEPWRTLVYQYNVPSTKIELLKRI 444
           LA+ L  SR VAKRRFEY++FRP V +  V++P+E+E+PWR+L++ YN+P +K  LLKR+
Sbjct: 388 LAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSPVEREDPWRSLIFHYNIPQSKSFLLKRL 447

Query: 445 WEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAGVISVSNVMTDHVRSNSKVIANLI 504
           +EWRD IARRDDESPRY+MPNQL+++LV   P D  G++SV++ +T+HVRSN+K ++ LI
Sbjct: 448 YEWRDTIARRDDESPRYVMPNQLLVALVMNAPTDTYGLLSVTSFVTEHVRSNAKSLSQLI 507

Query: 505 KKSLEDMKSVPAGALTAFQNIDYKIGQKFASDKLTISQIQNM---TALFKEIASNPSIIE 561
           KK+L   + +    +    +    +  K +   +  +  QN    T   +E+  +   + 
Sbjct: 508 KKTLASPQDLFTDQINHMDSNKSMVDSKLSPGDVKANH-QNFDQYTRKSRELVIHGPTVV 566

Query: 562 KDVSKKIDPILFSNIFLSKNEIVLYDHDKRHVVTNEQLAGRAEEVEGFMNEANNTTLAIN 621
           +  S      LF    L     V Y   + H +    L  R E V      A N T   N
Sbjct: 567 RGCS------LFPGKPLPNEAYVSYQGTQVHHIEPTVLDDRRELV------AQNITTTAN 614

Query: 622 IESSAEMHVEEPEAKE-KNALFSPPISNVENASSSNTDGFEDMNDIIVLKDVKKRTNIKD 680
           +    ++ VE+  A E  + L       + + + S     ED ++I+VLK  K       
Sbjct: 615 VTEKLQVAVEKTPAPEVSDELDEGEAKELSDDTVSQLK--EDKDEIVVLKRRKALPQSSS 672

Query: 681 -HKKKQGMPNKEVIDYSKLDTILXXXXXXXXXXXXG-DPFGEENGLEGPKAAKKRKQINR 738
             K  +G P KE++D+     I+              DP+  +    GP   K+RK+  R
Sbjct: 673 PPKNAEGNP-KEILDFKNNKKIMTATASVPRKSTKRFDPYAIQAS--GPDGVKRRKK-TR 728

Query: 739 GKNVSFK 745
           G   SFK
Sbjct: 729 GIQKSFK 735

>KLLA0F02431g Chr6 (220848..223718) [2871 bp, 956 aa] {ON} highly
           similar to uniprot|P40825 Saccharomyces cerevisiae
           YOR335C ALA1 Cytoplasmic alanyl-tRNA synthetase required
           for protein synthesis point mutation (cdc64-1 allele)
           causes cell cycle arrest at G1 lethality of null
           mutation is functionally complemented by human homolog
          Length = 956

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 46/88 (52%), Gaps = 7/88 (7%)

Query: 478 DPAGVISVSNVMTDHVRSNSKVIANLIKKSLEDMKSV-----PAGALTAFQNIDYKIGQK 532
           D  G+ +   V+ DHVR+ +  +A+    + E    V       GA  A + ++Y IG  
Sbjct: 291 DTDGIDTAYRVLADHVRTLTFALADGGVPNNEGRGYVLRRILRRGARYARKYMNYPIGNF 350

Query: 533 FASDKLTISQIQNMTALFKEIASNPSII 560
           F+  +L+++ I+ +  +F E+A +PS +
Sbjct: 351 FS--QLSVTLIEQVKDMFPEVARDPSYL 376

>KAFR0C05200 Chr3 complement(1034417..1035166) [750 bp, 249 aa] {ON}
           Anc_5.499 YOR152C
          Length = 249

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 66/149 (44%), Gaps = 11/149 (7%)

Query: 435 STKIELLKRIWEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAGVISVSNVMTDHVR 494
           +T +ELL + W    MI      +P YI+   L  SL+  T  + A    +     + V 
Sbjct: 50  ATMVELLLKYWSLHCMIYLILPHTPLYIIYKLLPFSLMILTAFNLALTRELLLQFINVVE 109

Query: 495 SNSKVIANLIKKSLEDMKSVPAGALTAFQN--IDYKIGQKFASDKLTISQIQNMTALFKE 552
             +  I NLI K +++ K+     LT F N  I+ KI Q F   ++T  Q+   T L K+
Sbjct: 110 EQNSFI-NLINK-IDNPKASSLDHLTNFLNFTINRKILQDFLFGRIT-EQMLISTELTKD 166

Query: 553 IASNPSI------IEKDVSKKIDPILFSN 575
             S   +      IE  VS  +  +L SN
Sbjct: 167 YPSTNFVVQLFEWIESKVSDAMTILLSSN 195

>KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]
           {ON} similar to uniprot|P23561 Saccharomyces cerevisiae
           YLR362W STE11 Signal transducing MEK kinase involved in
           pheromone response and pseudohyphal/invasive growth
           pathways where it phosphorylates Ste7p and the high
           osmolarity response pathway via phosphorylation of Pbs2p
           regulated by Ste20p and Ste50p
          Length = 730

 Score = 31.6 bits (70), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 32/67 (47%), Gaps = 2/67 (2%)

Query: 184 EVEIDKQEYNASVLQVAEPLKS--QPWNSESTWVDTSEALQSMLDKLKECTEIAVDLEHH 241
           +VE+      A V+ +A+  K    P    +   +TS+  + M+D L+    I  +L H 
Sbjct: 469 QVELKPTAVTAGVVSIADESKKAHSPGGGNTAVKNTSQIHRKMIDALQHEMNILKELHHE 528

Query: 242 DYRSYYG 248
           +  +YYG
Sbjct: 529 NIVTYYG 535

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 77,768,302
Number of extensions: 3533436
Number of successful extensions: 11656
Number of sequences better than 10.0: 88
Number of HSP's gapped: 12173
Number of HSP's successfully gapped: 88
Length of query: 746
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 629
Effective length of database: 40,065,477
Effective search space: 25201185033
Effective search space used: 25201185033
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 70 (31.6 bits)