Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1037.276.22ON54654628170.0
TPHA0J003506.22ON55954422040.0
KAFR0A050706.22ON56454621810.0
NCAS0D021606.22ON56354721300.0
TDEL0G044706.22ON54254620910.0
Suva_15.1776.22ON54454620830.0
Smik_15.1716.22ON54454620810.0
YOR002W (ALG6)6.22ON54454620710.0
Skud_15.1636.22ON54454620600.0
ZYRO0C07744g6.22ON54754520570.0
TBLA0G009706.22ON55954420490.0
CAGL0E02629g6.22ON54854520350.0
KNAG0F028906.22ON56355220250.0
SAKL0E01364g6.22ON54154420140.0
KLLA0D01221g6.22ON56654720070.0
NDAI0C026306.22ON58055320050.0
KLTH0C11176g6.22ON53652919630.0
Ecym_30276.22ON54954619520.0
Kwal_56.224376.22ON53654219390.0
ACR004W6.22ON56354619090.0
TBLA0A093105.669ON5464162994e-28
TPHA0J013805.669ON5754322961e-27
NDAI0F005105.669ON5704172891e-26
Kwal_55.217425.669ON5554102872e-26
Kpol_1018.735.669ON6212652793e-25
YOR067C (ALG8)5.669ON5772632774e-25
KLTH0F17666g5.669ON5554182765e-25
Smik_15.2475.669ON5772632756e-25
ZYRO0A11506g5.669ON5562682748e-25
NCAS0G004505.669ON5704212749e-25
CAGL0L10450g5.669ON5504142731e-24
Skud_15.2345.669ON5772632722e-24
Suva_8.1185.669ON5763702712e-24
TDEL0B025405.669ON5694082703e-24
KLLA0F16621g5.669ON5612922668e-24
ADR210C5.669ON5722922668e-24
KAFR0D024405.669ON5754132605e-23
KNAG0L019205.669ON5682652524e-22
SAKL0G00836g5.669ON5612692525e-22
Ecym_40515.669ON6042682454e-21
NDAI0E04320singletonON52699770.77
TBLA0D041007.236ON553116723.5
SAKL0F15136g7.498ON690120714.9
Smik_5.1857.236ON497126689.2
NCAS0A134707.236ON545128689.5
NCAS0F038503.540ON745110689.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1037.27
         (546 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {O...  1089   0.0  
TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON...   853   0.0  
KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa] ...   844   0.0  
NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {O...   825   0.0  
TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.2...   810   0.0  
Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002...   806   0.0  
Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002...   806   0.0  
YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha...   802   0.0  
Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002...   798   0.0  
ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly...   796   0.0  
TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.2...   793   0.0  
CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly...   788   0.0  
KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {O...   784   0.0  
SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} simila...   780   0.0  
KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {...   777   0.0  
NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.2...   776   0.0  
KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} simila...   760   0.0  
Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON} s...   756   0.0  
Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {...   751   0.0  
ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic ho...   739   0.0  
TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON} Anc_5...   119   4e-28
TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {...   118   1e-27
NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.6...   115   1e-26
Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {...   115   2e-26
Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa] ...   112   3e-25
YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON} ...   111   4e-25
KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]...   110   5e-25
Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {...   110   6e-25
ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {...   110   8e-25
NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669...   110   9e-25
CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa...   109   1e-24
Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {...   109   2e-24
Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON...   108   2e-24
TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.6...   108   3e-24
KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]...   107   8e-24
ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}...   107   8e-24
KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.6...   104   5e-23
KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {...   101   4e-22
SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly s...   101   5e-22
Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar t...    99   4e-21
NDAI0E04320 Chr5 (974435..976015) [1581 bp, 526 aa] {ON}               34   0.77 
TBLA0D04100 Chr4 (1017819..1019480) [1662 bp, 553 aa] {ON}             32   3.5  
SAKL0F15136g Chr6 complement(1217419..1219491) [2073 bp, 690 aa]...    32   4.9  
Smik_5.185 Chr5 complement(270718..272211) [1494 bp, 497 aa] {ON...    31   9.2  
NCAS0A13470 Chr1 complement(2651815..2653452) [1638 bp, 545 aa] ...    31   9.5  
NCAS0F03850 Chr6 (772412..774649) [2238 bp, 745 aa] {ON} Anc_3.5...    31   9.7  

>Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {ON}
           complement(65544..67184) [1641 nt, 547 aa]
          Length = 546

 Score = 1089 bits (2817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/546 (97%), Positives = 534/546 (97%)

Query: 1   MASKKKISRINKPVEESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYS 60
           MASKKKISRINKPVEESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYS
Sbjct: 1   MASKKKISRINKPVEESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYS 60

Query: 61  GMGNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLN 120
           GMGNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLN
Sbjct: 61  GMGNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLN 120

Query: 121 KSWFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIA 180
           KSWFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIA
Sbjct: 121 KSWFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIA 180

Query: 181 AAAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYY 240
           AAAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYY
Sbjct: 181 AAAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYY 240

Query: 241 APIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSVHRIF 300
           APIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSVHRIF
Sbjct: 241 APIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSVHRIF 300

Query: 301 PFARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHL 360
           PFARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHL
Sbjct: 301 PFARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHL 360

Query: 361 LPYALAACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSFVSWVNNVGLFTLWPL 420
           LPYALAACSMSFYLFSFQVHEK            YTSTDWNVLSFVSWVNNVGLFTLWPL
Sbjct: 361 LPYALAACSMSFYLFSFQVHEKTILVPLLPITLLYTSTDWNVLSFVSWVNNVGLFTLWPL 420

Query: 421 LKKDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNIL 480
           LKKDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNIL
Sbjct: 421 LKKDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNIL 480

Query: 481 WKIIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLAN 540
           WKIIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLAN
Sbjct: 481 WKIIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLAN 540

Query: 541 KTLQYL 546
           KTLQYL
Sbjct: 541 KTLQYL 546

>TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON}
           Anc_6.22 YOR002W
          Length = 559

 Score =  853 bits (2204), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/544 (74%), Positives = 468/544 (86%), Gaps = 3/544 (0%)

Query: 4   KKKISRINKPVE-ESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYSGM 62
           K  IS +++ ++ E F+ASPLY FLSPF+  +NQWL+ YIIV+FALI+RCAIGLG YSGM
Sbjct: 18  KNDISSLDETLDTEPFYASPLYTFLSPFKSTTNQWLSVYIIVLFALIIRCAIGLGPYSGM 77

Query: 63  GNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNKS 122
              PMFGDFEAQRHWMEITQHLPIS+WYF+DL+YWGLDYPPLTAYHSY+ G+IG F N +
Sbjct: 78  NEAPMFGDFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPA 137

Query: 123 WFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAA 182
           WF L  SRG E +  +LKT+MR T I+SE+IFYIP +IYFT WVG+ R+QS +GQYIAAA
Sbjct: 138 WFELETSRGMEMK--ELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAA 195

Query: 183 AILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAP 242
           AILFQP LMLIDHGHFQYNSVMLGLTVYAINNLLD+ YAPAA+ FV+SICFKQM+LYYAP
Sbjct: 196 AILFQPCLMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAP 255

Query: 243 IFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSVHRIFPF 302
           IFF YLLGRSLF ++FFN+SRFL+IAI+T+ +FF+++APLYVFGGG RN+IQSVHRIFPF
Sbjct: 256 IFFAYLLGRSLFKKQFFNVSRFLNIAIATMVSFFTVFAPLYVFGGGKRNIIQSVHRIFPF 315

Query: 303 ARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHLLP 362
           ARG+FEDKVANFWCVTN+ +KYK+ YTQ ELQLYSLI TVVGFLPA+VTIL++PKKHLLP
Sbjct: 316 ARGIFEDKVANFWCVTNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPKKHLLP 375

Query: 363 YALAACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSFVSWVNNVGLFTLWPLLK 422
           Y+LAAC+MSF+LFSFQVHEK            YTSTDWNVLS VSW+NNV LFTLWPLLK
Sbjct: 376 YSLAACAMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSLVSWINNVALFTLWPLLK 435

Query: 423 KDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNILWK 482
           KDG+ LQYGVCF LSNWLIGNFSF TP+FLPK+LTPGPP+QN    Y RRSLLP+NI+WK
Sbjct: 436 KDGVVLQYGVCFILSNWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPNNIIWK 495

Query: 483 IIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLANKT 542
           IIIV SYIVM+ I   E+FV PPP+YPDI+VL+NC LGF CF  FWLWNYYK+FTL +K 
Sbjct: 496 IIIVLSYIVMVAIQGLELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFTLTSKN 555

Query: 543 LQYL 546
           LQYL
Sbjct: 556 LQYL 559

>KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa]
           {ON} Anc_6.22 YOR002W
          Length = 564

 Score =  844 bits (2181), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/546 (73%), Positives = 456/546 (83%), Gaps = 3/546 (0%)

Query: 2   ASKKKISRIN-KPVEESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYS 60
           ++ KK S++N + +EE F+ASPLYDFL PFRP  NQWL +YIIV FALI+RCAIGLGSYS
Sbjct: 21  SNPKKASKLNNEAIEEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYS 80

Query: 61  GMGNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLN 120
           GMG+ PMFGDFEAQRHWMEITQHLPISKWY+FDL+YWGLDYPPLTAYHSY+LG IGSF+ 
Sbjct: 81  GMGHSPMFGDFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIY 140

Query: 121 KSWFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIA 180
             WF LNDSRG E E   +K+YMRTTV+ISE +FY P +IYF+KW G+HR QS IGQYIA
Sbjct: 141 PKWFTLNDSRGIEMEG--IKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIA 198

Query: 181 AAAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYY 240
           A AILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLD+FY+ A++CFVLSICFKQM+LYY
Sbjct: 199 ATAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYY 258

Query: 241 APIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSVHRIF 300
           APIFFGYLL +SLF  + FNI R + IA  T+  F +MY+PLY+FGGGL N+IQSVHRIF
Sbjct: 259 APIFFGYLLSKSLFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHRIF 318

Query: 301 PFARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHL 360
           PFARG+FEDKVANFWCVTNI IKYKI +TQ +LQLYSL ATV+GFLPA+V I+ YPKKHL
Sbjct: 319 PFARGIFEDKVANFWCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHL 378

Query: 361 LPYALAACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSFVSWVNNVGLFTLWPL 420
           LPYALAACSMSF+LFSFQVHEK            YTSTDWNVLS V W+NNV LFTLWPL
Sbjct: 379 LPYALAACSMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSMVCWINNVALFTLWPL 438

Query: 421 LKKDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNIL 480
           LKKDGL LQY VCF LSNWL+GNFSF+TPKFLPKMLTPGP +    + YHRRSLLPHNIL
Sbjct: 439 LKKDGLILQYAVCFALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNIL 498

Query: 481 WKIIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLAN 540
           WK++IVSSY+ M + H  + FV PP  YPDIW+ +NC +GFG FV FW+W YY +FTL N
Sbjct: 499 WKVVIVSSYLSMAVFHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRN 558

Query: 541 KTLQYL 546
           KTL  L
Sbjct: 559 KTLMDL 564

>NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  825 bits (2130), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/547 (72%), Positives = 459/547 (83%), Gaps = 4/547 (0%)

Query: 2   ASKKKISRINKPVEESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYSG 61
              K+ S+ +   EESF+ASPLYD L PFRP  +QW+TEY IV+F+LI+RCA+GLG +SG
Sbjct: 19  GKTKETSKKHDIPEESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFSG 78

Query: 62  MGNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNK 121
            G PPMFGDFEAQRHWMEITQHLPI KWY+FDL+YWGLDYPPLTAYHSY+ G IGSF N 
Sbjct: 79  YGVPPMFGDFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNP 138

Query: 122 SWFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAA 181
           +WFAL+ SRGYE++  DLKT+MR TV++SE +FYIPGV+YF KW+G+HR+QS IGQ+IAA
Sbjct: 139 NWFALDSSRGYEAQ--DLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAA 196

Query: 182 AAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYA 241
           AAIL QPSL+LIDHGHFQYNSV LGLTVYAINNLLDEFYA AA+CFVLSICFKQM LYY+
Sbjct: 197 AAILLQPSLILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYS 256

Query: 242 PIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGG--GLRNVIQSVHRI 299
           PIFF YLL +SLF+ K FNI RFL+IAI+TV +F  MY PLYVFGG  GL NV+QS+HRI
Sbjct: 257 PIFFAYLLSKSLFTPKLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQSIHRI 316

Query: 300 FPFARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKH 359
           FPFARG+FEDKVANFWCVTN+  KYK+L+TQ+ELQLYSL+ TVVGFLPA++ ILFYPKK+
Sbjct: 317 FPFARGIFEDKVANFWCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKKY 376

Query: 360 LLPYALAACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSFVSWVNNVGLFTLWP 419
           LLPYAL+ACSM+FYLFSFQVHEK            YTSTD NVLS VSW+NN+GLFTLWP
Sbjct: 377 LLPYALSACSMAFYLFSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLFTLWP 436

Query: 420 LLKKDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNI 479
           LLKKDGLTLQY VC  LSNWLIGNFSFITP FLPK+LTPGP V    + YH RSLLP NI
Sbjct: 437 LLKKDGLTLQYWVCLLLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRNI 496

Query: 480 LWKIIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLA 539
            WK+IIV SYI M  IH+ + FV+PP  YPD+WV++NC LGFGCF LFW+WNYYK+F++ 
Sbjct: 497 FWKVIIVLSYIAMGAIHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSMI 556

Query: 540 NKTLQYL 546
            K+L +L
Sbjct: 557 KKSLHHL 563

>TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.22
           YOR002W
          Length = 542

 Score =  810 bits (2091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/546 (71%), Positives = 456/546 (83%), Gaps = 4/546 (0%)

Query: 1   MASKKKISRINKPVEESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYS 60
           MA K K ++ N  VEESF+ASPLYDFL PFRP  +QWLTEY+IV+FALI+ CA+G GSYS
Sbjct: 1   MAPKNKEAKRNT-VEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYS 59

Query: 61  GMGNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLN 120
           G  +PPMFGDFEAQRHWMEITQHL  S+WY+FDLEYWGLDYPPLTAYHSYVLG IGSF+ 
Sbjct: 60  GQFSPPMFGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIK 119

Query: 121 KSWFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIA 180
             WF LN+SRG E+   DLKT+MR TV++SE +FYIP V+YFTKW+G+HRQ+S IGQ+I+
Sbjct: 120 PEWFELNESRGIETP--DLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFIS 177

Query: 181 AAAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYY 240
           AAAILFQPSLMLIDHGHFQYN VMLGLTVYAIN+L +EFYA AA+CFVLSICFKQMALYY
Sbjct: 178 AAAILFQPSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYY 237

Query: 241 APIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSVHRIF 300
           APIFF YLL +SLFS +F N  R  +IA++TV +F +MYAPLY+FGGGL NVIQSVHRIF
Sbjct: 238 APIFFAYLLSKSLFSPRF-NFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRIF 296

Query: 301 PFARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHL 360
           PFARG+FEDKVANFWCVTN+F KYK ++ Q++LQLYSLIAT++GFLPAV+ I  YPKKH+
Sbjct: 297 PFARGIFEDKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHI 356

Query: 361 LPYALAACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSFVSWVNNVGLFTLWPL 420
           + YALA CSMSFYLFSFQVHEK            YTS++W+VLS  +W+NNVGLFTL+PL
Sbjct: 357 ICYALATCSMSFYLFSFQVHEKTILVPLLPITLLYTSSNWDVLSMANWINNVGLFTLYPL 416

Query: 421 LKKDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNIL 480
           LKKDGLTLQY VCF LSNWL+GNFSF+TPKFLPK LTPGP V + +  Y RRS LP N++
Sbjct: 417 LKKDGLTLQYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVI 476

Query: 481 WKIIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLAN 540
           WKIIIVSSY  M ++H+ +  + PP  YPD+WVL+NC LGFGCF LFWLW+YY +FT+  
Sbjct: 477 WKIIIVSSYTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPR 536

Query: 541 KTLQYL 546
           KTLQ L
Sbjct: 537 KTLQQL 542

>Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  806 bits (2083), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/546 (70%), Positives = 453/546 (82%), Gaps = 2/546 (0%)

Query: 1   MASKKKISRINKPVEESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYS 60
           MA  K++  +NKP EESF+ASP+YDFL PFRPV NQWL EYII + A+IVRCAIGLG YS
Sbjct: 1   MAIGKRL-LVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYS 59

Query: 61  GMGNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLN 120
           G   PP+ GDFEAQRHWMEITQHLP+SKWY++DL+YWGLDYPPLTA+HSY+LG+IG+F N
Sbjct: 60  GKATPPLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGTFFN 119

Query: 121 KSWFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIA 180
            SWFAL+ SRG+ES +N LKTYMR+TVIIS+I+FY P VIYFTKW+GR+R QS IGQ IA
Sbjct: 120 PSWFALDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIA 179

Query: 181 AAAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYY 240
           AAAILFQPSLMLIDHGHFQYNSVMLGLT YAINNLLDE+YA AAMCFVLSICFKQMALYY
Sbjct: 180 AAAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYY 239

Query: 241 APIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSVHRIF 300
           APIFF YLL RSLF  K FNI+R   IA +T+  F  M+APLY  GGGLRN+ Q +HR+F
Sbjct: 240 APIFFAYLLSRSLFFPK-FNIARLTVIAFATLATFSLMFAPLYFLGGGLRNIYQCIHRMF 298

Query: 301 PFARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHL 360
           PFARG+FEDKVANFWCV+NIF+KYK  ++ ++LQLYSL+ATV+GFLPA++  L +PKKHL
Sbjct: 299 PFARGIFEDKVANFWCVSNIFVKYKERFSIQQLQLYSLVATVLGFLPAMMMTLLHPKKHL 358

Query: 361 LPYALAACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSFVSWVNNVGLFTLWPL 420
           LPY L ACSMSF+LFSFQVHEK            Y+STDWNVLS VSW+NNV LFTLWPL
Sbjct: 359 LPYVLIACSMSFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPL 418

Query: 421 LKKDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNIL 480
           LKKDGL LQY V F L+NWLIGNFSFITP+FLPK LTPGP + +    Y RRSLLP+N++
Sbjct: 419 LKKDGLHLQYVVSFLLTNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVV 478

Query: 481 WKIIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLAN 540
           WK  I+ +YI M L H  ++FV+PP +YPD+WVL+NC +GF CF +FW+W+YYKIFT  N
Sbjct: 479 WKSFIIGTYIAMGLYHFLDLFVAPPKKYPDLWVLLNCAVGFICFSIFWIWSYYKIFTSGN 538

Query: 541 KTLQYL 546
           K+++ L
Sbjct: 539 KSMKDL 544

>Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  806 bits (2081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/546 (69%), Positives = 452/546 (82%), Gaps = 2/546 (0%)

Query: 1   MASKKKISRINKPVEESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYS 60
           MA  K++  +NKP EESF+ASP+YDFL PFRPV NQWL EYII + A+IVRC IGLG YS
Sbjct: 1   MAIGKRL-LVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCTIGLGPYS 59

Query: 61  GMGNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLN 120
           G G+PP+ GDFEAQRHWMEITQHLP+SKWY++DL+YWGLDYPPLTA+HSY+LG+IGSF N
Sbjct: 60  GKGSPPLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFN 119

Query: 121 KSWFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIA 180
            SWFAL+ SRG+ES +N LKTYMR+TVIIS+I+FY P VIYFTKW+GR+R QS IGQ IA
Sbjct: 120 PSWFALDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIA 179

Query: 181 AAAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYY 240
           A+AILFQPSLMLIDHGHFQYNSVMLGLT YAINNLLDE+YA AAMCFVLSICFKQMALYY
Sbjct: 180 ASAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYY 239

Query: 241 APIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSVHRIF 300
           APIFF YLL RSL   K FNI+R   I+ +T+  F  M APLY  GGGL+N+ Q +HRIF
Sbjct: 240 APIFFAYLLSRSLLFPK-FNIARLTVISFATLATFALMLAPLYFLGGGLKNIYQCIHRIF 298

Query: 301 PFARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHL 360
           PFARG+FEDKVANFWCVTN+F+KYK  ++ ++LQLYSL+ATV+GFLPA+V  L +PKKHL
Sbjct: 299 PFARGIFEDKVANFWCVTNVFVKYKERFSVQQLQLYSLVATVIGFLPAMVMTLLHPKKHL 358

Query: 361 LPYALAACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSFVSWVNNVGLFTLWPL 420
           LPY L ACSMSF+LFSFQVHEK            Y+STDWNVLS VSW+NNV LFTLWPL
Sbjct: 359 LPYVLIACSMSFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPL 418

Query: 421 LKKDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNIL 480
           LK+DGL LQY V F LSNWLIGNFSFITP+FLPK LTPGP + +    Y RRSLLP+N++
Sbjct: 419 LKRDGLHLQYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVV 478

Query: 481 WKIIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLAN 540
           WK  I+ +YI M L H  ++FV+PP +YPD+WVL+NC +GF CF +FW+W+YYKIFT  +
Sbjct: 479 WKSFIIGTYIAMGLYHFLDLFVAPPSKYPDLWVLLNCTVGFTCFSIFWVWSYYKIFTSGS 538

Query: 541 KTLQYL 546
           K+++ L
Sbjct: 539 KSMKDL 544

>YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha
           1,3 glucosyltransferase, involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation; mutations in human ortholog are
           associated with disease
          Length = 544

 Score =  802 bits (2071), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/546 (69%), Positives = 451/546 (82%), Gaps = 2/546 (0%)

Query: 1   MASKKKISRINKPVEESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYS 60
           MA  K++  +NKP EESF+ASP+YDFL PFRPV NQWL EYII + A+I+RC IGLG YS
Sbjct: 1   MAIGKRL-LVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYS 59

Query: 61  GMGNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLN 120
           G G+PP++GDFEAQRHWMEITQHLP+SKWY++DL+YWGLDYPPLTA+HSY+LG+IGSF N
Sbjct: 60  GKGSPPLYGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFN 119

Query: 121 KSWFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIA 180
            SWFAL  SRG+ES +N LKTYMR+TVIIS+I+FY P VIYFTKW+GR+R QS IGQ IA
Sbjct: 120 PSWFALEKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIA 179

Query: 181 AAAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYY 240
           A+AILFQPSLMLIDHGHFQYNSVMLGLT YAINNLLDE+YA AA+CFVLSICFKQMALYY
Sbjct: 180 ASAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYY 239

Query: 241 APIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSVHRIF 300
           APIFF YLL RSL   K FNI+R   IA +T+  F  ++APLY  GGGL+N+ Q +HRIF
Sbjct: 240 APIFFAYLLSRSLLFPK-FNIARLTVIAFATLATFAIIFAPLYFLGGGLKNIHQCIHRIF 298

Query: 301 PFARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHL 360
           PFARG+FEDKVANFWCVTN+F+KYK  +T ++LQLYSLIATV+GFLPA++  L +PKKHL
Sbjct: 299 PFARGIFEDKVANFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHL 358

Query: 361 LPYALAACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSFVSWVNNVGLFTLWPL 420
           LPY L ACSMSF+LFSFQVHEK            Y+STDWNVLS VSW+NNV LFTLWPL
Sbjct: 359 LPYVLIACSMSFFLFSFQVHEKTILIPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPL 418

Query: 421 LKKDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNIL 480
           LKKDGL LQY V F LSNWLIGNFSFITP+FLPK LTPGP + +    Y RRSLLP+N++
Sbjct: 419 LKKDGLHLQYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVV 478

Query: 481 WKIIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLAN 540
           WK  I+ +YI M   H  + FV+PP +YPD+WVL+NC +GF CF +FWLW+YYKIFT  +
Sbjct: 479 WKSFIIGTYIAMGFYHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGS 538

Query: 541 KTLQYL 546
           K+++ L
Sbjct: 539 KSMKDL 544

>Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  798 bits (2060), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/546 (69%), Positives = 450/546 (82%), Gaps = 2/546 (0%)

Query: 1   MASKKKISRINKPVEESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYS 60
           MA  K++  +NKP EESF+ASP+YDFL PFRPV NQWL EYII + A+IVRCAIGLG YS
Sbjct: 1   MAIGKRL-LVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYS 59

Query: 61  GMGNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLN 120
           G  +PP+ GDFEAQRHWMEITQHLP+SKWY++DL+YWGLDYPPLTA+HS + G+IG+F N
Sbjct: 60  GKDSPPLHGDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFN 119

Query: 121 KSWFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIA 180
            SWFAL+ SRG+ES +N LKTYMR+TVIIS+I+FY P VIYFTKW+GR+R QS IGQ IA
Sbjct: 120 PSWFALDKSRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIA 179

Query: 181 AAAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYY 240
           AAAILFQPSLMLIDHGHFQYNSVMLGLT YAINNLLDE+YA AA+CFVLSICFKQMALYY
Sbjct: 180 AAAILFQPSLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYY 239

Query: 241 APIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSVHRIF 300
           APIFF YLL RSL   K FNI+R   IA +T+  F  + APLY  GGGLRN+ Q ++RIF
Sbjct: 240 APIFFAYLLSRSLLFPK-FNIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIF 298

Query: 301 PFARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHL 360
           PF+RG+FEDKVANFWCVTNIF+KYK  +T ++LQLYSL+ATV+GFLPA++  L +PKKHL
Sbjct: 299 PFSRGIFEDKVANFWCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHL 358

Query: 361 LPYALAACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSFVSWVNNVGLFTLWPL 420
           LPY L ACSMSF+LFSFQVHEK            Y+STDWNVLS VSW+NNV LFTLWPL
Sbjct: 359 LPYVLIACSMSFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPL 418

Query: 421 LKKDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNIL 480
           LKKDGL LQY V F LSNWLIGNFSFITP+FLPK LTPGP + +    Y RRSLLP+N++
Sbjct: 419 LKKDGLHLQYTVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVV 478

Query: 481 WKIIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLAN 540
           WK  I+ +YI M + HL ++FV PP +YPD+WVL+NC +GF CF +FW+W+YYKIFT  N
Sbjct: 479 WKSFIIGTYIAMGVYHLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGN 538

Query: 541 KTLQYL 546
           K+++ L
Sbjct: 539 KSVKDL 544

>ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 547

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/545 (71%), Positives = 455/545 (83%), Gaps = 3/545 (0%)

Query: 2   ASKKKISRINKPVEESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYSG 61
           + K + ++ +   EESF+ASPLYDFL PF+PV +QWL EYII++FA+I+RCAIGLG YSG
Sbjct: 6   SKKVEKAQADNTAEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGLGPYSG 65

Query: 62  MGNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNK 121
               PM GDFEAQRHW+EITQHLPIS+WY+FDLEYWGLDYPPLTAYHSY+LG +GS +N 
Sbjct: 66  QSVKPMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINP 125

Query: 122 SWFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAA 181
            WFALN SRG ES  NDLKTYMR TVI+SE+IFYIP V+YFTKWVGRHR  S +GQ+IAA
Sbjct: 126 DWFALNVSRGLES--NDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAA 183

Query: 182 AAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYA 241
           AAILFQP+LMLIDHGHFQYN VMLG TVYAIN+L+DEFYAPAA CFVLSICFKQMALYY+
Sbjct: 184 AAILFQPALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYS 243

Query: 242 PIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSVHRIFP 301
           PIFF YLLGR +F +      RFLSIA++T+  F  MY PLY+ G G +NV+QSVHRIFP
Sbjct: 244 PIFFAYLLGRCVF-KTGIRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHRIFP 302

Query: 302 FARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHLL 361
           FARG+FEDKVANFWCVTNIF+KYK L+TQ++LQLYSL+AT +GFLPAVV +L YPKKHL+
Sbjct: 303 FARGIFEDKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKHLV 362

Query: 362 PYALAACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSFVSWVNNVGLFTLWPLL 421
           P+ALAACSMSF+LFSFQVHEK            YTST+W+VLS VSW+NNVGLFTLWPLL
Sbjct: 363 PFALAACSMSFFLFSFQVHEKTILVPLLPITLLYTSTNWDVLSLVSWINNVGLFTLWPLL 422

Query: 422 KKDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNILW 481
           KKDGL LQY VCF   NWLIGNFSF+TP FLPK LTPGP V + +  Y RRSLLP +I+W
Sbjct: 423 KKDGLALQYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSIIW 482

Query: 482 KIIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLANK 541
           K+IIV SYI M  IH+ ++FV+PP  YPD+WV++NC LGFGCF+LFWLWNYYK+F+LA +
Sbjct: 483 KLIIVGSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLAGQ 542

Query: 542 TLQYL 546
           +LQ L
Sbjct: 543 SLQQL 547

>TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.22
           YOR002W
          Length = 559

 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/544 (71%), Positives = 450/544 (82%), Gaps = 13/544 (2%)

Query: 15  EESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYSGMGNPPMFGDFEAQ 74
           EE+F+ASPL+DFL PFRPV +QWLTEY+I+IFA+I+RCAI LGSYSG G PPMFGDFEAQ
Sbjct: 17  EEAFYASPLFDFLYPFRPVGSQWLTEYVIIIFAIIIRCAISLGSYSGKGTPPMFGDFEAQ 76

Query: 75  RHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNKSWFALNDSRGYES 134
           RHWMEITQHLPISKWY+FDL+YWGLDYPP TAYHSY  G +GSF N  WFALN SRGYES
Sbjct: 77  RHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYES 136

Query: 135 ENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAAAILFQPSLMLID 194
           ++N LKTYMR TVI+SE +FYIP V+YFTKW+G+HR QS IGQ+IAAAAILFQPSLMLID
Sbjct: 137 DDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLID 196

Query: 195 HGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAPIFFGYLLGRSLF 254
           HGHFQYNSVMLGLTVYAINNLLDEFY PAA+CFVLS+CFKQMALYY+PIFFGYLL +SL 
Sbjct: 197 HGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSLV 256

Query: 255 SRKFFNISRFLSIAISTVFAFFSMYAPLYVFG------------GGLRNVIQSVHRIFPF 302
                NISRF+ +AISTV +F  M+ P+Y+FG             GL N+IQ + RIFPF
Sbjct: 257 HPS-CNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFPF 315

Query: 303 ARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHLLP 362
           ARG+FEDKVANFWCVTN+ IKY+ L+TQ++LQ YSL+AT++GFLP+++TI  YP+K L+P
Sbjct: 316 ARGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLIP 375

Query: 363 YALAACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSFVSWVNNVGLFTLWPLLK 422
           YALAACSMSF+LFSFQVHEK            YTSTDWNVLS V W+NNV LFTLWPLL+
Sbjct: 376 YALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLR 435

Query: 423 KDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNILWK 482
           KDGL LQY VC+FLSNWLIGNFSFITPKFLP  LTPGP + N +D Y R SLLPHNILWK
Sbjct: 436 KDGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILWK 495

Query: 483 IIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLANKT 542
           III+SSYIVM  + + ++F  PP  YPD+W+++NC +GFGCF+LFWLWN YKI  + NKT
Sbjct: 496 IIIISSYIVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNKT 555

Query: 543 LQYL 546
           L  L
Sbjct: 556 LNDL 559

>CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002w ALG6 glucosyltransferase
          Length = 548

 Score =  788 bits (2035), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/545 (68%), Positives = 446/545 (81%), Gaps = 4/545 (0%)

Query: 3   SKKKISRI-NKPVEESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYSG 61
            KK +S+  ++  EESF+ASPLYDFL PFRP  +QWLTE+II++FA+I+RCAIGLG YSG
Sbjct: 7   DKKAVSKFESEQGEESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIGLGPYSG 66

Query: 62  MGNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNK 121
             + PM GDFEAQRHWMEITQHLPISKWY++DL+YWGLDYPPLTA+HSY+LG +G+F N 
Sbjct: 67  YKDGPMHGDFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNP 126

Query: 122 SWFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAA 181
            WFAL+ SRG E++   LK YMR TV++SE IFY+P V+YFTKW+GR R QS IGQ+IAA
Sbjct: 127 DWFALDSSRGIETQG--LKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAA 184

Query: 182 AAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYA 241
           AAILFQPSLMLIDHGHFQYNS+MLG TVYAINNLLDEFYAPAA+CFVLSICFKQM+LYYA
Sbjct: 185 AAILFQPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYA 244

Query: 242 PIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSVHRIFP 301
           PIFF YLLGRS+F  K FNI RF+SI+I+T+  F +M++P Y+FGG L  + Q+V RIFP
Sbjct: 245 PIFFAYLLGRSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIFGG-LDGLAQTVRRIFP 303

Query: 302 FARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHLL 361
           FARG+FEDKVANFWCV N  +K+K+L+T  +L++YSLI TVVGF PA++ I+ YP+KHLL
Sbjct: 304 FARGIFEDKVANFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRKHLL 363

Query: 362 PYALAACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSFVSWVNNVGLFTLWPLL 421
           PYALAACSMSFYLFSFQVHEK            +TS DWNVLS VSW+NNV LFTLWPLL
Sbjct: 364 PYALAACSMSFYLFSFQVHEKTILVPLLPITLLFTSRDWNVLSMVSWINNVALFTLWPLL 423

Query: 422 KKDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNILW 481
           K++GL LQY VCFFLSNWLIGNFSFITP+FLPK +TPGP + +  D Y RRSLLPH+I W
Sbjct: 424 KREGLYLQYFVCFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHSIFW 483

Query: 482 KIIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLANK 541
           K+IIVSSYI M   H  ++F+  PP +PD+WV++NC +GF  F LFWLW YYK  TL  K
Sbjct: 484 KLIIVSSYIGMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTLLKK 543

Query: 542 TLQYL 546
            +Q L
Sbjct: 544 NIQDL 548

>KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  784 bits (2025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/552 (67%), Positives = 449/552 (81%), Gaps = 10/552 (1%)

Query: 2   ASKKKISRINK-------PVEESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAI 54
           +  K +S++ +        VEE F+ASP+YDFL PFR   +QW+TEYIIV+F LI++ AI
Sbjct: 15  SKTKSLSKLQRNKDEAAPEVEECFYASPIYDFLYPFRSPGSQWVTEYIIVVFLLIIKSAI 74

Query: 55  GLGSYSGMGNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGV 114
           GLGSYSG   PPMFGDFEAQRHWMEITQHLP+S+WY+FDL+YWGLDYPP TAYHSY+LG 
Sbjct: 75  GLGSYSGFQTPPMFGDFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGK 134

Query: 115 IGSFLNKSWFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSL 174
           IG+F+   WF L+ SRG E++   +K+YMR TV++SE IFYIP ++YFTKWVGR ++QS 
Sbjct: 135 IGTFIYPPWFELDASRGMETDG--IKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSP 192

Query: 175 IGQYIAAAAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFK 234
           IGQ++AAAAILFQP+LMLIDHGHFQYN VMLGLTVYAINNLLD FYA AA+CFVLSICFK
Sbjct: 193 IGQFVAAAAILFQPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFK 252

Query: 235 QMALYYAPIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQ 294
           QMALYYAPIFF  LL +SLF  + FNI RFLS+A +T+ + F M+APLY+FGG + NV+Q
Sbjct: 253 QMALYYAPIFFAVLLSKSLFFPRLFNIPRFLSVAFATLASLFVMFAPLYIFGG-VGNVLQ 311

Query: 295 SVHRIFPFARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILF 354
           S+HRIFPFARG+FEDKVANFWCVTN+F KYK ++TQ ELQ YSL+ATVVGF PA + ++F
Sbjct: 312 SIHRIFPFARGIFEDKVANFWCVTNVFFKYKTMFTQSELQFYSLVATVVGFFPAFMIMIF 371

Query: 355 YPKKHLLPYALAACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSFVSWVNNVGL 414
           YPKK L+PY LAACSM+F+LFSFQVHEK            +TST+WN LS V WVNNV L
Sbjct: 372 YPKKFLIPYGLAACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVAL 431

Query: 415 FTLWPLLKKDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSL 474
           FTLWPLLKKDGL LQY VC  + NWL+GNFSFITP+FLPK+LTPGP + N  + Y RRSL
Sbjct: 432 FTLWPLLKKDGLWLQYCVCLVMYNWLLGNFSFITPRFLPKILTPGPSISNIAENYRRRSL 491

Query: 475 LPHNILWKIIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYK 534
           LPHNI+WKIII+ SY+ ML+IH+ E  ++ P +YPD+WV +NC +GFGCFVLFW+W YYK
Sbjct: 492 LPHNIIWKIIILVSYLCMLMIHVLEYTIAAPSQYPDLWVQLNCTVGFGCFVLFWMWTYYK 551

Query: 535 IFTLANKTLQYL 546
           + TL NKT+Q L
Sbjct: 552 LITLRNKTIQEL 563

>SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 541

 Score =  780 bits (2014), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/544 (69%), Positives = 452/544 (83%), Gaps = 7/544 (1%)

Query: 1   MASKKK-ISRINKPVEESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSY 59
           M+SK+K  SR  K V+ESFFASPL+DFLSPFRPV+NQW  +YIIV+FALI+RC +GLGS+
Sbjct: 1   MSSKRKPYSR--KIVKESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSF 58

Query: 60  SGMGNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFL 119
           SGM  PPM GDFEAQRHWME+T +LP+S+WY++DL YWGLDYPPLTAYHSY+LG +G   
Sbjct: 59  SGMNVPPMHGDFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIF 118

Query: 120 NKSWFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYI 179
           + +WF L  SRG ES   DLK+YMR TV++SE++ YIPGVIYF KW+G+HR Q+ IGQYI
Sbjct: 119 DPTWFQLGVSRGQESM--DLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYI 176

Query: 180 AAAAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALY 239
           AAAAILFQPSL+LIDHGHFQYNSVMLGLTVYAINNLLDE+YAPAA+CFVLS+CFKQMALY
Sbjct: 177 AAAAILFQPSLILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALY 236

Query: 240 YAPIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSVHRI 299
           YAPIFF YLL +SLFS   FN+ R L++A +T+ +F +M+ PLY++GG +RNV+QS+HRI
Sbjct: 237 YAPIFFSYLLSKSLFS-PLFNLPRLLAVAAATLISFAAMFFPLYMWGG-IRNVLQSIHRI 294

Query: 300 FPFARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKH 359
           FPF+RG+FEDKVANFWC +NIFIKYK+LYTQ +LQ+YSL AT +GFLPA + I FYPKKH
Sbjct: 295 FPFSRGIFEDKVANFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKH 354

Query: 360 LLPYALAACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSFVSWVNNVGLFTLWP 419
           L+PYAL ACSMSF+LFSFQVHEK            YTSTDWNVLS VSW+NN+  FTLWP
Sbjct: 355 LIPYALTACSMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSMVSWINNMAFFTLWP 414

Query: 420 LLKKDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNI 479
           LLKKDGL LQY     LSNWLIGNFSF+TP+FLPK LTPGP   +  + Y RRSLLP NI
Sbjct: 415 LLKKDGLVLQYATLLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNI 474

Query: 480 LWKIIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLA 539
            WK+IIV+SYI M ++HL + +V PP +YPD+WVL+NC LGF  F LFW+WNYYK+FTL 
Sbjct: 475 FWKLIIVASYISMGILHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLR 534

Query: 540 NKTL 543
           NKTL
Sbjct: 535 NKTL 538

>KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {ON}
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease,
          Length = 566

 Score =  777 bits (2007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/547 (67%), Positives = 439/547 (80%), Gaps = 6/547 (1%)

Query: 2   ASKKKISRINKPVE--ESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSY 59
           A     + I K VE  E+FFASP+YDFL+PFRPV NQW  +Y+IVIFALI+RCA+GLG Y
Sbjct: 24  AETTTSTAIMKKVESVEAFFASPMYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGLGGY 83

Query: 60  SGMGNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFL 119
           SGM  PPMFGDFEAQRHWMEITQHLP+ +WY++DL+YWGLDYPPLTAYHSY+LG +GSF 
Sbjct: 84  SGMNTPPMFGDFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLGSFF 143

Query: 120 NKSWFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYI 179
            + WF L  SRGYES N  LK+YMR TVIISE++ YIP VIYFTKWVG++R QS IGQYI
Sbjct: 144 REGWFDLESSRGYESLN--LKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYI 201

Query: 180 AAAAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALY 239
           AAAAILFQP+L+L+DHGHFQYN VMLG+TVY +NNLLD FYA  A+CFVLS+CFKQMALY
Sbjct: 202 AAAAILFQPALILVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALY 261

Query: 240 YAPIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSVHRI 299
           Y+PIFF YLL +S +S    N+ R  +I++ST  AF   + P+Y+FGG  +N++QS+HRI
Sbjct: 262 YSPIFFAYLLSKSTYSPGI-NLPRLFAISVSTALAFIGSFGPIYIFGG-YKNLVQSMHRI 319

Query: 300 FPFARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKH 359
           FPFARG+FEDKVANFWCV+NIFIKY+ L+TQK+LQLYSL+ATV+G LP+ +    YPK+H
Sbjct: 320 FPFARGIFEDKVANFWCVSNIFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRH 379

Query: 360 LLPYALAACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSFVSWVNNVGLFTLWP 419
           LLPYALAACSMSF+LFSFQVHEK            YTS DWNVLS V W+NNV LFTLWP
Sbjct: 380 LLPYALAACSMSFFLFSFQVHEKTILLPLLPITLLYTSRDWNVLSLVCWINNVALFTLWP 439

Query: 420 LLKKDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNI 479
           LLKKD L LQYGV F  SNWLIGNFSF+TP+FLPK LTPGP + + +  Y R SLLP ++
Sbjct: 440 LLKKDNLVLQYGVMFMFSNWLIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSL 499

Query: 480 LWKIIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLA 539
           +W++IIV SYI M +IH  + +VSPP +YPD+WVL NC LGF CFV FW+WN YK+F + 
Sbjct: 500 IWRLIIVGSYIAMGIIHFLDYYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMR 559

Query: 540 NKTLQYL 546
           N TLQ L
Sbjct: 560 NSTLQDL 566

>NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.22
           YOR002W
          Length = 580

 Score =  776 bits (2005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/553 (66%), Positives = 445/553 (80%), Gaps = 10/553 (1%)

Query: 2   ASKKKISRINKPVE-----ESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGL 56
             K K    N+P+E     ESF+ASPLYDFL PFRP  +QW+TEYIIV+FA+I+RCA+GL
Sbjct: 30  TKKSKKMNNNQPLETETSKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGL 89

Query: 57  GSYSGMGNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIG 116
           G YSG   PPMFGDFEAQRHWMEITQ+LPIS+WY+FDL+YWGLDYPPLTA+HSY+ G IG
Sbjct: 90  GPYSGFNTPPMFGDFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIG 149

Query: 117 SFLNKSWFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIG 176
           SF   +WF L DSRGYE +  DLKT+MR TV+ SE + YIP V+YFTKW+G+ R QS IG
Sbjct: 150 SFFQPNWFTLGDSRGYEGQ--DLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIG 207

Query: 177 QYIAAAAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQM 236
           Q+IA AAILFQPSL+LIDHGHFQ+NSVMLGLTVY +NNLLDEFYA AA+CFVLSICFKQM
Sbjct: 208 QFIAVAAILFQPSLILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQM 267

Query: 237 ALYYAPIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGG---GLRNVI 293
           ALYY+PIFF YLL +SLF  + FNI RF +I+ +T+  F SM+ P+Y FGG   G+ N++
Sbjct: 268 ALYYSPIFFAYLLSKSLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLL 327

Query: 294 QSVHRIFPFARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTIL 353
           QS+ RIFPFARG+FEDKVANFWCVTN+  KYK  +TQ++LQLYSLI T++ FLPA++ IL
Sbjct: 328 QSIKRIFPFARGIFEDKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVIL 387

Query: 354 FYPKKHLLPYALAACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSFVSWVNNVG 413
            YP+K+LL YAL+ACSMSFYLFSFQVHEK            YTSTD NVLS VSW+NN+G
Sbjct: 388 LYPRKYLLLYALSACSMSFYLFSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIG 447

Query: 414 LFTLWPLLKKDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRS 473
           LFTLWPLLKKDGL+LQY VC  LSNWLIGNFSFITP+FLPK+LTPGP +    + Y R +
Sbjct: 448 LFTLWPLLKKDGLSLQYWVCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPT 507

Query: 474 LLPHNILWKIIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYY 533
           LLP N +WK+IIV SY++M +IH  + F+ PP  YPD+WV++NC LGFGCFVLFWLWNYY
Sbjct: 508 LLPSNWIWKVIIVLSYVMMGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYY 567

Query: 534 KIFTLANKTLQYL 546
           K+F++  K +  L
Sbjct: 568 KLFSMTKKNIHQL 580

>KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 536

 Score =  760 bits (1963), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/529 (67%), Positives = 431/529 (81%), Gaps = 4/529 (0%)

Query: 15  EESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYSGMGNPPMFGDFEAQ 74
           +ESFFASPLYDFLSPFRPV+NQ+  EY+IVIFAL++RCA+GLGS+SG    PM GDFEAQ
Sbjct: 9   KESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPMHGDFEAQ 68

Query: 75  RHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNKSWFALNDSRGYES 134
           RHWME+T +LP+S+WY+FDL+YWGLDYPPLTAYHSY LG +GS LN  WFAL  SRG  +
Sbjct: 69  RHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGSSRG--N 126

Query: 135 ENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAAAILFQPSLMLID 194
           E  +LK YMR TVI+SE   YIP V+YFTKW G  R+QS IGQYIAAAAILFQPSL+LID
Sbjct: 127 ETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLILID 186

Query: 195 HGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAPIFFGYLLGRSLF 254
           HGHFQYNSVMLGLTVYAINNLLD F+ PAA+CF+LS+CFKQMAL+Y+PIFF YLL RSLF
Sbjct: 187 HGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLSRSLF 246

Query: 255 SRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSVHRIFPFARGLFEDKVANF 314
           S  F   SRF+S+A+STV  F  M++PLYVFGG ++NV+QS+HRIFPF+RG+FEDKVANF
Sbjct: 247 SPSF-KFSRFMSVALSTVITFCLMFSPLYVFGG-MKNVLQSIHRIFPFSRGIFEDKVANF 304

Query: 315 WCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHLLPYALAACSMSFYL 374
           WCV+N+ +KY   +TQ +LQ  S  AT  GFLP+   ++ YPKKH++PY LAACSM+F+L
Sbjct: 305 WCVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSMAFFL 364

Query: 375 FSFQVHEKXXXXXXXXXXXXYTSTDWNVLSFVSWVNNVGLFTLWPLLKKDGLTLQYGVCF 434
           F FQVHEK            + STDWNVL+ VSW+NNV LFTLWPLLKKD L LQYG+  
Sbjct: 365 FGFQVHEKSILVPLLPISLLFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQYGIMM 424

Query: 435 FLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNILWKIIIVSSYIVMLL 494
            LSNWLIGNFSF+TP+FLP  +TPGP + N  +TY RRS LP+NI+WKI+I++SYIVM +
Sbjct: 425 LLSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYIVMAV 484

Query: 495 IHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLANKTL 543
           IH+ ++FV PP + PD+WVLMNC LGF CF +FWLWN YK+FT+ NK++
Sbjct: 485 IHILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSI 533

>Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON}
           similar to Ashbya gossypii ACR004W
          Length = 549

 Score =  756 bits (1952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/546 (65%), Positives = 428/546 (78%), Gaps = 4/546 (0%)

Query: 1   MASKKKISRINKPVEESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYS 60
           +AS+K        VEESFFASPLYDFL P RPV+NQW  +YII+IFALIVR A+GLG YS
Sbjct: 8   VASEKGQDTRRSCVEESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVGLGGYS 67

Query: 61  GMGNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLN 120
           G G  P+FGDFEAQRHWMEIT  LPIS+WYF+DLEYWGLDYPPLTAYHSY+LG +GSF+N
Sbjct: 68  GKGKGPLFGDFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVN 127

Query: 121 KSWFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIA 180
            +WF LN SRG+ES   DLK++MR TV++SE++ YIP V+YFT+W+GRHR QS IGQY+A
Sbjct: 128 ATWFKLNTSRGFESI--DLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVA 185

Query: 181 AAAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYY 240
            AAILFQPSL+LIDHGHFQYN VMLGL VY INNLLDEFY  AA+CFVLS+ FKQMALYY
Sbjct: 186 CAAILFQPSLILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYY 245

Query: 241 APIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSVHRIF 300
           +P+ F YL  RS +  +F N  RF  IAI+T+  F ++YAPL +FG   RN+IQSV+R+F
Sbjct: 246 SPVIFAYLFSRSAYYPRF-NFPRFAGIAIATLLTFGALYAPLCLFGD-FRNIIQSVYRVF 303

Query: 301 PFARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHL 360
           PF+RG+FEDKVANFWCVTN+ IKY+ LYTQK+LQ Y L+ T +   PA + I  YPKK L
Sbjct: 304 PFSRGIFEDKVANFWCVTNVIIKYRELYTQKQLQFYCLLTTAIAQFPAFIIIFLYPKKFL 363

Query: 361 LPYALAACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSFVSWVNNVGLFTLWPL 420
           LPYALAACSM+F+LFSFQVHEK            + ST+W+VLS V+W+NNV LFTLWPL
Sbjct: 364 LPYALAACSMAFFLFSFQVHEKTILVPLLPITLLHISTNWDVLSMVAWINNVALFTLWPL 423

Query: 421 LKKDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNIL 480
           LKKDGL LQY + F LSNWL+GNFSF+TP FLPK LTPGP V +  D Y RRSLLP NI 
Sbjct: 424 LKKDGLLLQYAIMFLLSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIF 483

Query: 481 WKIIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLAN 540
           W+IIIVSSY+ M  IHL +++V PP  YPDIWVL  C LGF CF  FWLWNYY+++ + N
Sbjct: 484 WRIIIVSSYVCMAFIHLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRN 543

Query: 541 KTLQYL 546
            +L  L
Sbjct: 544 SSLNEL 549

>Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {ON}
           YOR002W (ALG6) - glucosyltransferase [contig 185] FULL
          Length = 536

 Score =  751 bits (1939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/542 (66%), Positives = 432/542 (79%), Gaps = 9/542 (1%)

Query: 3   SKKKISRINKPVEESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYSGM 62
           + KK+S+      E FFASPLYDFLSPFRPV+NQ+  EY+IVIFAL++RCA+GLGS+SG 
Sbjct: 2   AGKKVSK-----NEPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGE 56

Query: 63  GNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNKS 122
            + P+ GDFEAQRHWME+T HLP+S+WY++DL+YWGLDYPPLTAYHSYVLG +GS LN  
Sbjct: 57  NSGPIHGDFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSE 116

Query: 123 WFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAA 182
           WFAL  SRG E  N D+K YMR TVI+SE   YIP V+YFTKW G  R+QS IGQYIAAA
Sbjct: 117 WFALLSSRGIE--NPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAA 174

Query: 183 AILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAP 242
           AILFQPSL+LIDHGHFQYNSVMLGLTVY+INNLLD +Y PAA+CFVLS+CFKQMALYY+P
Sbjct: 175 AILFQPSLILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSP 234

Query: 243 IFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSVHRIFPF 302
           +FF YLL   L S    N+ RFLS+A STV +F  +++PLYVFGG  +NV+QS+HRIFPF
Sbjct: 235 VFFAYLLSECLISPSL-NVPRFLSVAFSTVISFCIIFSPLYVFGGT-KNVLQSIHRIFPF 292

Query: 303 ARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHLLP 362
           +RG+FEDKVANFWCV+N+  KY   YTQ+ELQ +S+IAT  GFLP+ + +L YPKKH++P
Sbjct: 293 SRGIFEDKVANFWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIP 352

Query: 363 YALAACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSFVSWVNNVGLFTLWPLLK 422
           +ALAACSM+F+LFSFQVHEK            Y STDWNVLS VSW+NNV LFTLWPLLK
Sbjct: 353 FALAACSMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLK 412

Query: 423 KDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNILWK 482
           KD LTLQYG+   LSNWLIGNFSF+TP+FLPK +TPGP +    +TY RRS LP N  WK
Sbjct: 413 KDHLTLQYGILMLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWK 472

Query: 483 IIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLANKT 542
           +IIV+SY++M  IH+ + FV  P   PD+WVL+NC LGF CF +FWLW +YK+FT+ N  
Sbjct: 473 LIIVASYLIMAAIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTN 532

Query: 543 LQ 544
           LQ
Sbjct: 533 LQ 534

>ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR002W (ALG6)
          Length = 563

 Score =  739 bits (1909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/546 (64%), Positives = 427/546 (78%), Gaps = 5/546 (0%)

Query: 2   ASKKKISRINKP-VEESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYS 60
             K   +   KP ++E+FFASPLYDFL P RPV+NQW  +YIIVIFALI+R A+GLG YS
Sbjct: 22  GQKGIATDAKKPGLKEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGLGGYS 81

Query: 61  GMGNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLN 120
           GMG PPMFGDFEAQRHWME+TQH+P+SKWYF  L+YWGLDYPPLTAYHSY+LG +GS+++
Sbjct: 82  GMGKPPMFGDFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYIS 141

Query: 121 KSWFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIA 180
             WF+L+ SRGYESE  DLK+YMR TVI+SE+ FYIP V+YFT+W+GR RQQS IGQYIA
Sbjct: 142 PEWFSLHASRGYESE--DLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIA 199

Query: 181 AAAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYY 240
            AAILFQP+L+LIDHGHFQYN VMLGLTV AINNLLD++YA AA+ FV S+ FKQMALYY
Sbjct: 200 GAAILFQPALILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYY 259

Query: 241 APIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSVHRIF 300
           AP+ F YLL RS++  +  NI RF+++A++T+ AF  +YAPLY+ G  +  + QS+HR+F
Sbjct: 260 APVMFVYLLSRSIYYPRL-NIPRFVAVAVATLIAFGVLYAPLYLLGN-ISAIFQSIHRVF 317

Query: 301 PFARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHL 360
           PF RGLFEDKVANFWCVTN+ +KYK  YT  +L+ +SL+ T    LP+++    YPKK +
Sbjct: 318 PFERGLFEDKVANFWCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKFM 377

Query: 361 LPYALAACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSFVSWVNNVGLFTLWPL 420
           LPYALAACSMSF+LF FQVHEK            YTSTDWNVLS V+W+NN+ LFTLWPL
Sbjct: 378 LPYALAACSMSFFLFGFQVHEKTILVPLLPITLLYTSTDWNVLSMVAWINNIALFTLWPL 437

Query: 421 LKKDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNIL 480
           LKKDGL+LQY + F LSNWLIGNFSFITP FLPK+LTPGP V +  D Y RRSLLP NI+
Sbjct: 438 LKKDGLSLQYAIMFLLSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNII 497

Query: 481 WKIIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLAN 540
           W+IIIV SYI +  IH+ E++  P    PDIWVL NC +G   F LFW+WN YK+F + N
Sbjct: 498 WRIIIVVSYICVGAIHIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMRN 557

Query: 541 KTLQYL 546
            T+  L
Sbjct: 558 STISDL 563

>TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON}
           Anc_5.669 YOR067C
          Length = 546

 Score =  119 bits (299), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 107/416 (25%), Positives = 180/416 (43%), Gaps = 53/416 (12%)

Query: 70  DFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNKSWFALNDS 129
           DF+  R+W+ IT  LP+ +WY+ +   W LDYPP  AY  + L        K    L+  
Sbjct: 43  DFDVHRNWLAITNKLPLREWYYENTSQWTLDYPPFFAYFEWFLSQFVPKFVKEDGCLDIL 102

Query: 130 RGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAAAILFQPS 189
              E   + +  + R TVIISEI+ ++   ++        + QS    ++ A++I+  P 
Sbjct: 103 PEGEFGWSTI-VFQRLTVIISEILLFVVLQVFINNSGSNEKTQS----FVVASSIILSPG 157

Query: 190 LMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAPIFFGYLL 249
            ++IDH HFQYN  + G+ + +I    ++ Y    + + +++CFK + LY AP +F +LL
Sbjct: 158 FLMIDHIHFQYNGFLFGILIASIVAAKNKRYLLCGLFYSIALCFKHIFLYLAPCYFVFLL 217

Query: 250 GRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYV------FGGGLRNVIQSVHRIFPFA 303
              + + + F    +  + +   +        + V      FG   R++ Q + R+FPF+
Sbjct: 218 RAYVLNFQDFKFKSYKDLILVVQWGNLMKLGGIVVCVMGVCFGPFWRDMNQLLSRLFPFS 277

Query: 304 RGL--------------FEDKVANFWCVTNIFIKYKILYTQKELQLY------------- 336
           RGL              F DK+ +   V   F K+  L   +E + +             
Sbjct: 278 RGLTHAYWAPNFWAIYSFVDKMLSILFVRVPFNKFINLDKIEERKRWNNGSRGLVEDVFF 337

Query: 337 ----------SLIATVVGFLPAVVTILFYPKKHLLPYALAACSMSFYLFSFQVHEKXXXX 386
                     + + T+   + AVV +LF P       +L  C  + +LF + VHEK    
Sbjct: 338 VILPQIQPNLTFVLTLFYQVLAVVPVLFDPSFKRFIGSLTLCGFASFLFGWHVHEKAILL 397

Query: 387 XXXXXXXXYTSTDWNVLSFVSWVNNVGLFTLWPLL-KKDGLTLQYGVCFFLSNWLI 441
                       D  +LS    V + G  +L+PLL K     L+   C +L  W I
Sbjct: 398 VIIPFSFL-VVCDRRLLSSFMLVGSAGYVSLFPLLFKGQDFLLK---CLYLIVWCI 449

>TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {ON}
           Anc_5.669 YOR067C
          Length = 575

 Score =  118 bits (296), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 113/432 (26%), Positives = 185/432 (42%), Gaps = 77/432 (17%)

Query: 70  DFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNKSWFALNDS 129
           DF+  R+W+ IT +LPISKWY+ +   W LDYPP  AY  +VL      + K+   L+  
Sbjct: 64  DFDVHRNWLAITSNLPISKWYYENTSEWTLDYPPFFAYFEWVLSRFAPEIVKNDGCLDIV 123

Query: 130 RGYESENNDLKT--YMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAAAILFQ 187
              E     L T  + R TVIISEI+ +     Y      + R Q     ++ A++I+  
Sbjct: 124 ---EVGQFGLPTIVFQRLTVIISEILLFAVLQYYINTSNSKERGQC----FVVASSIVLS 176

Query: 188 PSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAPIFFGY 247
           P  ++IDH HFQYN  +  + + +I     + Y   A+ + +S+CFK + LY AP +F +
Sbjct: 177 PGFLIIDHIHFQYNGFLFAIFIASIVAAKQKKYLACAVFYSISLCFKHIFLYLAPCYFVF 236

Query: 248 LLGRSLFSRKFFNISRFLS----IAISTVFAFFSMYAPLYV--FGGGLRNVIQSVHRIFP 301
           LL   + + + F    ++     I    +F    + + ++   F   +  + Q + R+FP
Sbjct: 237 LLRAYVLNFENFKFKSYMDLQSVIQWKRLFKLAGIVSGIFTICFAPFIFQLPQVLSRLFP 296

Query: 302 FARGLFEDKVA-NFWCVTN------IFIKYKILYTQK----------------ELQ---- 334
           F+RGL     A NFW + +       F+  +  Y  K                E++    
Sbjct: 297 FSRGLTHAYWAPNFWAMYSFIDKVLTFVMLRFPYVHKLMLSFTSSPILPKTAAEIRERMA 356

Query: 335 ---------------------------LYSLIATVVGFLPAVVTILFYPKKHLLPYALAA 367
                                      L +L   ++  +P    +LF P       +L  
Sbjct: 357 QNNNGTKGLVQDYFFVILPQITPKLTFLLTLFYQILAVIP----LLFDPSYKRFIGSLTL 412

Query: 368 CSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSFVSWVNNVGLFTLWPLLKKDG-- 425
           C M+ YLF + VHEK              S    ++SF+  V   G  +L+PLL ++   
Sbjct: 413 CGMASYLFGWHVHEKAIMLVIIPFSFLVVSDRRLLISFM-LVTAAGYVSLFPLLFENQDF 471

Query: 426 -LTLQYGVCFFL 436
            L + Y  C+F+
Sbjct: 472 LLKILYTFCWFI 483

>NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score =  115 bits (289), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 111/417 (26%), Positives = 182/417 (43%), Gaps = 71/417 (17%)

Query: 70  DFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNKSWFALN-- 127
           DF+  R+W+ IT  LP+ +WY+     W LDYPP  AY  + +      + +    L+  
Sbjct: 54  DFDVHRNWLAITNKLPLKEWYYEHTSQWTLDYPPFFAYFEWFMSQFVPKVVRDDGCLDIV 113

Query: 128 --DSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAAAIL 185
                G+ +       + RT+VIISEI+ ++    +  K     R QS    +I A +I+
Sbjct: 114 PVGQFGWATV-----VFQRTSVIISEILLFVVLQWFINKSKDNERTQS----FIVATSII 164

Query: 186 FQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAPIFF 245
             P  ++IDH HFQYN  +  + + +I     E Y    + + +++CFK + LY AP +F
Sbjct: 165 LSPGFLIIDHIHFQYNGFLFAILIASIVAAKQERYLLCGLFYSIALCFKHIFLYLAPCYF 224

Query: 246 GYLLGRSLFSRKFFNISRF----LSIAISTVFAFFSMYAPLY--VFGGGLRNVIQSVHRI 299
            +LL   + + K F    +    L I  + +F    +   ++   F   + ++ Q   R+
Sbjct: 225 VFLLRAYVLNVKNFKFKSYKDLILLIQWNNLFKLGGIVLSIFGICFLPFIYHLPQVFTRL 284

Query: 300 FPFARGLFEDKVA-NFWCV--------TNIFIK----YKIL----------YTQKELQ-- 334
           FPF RGL     A NFW +        T + +K    +K+L           T++E+Q  
Sbjct: 285 FPFGRGLTHAYWAPNFWAIYSFTDKIATTLLLKLPYVHKLLCKCIKHPLFPTTREEIQSR 344

Query: 335 ---------------LYSLIA---------TVVGF--LPAVVTILFYPKKHLLPYALAAC 368
                          +Y +I           + GF  L AVV +LF P       +L  C
Sbjct: 345 IMEYGNNGSKGLVEDVYFIILPQIIPKLSFILTGFYQLLAVVPLLFDPSFKRFIGSLTLC 404

Query: 369 SMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSFVSWVNNVGLFTLWPLLKKDG 425
            M+ +LF + VHEK                D  +L+    V++ G  +L+PLL K+ 
Sbjct: 405 GMASFLFGWHVHEKAILLVIIPFSFL-VVCDRRLLTSFMLVSSAGYVSLFPLLYKND 460

>Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {ON}
           YOR067C (ALG8) - glycosyl transferase [contig 126] FULL
          Length = 555

 Score =  115 bits (287), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 109/410 (26%), Positives = 175/410 (42%), Gaps = 62/410 (15%)

Query: 70  DFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNKSWFALNDS 129
           DF+  R+W+ IT  LP+ +WYF +   W LDYPP  AY  + L  +   + +    L+  
Sbjct: 44  DFDVHRNWLAITNKLPLKQWYFENTSQWTLDYPPFFAYFEWALSQLVPNIVRQDGCLDIV 103

Query: 130 RGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAAAILFQPS 189
           +  +     +  + R TVI SEI+ ++   +Y  K     R       ++ A++I+  P 
Sbjct: 104 KVGQFGMPTI-VFQRLTVIASEILLFVVLQVYINKSHISERS----ANFVVASSIVLSPG 158

Query: 190 LMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAPIFFGYLL 249
            ++IDH HFQYN  +  + + +I    ++ Y    + F ++ICFK + LY AP FF +LL
Sbjct: 159 FLIIDHIHFQYNGFLFAILIASIVAAKEQRYLLCGLFFSIAICFKHIFLYLAPSFFVFLL 218

Query: 250 GRSLFSRKFFNISRFLS-IAISTVFAFFSM-YAPLYVFGGGLRNVI----QSVHRIFPFA 303
              +     F+   +   I+I      F +    L VFG      I    Q + R+FPF+
Sbjct: 219 RVYVLDFSNFHFKSYNDLISIVQWRNLFKLGSVVLCVFGVCFAPFISQWPQLLSRLFPFS 278

Query: 304 RGLFEDKVA-NFWCVTNIFIK------YKILYTQKELQLY---SLIATVVG--------- 344
           RGL     A NFW + ++  K       K+ Y  K L  +    LI   +G         
Sbjct: 279 RGLTHAYWAPNFWAMYSLLDKVLTLIILKVPYVHKFLTQFIAPPLIPATIGEIKQKLLQY 338

Query: 345 --------------FLP-----------------AVVTILFYPKKHLLPYALAACSMSFY 373
                          LP                 A++ +LF P       +L  C  + +
Sbjct: 339 NVGTKGLVQDVYFVILPQIQPRLTFILTLFYQILAIIPVLFSPSFKRFVGSLTLCGFASF 398

Query: 374 LFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSFVSWVNNVGLFTLWPLLKK 423
           LF + VHEK             TS D  +L+  + + + G  +L+PLL +
Sbjct: 399 LFGWHVHEKAIMLIIIPFSFLVTS-DRRLLTPFNLLASAGYVSLFPLLHE 447

>Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa]
           {ON} complement(205615..207480) [1866 nt, 622 aa]
          Length = 621

 Score =  112 bits (279), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 83/265 (31%), Positives = 124/265 (46%), Gaps = 32/265 (12%)

Query: 70  DFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNKSWFALNDS 129
           DF+  R+WM IT  LPISKWYF +   W LDYPP  AY  + L     F+ K     +D 
Sbjct: 109 DFDVHRNWMAITNALPISKWYFENTSQWTLDYPPFFAYFEWFLS---QFVPK--IVRDDG 163

Query: 130 RGYESENNDLK----TYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAAAIL 185
                E          + R TVIISEI  +     Y        R QS    ++ A++I+
Sbjct: 164 CLDIVEVGQFGWPTVVFQRLTVIISEICLFAVLQYYINTSNLNERTQS----FVVASSIV 219

Query: 186 FQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAPIFF 245
             P  +++DH HFQYN+ +  + + +I     + Y   A+ + +++CFK + LY AP +F
Sbjct: 220 LSPGFLIVDHIHFQYNAFLFSILIASIVAAKQKKYIACAVFYTIALCFKHIFLYLAPCYF 279

Query: 246 GYLLGRSLFSRKFFNIS------------RFLSIAISTVFAFFSMYAPLYVFGGGLRNVI 293
            +LL   + + K F               R L +  S V   F +    ++F      + 
Sbjct: 280 VFLLRAYVLNFKDFKFKSYKDLIFIVQWRRLLKLG-SIVLGIFGICFAPFIF-----QMP 333

Query: 294 QSVHRIFPFARGLFEDKVA-NFWCV 317
           Q + R+FPF+RGL     A NFW +
Sbjct: 334 QVLSRLFPFSRGLTHAYWAPNFWAI 358

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 1/77 (1%)

Query: 348 AVVTILFYPKKHLLPYALAACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSFVS 407
           AV+ +LF P       +L  C ++ YLF + VHEK                D  +LS   
Sbjct: 438 AVIPVLFNPSFKRFIGSLTLCGLASYLFGWHVHEKAILLVIIPFSFLVV-CDRRLLSSFM 496

Query: 408 WVNNVGLFTLWPLLKKD 424
            V + G  +L+PLL ++
Sbjct: 497 LVASAGYVSLFPLLYEN 513

>YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON}
           ALG8Glucosyl transferase, involved in N-linked
           glycosylation; adds glucose to the dolichol-linked
           oligosaccharide precursor prior to transfer to protein
           during lipid-linked oligosaccharide biosynthesis;
           similar to Alg6p
          Length = 577

 Score =  111 bits (277), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 82/263 (31%), Positives = 122/263 (46%), Gaps = 28/263 (10%)

Query: 70  DFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNKSWFALNDS 129
           DF+  R+W+ IT  LPIS+WY+     W LDYPP  AY  + L     F+ KS       
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLS---QFVPKSVRDDGCL 122

Query: 130 RGYESENNDLKT--YMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAAAILFQ 187
              E     L T  + R TVI SEI+ ++   IY        R QS    ++ A++I+  
Sbjct: 123 DIVEIGKFGLPTIVFQRLTVIFSEILLFVILQIYINTTKLSERSQS----FVVASSIVLS 178

Query: 188 PSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAPIFFGY 247
           P  ++IDH HFQYN  +  + + +I    ++ Y   A+ +  +ICFK + LY AP +F +
Sbjct: 179 PGFLIIDHIHFQYNGFLFAILIGSIVAAKNKRYILCAVLYTTAICFKHIFLYLAPCYFVF 238

Query: 248 LLGRSLFSRKFFNISRF------------LSIAISTVFAFFSMYAPLYVFGGGLRNVIQS 295
           LL   + +   F    +            L +A   V  F   + P          + Q 
Sbjct: 239 LLRAYVLNVNNFKFKSYKDFLFLIRWANLLKLATVVVGIFTICFLPF------AHQMPQV 292

Query: 296 VHRIFPFARGLFEDKVA-NFWCV 317
           + R+FPF+RGL     A NFW +
Sbjct: 293 LSRLFPFSRGLTHAYWAPNFWAL 315

>KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 555

 Score =  110 bits (276), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 107/418 (25%), Positives = 166/418 (39%), Gaps = 78/418 (18%)

Query: 70  DFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNKSWFALNDS 129
           DF+  R+W+ IT  LP+ KWY+     W LDYPP  AY  ++L        +    L D 
Sbjct: 44  DFDVHRNWLAITNKLPLHKWYYESTSQWTLDYPPFFAYFEWLLSQFVPQRVQDDGCL-DI 102

Query: 130 RGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAAAILFQPS 189
                       + R TVI+SEI+ ++   +Y  K     R       ++ A++I+  P 
Sbjct: 103 VAVGQFGLPTIVFQRVTVIVSEILLFVVLQVYINKSHISDRS----ANFVVASSIVLSPG 158

Query: 190 LMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAPIFFGYLL 249
            ++IDH HFQYN  +  + + +I     + Y      F  ++CFK + LY AP FF +LL
Sbjct: 159 FLIIDHIHFQYNGFLFAILIASIVAAKHQRYLLCGFFFSTALCFKHIFLYLAPSFFAFLL 218

Query: 250 GRSLFSRKFFNISRF--------------LSIAISTVFAFFSMYAPLYVFGGGLRNVIQS 295
              +     F    +              L   + +VFA          F   +  + Q 
Sbjct: 219 RVYILDFSNFRFRTYNDLISMVRWKNLFKLGTVVLSVFA--------VCFAPFIYQLPQL 270

Query: 296 VHRIFPFARGLFEDKVA-NFWCVTNIFIKY------KILYTQK----------------- 331
           + R+FPF+RGL     A NFW + +   K       K+ Y  K                 
Sbjct: 271 MSRLFPFSRGLTHAYWAPNFWALYSALDKVLTLFFLKVPYVHKFLTQVVSPPLIPVTIDE 330

Query: 332 ---ELQLYSL-----------------------IATVVGFLPAVVTILFYPKKHLLPYAL 365
              +LQ Y++                       I T+   + AV+ +LF P       +L
Sbjct: 331 IKTKLQQYNVGTKGLVQDVYFVILPQIQPKLTFILTLFYQILAVIPVLFSPSFERFVGSL 390

Query: 366 AACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSFVSWVNNVGLFTLWPLLKK 423
             C  + +LF + VHEK             T TD  +L+    V + G  +L+PLL +
Sbjct: 391 TLCGFASFLFGWHVHEKAVLLIIIPFSFLVT-TDRRLLTPFHLVASAGYVSLFPLLHE 447

>Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  110 bits (275), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 82/263 (31%), Positives = 120/263 (45%), Gaps = 28/263 (10%)

Query: 70  DFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNKSWFALNDS 129
           DF+  R+W+ IT  LPIS+WY+     W LDYPP  AY  + L     F+ K        
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLS---QFVPKVVRDDGCL 122

Query: 130 RGYESENNDLKT--YMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAAAILFQ 187
              E     L T  + R TVI SEI+ Y    IY        R QS    ++ A++I+  
Sbjct: 123 DIVEVGKFGLPTIVFQRLTVIFSEILLYAVLQIYINTTKLSERSQS----FVVASSIVLS 178

Query: 188 PSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAPIFFGY 247
           P  ++IDH HFQYN  +  + + +I    ++ Y   A  +  +ICFK + LY AP +F +
Sbjct: 179 PGFLMIDHIHFQYNGFLFAILIGSIVAAKNKKYLLCAFLYTTAICFKHIFLYLAPCYFVF 238

Query: 248 LLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVI------------QS 295
           LL   + +   F    +        F F   +A L+  G  +  +             Q 
Sbjct: 239 LLRAYVLNVNNFKFKSYKD------FLFLIRWANLFKLGSIVIGIFTICFVPFAHQMPQV 292

Query: 296 VHRIFPFARGLFEDKVA-NFWCV 317
           + R+FPF+RGL     A NFW +
Sbjct: 293 LSRLFPFSRGLTHAYWAPNFWAL 315

>ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {ON}
           highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 556

 Score =  110 bits (274), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 74/268 (27%), Positives = 128/268 (47%), Gaps = 26/268 (9%)

Query: 70  DFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLG--VIGSFLNKSWFALN 127
           DF+  R+W+ IT +LP+ +WY+     W LDYPP  AY  + L   V G+        + 
Sbjct: 45  DFDVHRNWLAITHNLPLRQWYYEATSQWTLDYPPFFAYFEWFLSQFVPGTVKQDGCLEIV 104

Query: 128 DSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAAAILFQ 187
           D   +         + R+TVI+SEI+ ++   ++        R QS    ++ A++I+  
Sbjct: 105 DKGQFGWST---LVFQRSTVILSEILLFVVLQVFINTSSVTERTQS----FVIASSIVLS 157

Query: 188 PSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAPIFFGY 247
           P+ +++DH HFQYN  +  + + +I       Y   A  + +++CFK + LY AP +F +
Sbjct: 158 PAFLIVDHIHFQYNGFLFAILIASIVAAKRGKYLWCATFYSVALCFKHIFLYLAPCYFVF 217

Query: 248 LLGRSLFSRKFFNISRFLSIAI-----------STVFAFFSMYAPLYVFGGGLRNVIQSV 296
           LL     + + F    +  +             S V   F++      FG  ++++ Q +
Sbjct: 218 LLRAYCLNFQDFKFKSYKDLIFIVKWRHLFQLGSIVIGVFAL-----CFGPFVKDLPQVL 272

Query: 297 HRIFPFARGLFEDKVA-NFWCVTNIFIK 323
            R+FPF+RGL     A NFW + +   K
Sbjct: 273 TRLFPFSRGLTHAYWAPNFWALYSFLDK 300

>NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score =  110 bits (274), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 105/421 (24%), Positives = 175/421 (41%), Gaps = 82/421 (19%)

Query: 70  DFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNKSWFALNDS 129
           DF+  R+W+ +T  LP+ +WY+     W LDYPP  AY  +++      + +    L+  
Sbjct: 56  DFDVHRNWLAVTNKLPLKQWYYEHTSQWTLDYPPFFAYFEWIISQFVPQVVRDDGCLDIV 115

Query: 130 R-GYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAAAILFQP 188
             G   E   +  + R +VI SEI+ ++    +      + R QS    +I A +I+  P
Sbjct: 116 EIGKFGEPTVI--FQRLSVITSEILLFVVLQWFINTSNVKERTQS----FIVATSIILSP 169

Query: 189 SLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAPIFFGYL 248
             +++DH HFQYN  +  + + +I     + Y   A+ +  ++CFK + LY AP +F +L
Sbjct: 170 GFLIVDHIHFQYNGFLFSILIASIVAAKQKRYILCAVFYTTALCFKHIFLYLAPCYFVFL 229

Query: 249 LGRSLFSRKFF---------------NISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVI 293
           L   + + K F               N+ R   + +S V            FG  + ++ 
Sbjct: 230 LRAYVLNVKGFQFKSYKDLVRLVQWTNLFRLAGVVLSIVGV---------CFGPFIFDMP 280

Query: 294 QSVHRIFPFARGLFEDKVA-NFWCV--------TNIFIKYKILYTQ-------------- 330
           Q + R+FPF+RGL     A NFW +        T + +K   ++T               
Sbjct: 281 QLLTRLFPFSRGLTHAYWAPNFWAIYSFTDKVLTTLMLKLPYVHTLATRFISAPFFPATI 340

Query: 331 KELQ---------------------------LYSLIATVVGFLPAVVTILFYPKKHLLPY 363
           KE+Q                             + I T+   L AV+ +LF P       
Sbjct: 341 KEIQKRLSEDNNGTKGLVQDVYFIVLPQIVPKLTFILTLFYQLLAVIPLLFDPSFKRFIG 400

Query: 364 ALAACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSFVSWVNNVGLFTLWPLLKK 423
           +L  C M+ YLF + VHEK                D  +LS     ++ G  +L+PLL +
Sbjct: 401 SLTLCGMASYLFGWHVHEKAIMLVIIPFSFLVVC-DRRLLSSFMLASSAGYVSLFPLLYE 459

Query: 424 D 424
           +
Sbjct: 460 N 460

>CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa]
           {ON} similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067c ALG8 Glucosyltransferase
          Length = 550

 Score =  109 bits (273), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 107/414 (25%), Positives = 170/414 (41%), Gaps = 74/414 (17%)

Query: 70  DFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNKSWFALNDS 129
           DF+  R+W+ IT  LP+ +WY+     W LDYPP  AY  + L        KS   L D 
Sbjct: 36  DFDVHRNWLAITNKLPLRQWYYEHTSQWTLDYPPFFAYFEWFLSQFVPSYVKSDGCL-DI 94

Query: 130 RGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAAAILFQPS 189
                       + R TVI SEI+ ++   +Y        R QS    ++ A++I   P 
Sbjct: 95  VEVGQFGMPTVVFQRLTVIASEILLFVVLQVYINTSKVSERTQS----FVVASSIAISPG 150

Query: 190 LMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAPIFFGYLL 249
            ++IDH HFQYN  +  + + +I    ++ Y      + +++CFK + LY AP +F +LL
Sbjct: 151 FLIIDHIHFQYNGFLFAILIASIVAAKNKKYLWCGFFYSVALCFKHIYLYLAPCYFVFLL 210

Query: 250 GRSLFSRKFFNISRFLSIAI-----------STVFAFFSMYAPLYVFGGGLRNVIQSVHR 298
              + + K F    +  +             S V A F++      FG  + ++ Q + R
Sbjct: 211 RAYVLNLKDFKFKSYRDLIFIVKWRHLVKLGSVVIATFAV-----AFGPFIFDLPQLLTR 265

Query: 299 IFPFARGLFEDKVA-NFWCV--------TNIFIK-------------------------- 323
           +FPF+RGL     A NFW +        T +F+K                          
Sbjct: 266 LFPFSRGLTHAYWAPNFWAIYSTIDKILTMVFLKMPYTYKLASQFISPPLIPASLNEIKA 325

Query: 324 ----------------YKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHLLPYALAA 367
                           Y ++  Q   +L  L+  +   L AVV +LF P       ++  
Sbjct: 326 KMAANNNGSKGLVEDVYFVILPQIVPKLTFLLTLLYQVL-AVVPVLFDPSFKRFMGSMTL 384

Query: 368 CSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSFVSWVNNVGLFTLWPLL 421
           C ++ +LF + VHEK              S D  +LS    + + G  +L+PLL
Sbjct: 385 CGLASFLFGWHVHEKAIMLVIIPFSFLVIS-DRRLLSSFMLLTSAGYVSLFPLL 437

>Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  109 bits (272), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 80/263 (30%), Positives = 120/263 (45%), Gaps = 28/263 (10%)

Query: 70  DFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNKSWFALNDS 129
           DF+  R+W+ IT  LPISKWY+     W LDYPP  AY  + L     F+ K        
Sbjct: 66  DFDVHRNWLAITNKLPISKWYYEHTSQWTLDYPPFFAYFEWFLS---QFVPKVVRDDGCL 122

Query: 130 RGYESENNDLKT--YMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAAAILFQ 187
              E     L T  + R TVI S+I+ ++   +Y        R QS    ++ A++I+  
Sbjct: 123 DIVEVGKFGLPTIVFQRLTVIFSDILLFVVLQVYINTTDLSERSQS----FVVASSIVLS 178

Query: 188 PSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAPIFFGY 247
           P   +IDH HFQYN  +  + + +I     + Y   A+ +  +ICFK + LY AP +F +
Sbjct: 179 PGFFMIDHIHFQYNGFLFAILIGSIVAAKKKRYILCAILYTTAICFKHIFLYLAPCYFVF 238

Query: 248 LLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVI------------QS 295
           LL   + +   F    +        F F   +A L+  G  +  +             Q 
Sbjct: 239 LLRAYVLNVNNFKFKSYKD------FLFLIRWANLFKLGSIVIGIFTICFLPFAHQMPQV 292

Query: 296 VHRIFPFARGLFEDKVA-NFWCV 317
           + R+FPF+RGL     A NFW +
Sbjct: 293 LSRLFPFSRGLTHAYWAPNFWAL 315

>Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON}
           YOR067C (REAL)
          Length = 576

 Score =  108 bits (271), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 102/370 (27%), Positives = 157/370 (42%), Gaps = 64/370 (17%)

Query: 70  DFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNKSWFALNDS 129
           DF+  R+W+ IT  LP+S+WY+     W LDYPP  AY  + L     F+ K        
Sbjct: 66  DFDVHRNWLAITNKLPMSEWYYEHTSQWTLDYPPFFAYFEWFLS---QFVPKVVRDDGCL 122

Query: 130 RGYESENNDLKT--YMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAAAILFQ 187
              E     L T  + R TVI SEI+ +    IY        R QS    ++ A++I+  
Sbjct: 123 DIVEVGKFGLPTIVFQRLTVIFSEILLFAVLQIYINTTKLSERSQS----FVVASSIVLS 178

Query: 188 PSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAPIFFGY 247
           P  ++IDH HFQYN  +  + + +I    ++ Y   A+ +  SICFK + LY AP +F +
Sbjct: 179 PGFLMIDHIHFQYNGFLFAILIGSIVAAKNKKYLWCAVLYTTSICFKHIFLYLAPCYFVF 238

Query: 248 LLGRSLFSRKFFNISRFLS----IAISTVFAFFSMYAPLYV--FGGGLRNVIQSVHRIFP 301
           LL   + +   F    +      I  + +F   S+   ++   F      + Q + R+FP
Sbjct: 239 LLRAYVLNVNNFKFKSYKDFLFLIRWTNLFKLGSIVIGIFTICFLPFAHQMPQVLSRLFP 298

Query: 302 FARGLFEDKVA-NFWC--------VTNIFIK--YKILYTQKELQ---------------- 334
           F+RGL     A NFW         +T I +K  Y  ++  K ++                
Sbjct: 299 FSRGLTHAYWAPNFWALYSFMDKILTTIMLKLPYVHMFATKLIKPPLIPKDIKEINERLL 358

Query: 335 ----------------------LYSLIATVVGFLPAVVTILFYPKKHLLPYALAACSMSF 372
                                   + I T+   + AV+ ILF P       +L  C ++ 
Sbjct: 359 ANNGSKGLVQDVFFVILPQIPPRLTFILTIFYQILAVLPILFDPSFKRFIGSLTLCGLAS 418

Query: 373 YLFSFQVHEK 382
           YLF + VHEK
Sbjct: 419 YLFGWHVHEK 428

>TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.669
           YOR067C
          Length = 569

 Score =  108 bits (270), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 105/408 (25%), Positives = 167/408 (40%), Gaps = 62/408 (15%)

Query: 70  DFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNKSWFALNDS 129
           DF+  R+W+ IT  LP+ +WY+     W LDYPP  AY  ++L      + K   AL D 
Sbjct: 55  DFDVHRNWLAITNELPLKEWYYEKTSQWTLDYPPFFAYFEWLLSQFVPKIVKEDGAL-DI 113

Query: 130 RGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAAAILFQPS 189
                       + R TVI SE++ ++   ++        + +S    ++ A++I+  P 
Sbjct: 114 VEIGQFGWPTVVFQRLTVIFSEVLLFVVLQVFVNTSSATEKTRS----FVVASSIVLSPG 169

Query: 190 LMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAPIFFGYLL 249
            ++IDH HFQYN  +    + +I     + Y   A  + +++CFK + LY AP +F +LL
Sbjct: 170 FLMIDHIHFQYNGFLFAPLIASIVAAKHKKYMWCATFYAIALCFKHIFLYLAPCYFVFLL 229

Query: 250 GRSLFSRKFFNISRFLSIAI----STVFAFFSMYAPLY--VFGGGLRNVIQSVHRIFPFA 303
              + + K F    +  +        +F   S+   ++   FG  L ++ Q + R+FPF+
Sbjct: 230 RAYVLNFKNFEFKSYKDLIFIVQWKHLFKMASVVLGIFFICFGPFLYDLPQVMTRLFPFS 289

Query: 304 RGLFEDKVA-NFWCVTN------IFIKYKILY-------------------------TQK 331
           RGL     A NFW + +       F+  K+ Y                          Q 
Sbjct: 290 RGLTHAYWAPNFWAIYSFLDKILTFVMLKLPYVHAFATKFISPPLIPESLDDLKERLVQN 349

Query: 332 ELQLYSLIATV-VGFLP-----------------AVVTILFYPKKHLLPYALAACSMSFY 373
                 L+  V    LP                 AV+ +LF P       +L  C +S Y
Sbjct: 350 NSGTKGLVQDVFFAILPQISPKLTFILTMFYQALAVIPLLFDPSFKRFIGSLTLCGLSSY 409

Query: 374 LFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSFVSWVNNVGLFTLWPLL 421
           LF + VHEK                D  +LS    V   G  +L+PLL
Sbjct: 410 LFGWHVHEKAIMLVIVPFSFL-VVCDRRLLSSFMLVAAAGYVSLFPLL 456

>KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 561

 Score =  107 bits (266), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 85/292 (29%), Positives = 136/292 (46%), Gaps = 26/292 (8%)

Query: 70  DFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNKSWFALNDS 129
           DF+  R+W+ IT  LP++KWY      W LDYPP  AY  + L     F+ KS       
Sbjct: 52  DFDVHRNWLAITNKLPLNKWYVESTSQWTLDYPPFFAYFEWFLS---QFVPKSVAEDGCL 108

Query: 130 RGYESENNDLKT--YMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAAAILFQ 187
              +  +  L T  + R TVI+SE++ Y    ++    +           ++ A++I+  
Sbjct: 109 DIVKVGSFGLPTIIFQRITVILSELVLYAALQVF----INTSDISEKSANFVVASSIVLS 164

Query: 188 PSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAPIFFGY 247
           P L+++DH HFQYN  + G+ + +I    ++ Y   A  F +++CFK + LY AP +F +
Sbjct: 165 PGLLIVDHIHFQYNGFLFGILISSIVAAKNKRYILCAAFFSIALCFKHIFLYLAPAYFVF 224

Query: 248 LLGRSLF---SRKFFNISRFLSIA--------ISTVFAFFSMYAPLYVFGGGLRNVIQSV 296
           LL   +    S KF +    +SI          S V   FS+      F   +    Q +
Sbjct: 225 LLRAYVLDFSSFKFRSYKDLISIVQWSNLLKLASVVMGIFSL-----AFLPFITTWQQLL 279

Query: 297 HRIFPFARGLFEDKVA-NFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLP 347
            R+FPF+RGL     A N W V +   K   +   K   L  +++ V+  +P
Sbjct: 280 ARLFPFSRGLTHAYWAPNVWAVYSFTDKVLTVLVLKLPYLQKILSIVLTSMP 331

>ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR067C
           (ALG8)
          Length = 572

 Score =  107 bits (266), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 77/292 (26%), Positives = 132/292 (45%), Gaps = 34/292 (11%)

Query: 70  DFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLG--VIGSFLNKSWFALN 127
           DFE  R+W+ +T  LP+ KWY      W +DYPPL A+  + L   V G+        L 
Sbjct: 59  DFEVHRNWLAVTHRLPLRKWYVDATSQWTMDYPPLFAWLEWALSQVVPGAVRRDGCLKLV 118

Query: 128 DSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAAAILFQ 187
               Y         + R TVI SE++ Y+   +Y +    + R  +    ++   ++   
Sbjct: 119 AEGRYGWPT---VVFQRLTVIASEVLLYVVLQVYVSSSAAQERTVN----FVVTTSVALS 171

Query: 188 PSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAPIFFGY 247
           P+ +L+DH HFQYN  +  + V +I    +  Y      F +++C K + LY AP +F +
Sbjct: 172 PAFLLVDHIHFQYNGFLFAVLVASIVAARERRYVLCGALFTVALCLKHIFLYLAPAYFVF 231

Query: 248 LLG-----------RS----LFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNV 292
           LL            RS    +F+ ++ N+ R   + ++ +   F+ +A +         +
Sbjct: 232 LLRAYVLDLGEFRFRSYRDLVFAVRWGNLCRLGGVVLAIMAVTFAPFAGV---------M 282

Query: 293 IQSVHRIFPFARGLFEDKVA-NFWCVTNIFIKYKILYTQKELQLYSLIATVV 343
            Q + R+FPF+RGL     A NFW + +   K       +   +Y L  ++V
Sbjct: 283 PQLMARLFPFSRGLTHAYWAPNFWAIYSFVDKVLTFLMLRVPYVYKLATSLV 334

>KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.669
           YOR067C
          Length = 575

 Score =  104 bits (260), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 98/413 (23%), Positives = 170/413 (41%), Gaps = 64/413 (15%)

Query: 70  DFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLG-VIGSFLNKSWFALND 128
           DF+  R+W+ IT  + +  WY+     W LDYPP  AY  + +  ++ SF+ +      D
Sbjct: 64  DFDVHRNWLAITNGMHLKDWYYEHTSQWTLDYPPFFAYFEWFISHLVPSFVRRD--GCLD 121

Query: 129 SRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAAAILFQP 188
                        + R TVI SE + ++   IY        R QS    +I A++I+  P
Sbjct: 122 IVEVGQFGWPTVLFQRLTVIFSESLLFLVLQIYINTSEVEERTQS----FIVASSIVLSP 177

Query: 189 SLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAPIFFGYL 248
             +++DH HFQYN  +  + V +I    ++ Y   A+ + +++CFK + LY AP +F +L
Sbjct: 178 GFLIVDHIHFQYNGFLFAILVASIVAARNKRYLLCALFYSIALCFKHIFLYLAPCYFVFL 237

Query: 249 LGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYV------FGGGLRNVIQSVHRIFPF 302
           L   + + + F    +  +     +        + V      FG  + ++ Q + R+FPF
Sbjct: 238 LRVYVLNFENFKFRSYKDLIFLIRWKNLCQLGMIVVGVFSLCFGPFIFDMPQLLSRLFPF 297

Query: 303 ARGLFEDKVA-NFWCVTNIFIKYKILYTQKELQLYSLIATVVG--FLP------------ 347
           +RGL     A NFW + +   K   ++  +   +++  A  +    LP            
Sbjct: 298 SRGLTHAYWAPNFWALYSFLDKVLTVFALRLHYVHNFAAKFIAPSLLPSSIEEIRQRIAE 357

Query: 348 -----------------------------------AVVTILFYPKKHLLPYALAACSMSF 372
                                              AV+ +LF P       +L  C M+ 
Sbjct: 358 HNNGTKGLVQDVFFVILPQISPKLTFLLTLFYQILAVIPLLFDPSFKRFMGSLTLCGMAS 417

Query: 373 YLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSFVSWVNNVGLFTLWPLLKKDG 425
           YLF + VHEK                   ++SF + V++ G  +L+PLL ++ 
Sbjct: 418 YLFGWHVHEKAIMLVIIPFSFLVVFDRRLLISF-TLVSSAGYVSLFPLLYENA 469

>KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {ON}
           Anc_5.669 YOR067C
          Length = 568

 Score =  101 bits (252), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 73/265 (27%), Positives = 123/265 (46%), Gaps = 26/265 (9%)

Query: 70  DFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNKSWFALN-D 128
           DF+  R+W+ IT  LP+ +WY+     W LDYPP  AY  +VL        ++   L+  
Sbjct: 53  DFDVHRNWLAITNALPLREWYYEKTSQWTLDYPPFFAYFEWVLSQFVPAAVRADGCLDIV 112

Query: 129 SRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAAAILFQP 188
            +G       L  + R TVI SE++ ++   +Y        + QS    ++ A++I+  P
Sbjct: 113 PQGVFGALTVL--FQRCTVIASEVLLFVVLQVYINTSPPAEKTQS----FVVASSIVLSP 166

Query: 189 SLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAPIFFGYL 248
            L+++DH HFQYN  +  + + +I       +   A  +  ++CFK + LY AP +F +L
Sbjct: 167 MLLIVDHIHFQYNGFLFAILIASIVAARKRKFLLCAFFYSTALCFKHIFLYLAPCYFMFL 226

Query: 249 LGRSLFS---------RKFFNI---SRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSV 296
           L   +           +  F I    R   +    +      +AP        R++ Q +
Sbjct: 227 LRTYVLQFEGFRFKSYKDLFRIIHWGRLFKLGGVVLGVAVVCFAPF------ARDMPQLL 280

Query: 297 HRIFPFARGLFEDKVA-NFWCVTNI 320
            R+FPF+RGL     A NFW + ++
Sbjct: 281 SRLFPFSRGLTHAYWAPNFWALYSL 305

>SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly
           similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067C ALG8 adds glucose to the dolichol- linked
           oligosaccharide precursor prior to transfer to protein
           glycosyl transferase
          Length = 561

 Score =  101 bits (252), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 76/269 (28%), Positives = 121/269 (44%), Gaps = 28/269 (10%)

Query: 70  DFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNKSWFALNDS 129
           DF+  R+W+ IT  LP+ +WY      W LDYPP  AY  + L      + +    L+  
Sbjct: 48  DFDVHRNWLAITNKLPLREWYIEATSQWTLDYPPFFAYFEWFLSQFVPKIVRDDGCLDI- 106

Query: 130 RGYESENNDLKT--YMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAAAILFQ 187
              E  N  + T  + R TVI+SE++ ++   I+  K     +       +I A++I+  
Sbjct: 107 --VEVGNFGMPTIIFQRITVIVSEVLLFVVLQIFINKSATNEKS----ANFIVASSIVLS 160

Query: 188 PSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAPIFFGY 247
           P  +++DH HFQYN  +  + + AI       Y      F  ++CFK + LY AP FF +
Sbjct: 161 PGFLIVDHIHFQYNGFLFAILIAAIVAAKHHRYLLCGAFFATALCFKHIFLYLAPSFFVF 220

Query: 248 LLGRSLFSRKFFNI------------SRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQS 295
           LL   +     F               R L + +  +  F   +AP       +  + Q 
Sbjct: 221 LLRAYILDFTNFKFKSYKDLVSIVKWQRALKLGLVVLGIFAVCFAPF------ISEMPQL 274

Query: 296 VHRIFPFARGLFEDKVA-NFWCVTNIFIK 323
           + R+FPF+RGL     A NFW + ++  K
Sbjct: 275 LERLFPFSRGLTHAYWAPNFWALYSLLDK 303

>Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar to
           Ashbya gossypii ADR210C
          Length = 604

 Score = 99.0 bits (245), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 74/268 (27%), Positives = 121/268 (45%), Gaps = 38/268 (14%)

Query: 70  DFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNKSWFALNDS 129
           D E  R+W+ +T  LP+  WY      W LDYPP  AY  +VL      + +    L+  
Sbjct: 93  DLEVHRNWLALTNKLPLLDWYREATSQWTLDYPPFFAYFEWVLSQFVPAVVRDDGCLDIV 152

Query: 130 R----GYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAAAIL 185
           +    G+ +       ++R TVI +EI+ ++   ++    +    +      +I A++I 
Sbjct: 153 KEGKFGWPTV-----VFLRLTVIGTEILLFVVLQVF----INTSDESERTVNFIIASSIA 203

Query: 186 FQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAPIFF 245
             P  +++DH HFQYN  +  + + +I     E Y      F   +CFK + LY AP +F
Sbjct: 204 LSPGFLIVDHMHFQYNGFLFAILIASIVAAKKERYLLCGAFFTTVLCFKHIFLYLAPAYF 263

Query: 246 GYLLG--------------RSL-FSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLR 290
            +LL               R L F  ++FN+ +   I +S +   F  + P+        
Sbjct: 264 TFLLRAYVLNFSNFSFRTYRDLIFVVRWFNLLKLGVIIVSILAVCFVPFIPV-------- 315

Query: 291 NVIQSVHRIFPFARGLFEDKVA-NFWCV 317
            + Q + R+FPF+RGL     A NFW V
Sbjct: 316 -LPQLISRLFPFSRGLTHAYWAPNFWAV 342

>NDAI0E04320 Chr5 (974435..976015) [1581 bp, 526 aa] {ON} 
          Length = 526

 Score = 34.3 bits (77), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 41/99 (41%), Gaps = 21/99 (21%)

Query: 241 APIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQS----- 295
            P+ FG   G S+ +  FFNI   L +      AFFS++ P      GLR +I S     
Sbjct: 104 GPLAFGLNFGTSVLTVVFFNILGVLPV------AFFSLFGPEL----GLRQMILSRFLTG 153

Query: 296 --VHRIFPFARGLFEDKVANFWCVTNIFIKYKILYTQKE 332
               RIF     LF       WCV N  +  ++L    E
Sbjct: 154 NITGRIFS----LFNCVACVGWCVLNTIVAAQLLNMVNE 188

>TBLA0D04100 Chr4 (1017819..1019480) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 50/116 (43%), Gaps = 14/116 (12%)

Query: 217 DEFYAPAAMCFVLSICFKQMAL-YYAPIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAF 275
           D     A+M F  ++     AL    P+ FG   G S+    FFNI   LS+      AF
Sbjct: 106 DSVINAASMWFSANMVIAGYALGVLGPMVFGLNFGTSVLVIIFFNILGLLSV------AF 159

Query: 276 FSMYAPLYVFGGGLRNVIQSVHRIFPFARGLFE--DKVANF-WCVTNIFIKYKILY 328
           FS++   +    GLR +I S   I      +F   + VA   WCV N     ++L+
Sbjct: 160 FSVFGAEF----GLRQMILSRFLIGNVTSRIFAVINVVACIGWCVVNTVASAQLLH 211

>SAKL0F15136g Chr6 complement(1217419..1219491) [2073 bp, 690 aa]
           {ON} similar to uniprot|P47144 Saccharomyces cerevisiae
           YJR106W ECM27 Non-essential protein of unknown function
          Length = 690

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 55/120 (45%), Gaps = 17/120 (14%)

Query: 109 SYVLGVIGSFLNKSWFALND-SRGYESENNDLK-TYMRTTVIISEIIFYIPGVIYFTKWV 166
           S +L  +   L+K    LN  S   +S N D K   M  T I+S++ F + G++    W+
Sbjct: 449 SMILSTMVISLHKKVKDLNSFSLTSDSRNEDAKEDIMNLTKIVSKV-FILIGIVNSILWI 507

Query: 167 GRHRQQSLIGQYIAAAAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMC 226
                 SL+   +     L+Q +L +        +  +LGLT+++  N + +  A  AMC
Sbjct: 508 ------SLLANTLIEIIELYQKTLGI--------SQAILGLTIFSWGNSISDLMANVAMC 553

>Smik_5.185 Chr5 complement(270718..272211) [1494 bp, 497 aa] {ON}
           YER060W (REAL)
          Length = 497

 Score = 30.8 bits (68), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 55/126 (43%), Gaps = 21/126 (16%)

Query: 217 DEFYAPAAMCFVLSICFKQMAL-YYAPIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAF 275
           D     A+M F  ++     AL    P+ FG   G+S+F   FFNI   +S+      AF
Sbjct: 85  DSIINAASMWFSANMVIAAYALGALGPMVFGLNFGQSVFVIIFFNILGLISV------AF 138

Query: 276 FSMYAPLYVFGGGLRNVIQSVHRIFPFARGLFEDKVANFWCVTNIF--IKYKILYTQKEL 333
           FS++        GLR +I S        R L  +  A  + + N+   + + I+ T    
Sbjct: 139 FSIFGAEL----GLRQMILS--------RYLIGNVTARIFSLINVIACVGWGIVNTSVSA 186

Query: 334 QLYSLI 339
           QL +++
Sbjct: 187 QLLNMV 192

>NCAS0A13470 Chr1 complement(2651815..2653452) [1638 bp, 545 aa]
           {ON} 
          Length = 545

 Score = 30.8 bits (68), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 54/128 (42%), Gaps = 21/128 (16%)

Query: 217 DEFYAPAAMCFVLSICFKQMALY-YAPIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAF 275
           D     A+M F  ++     AL    PI F    G S+    FFNI   LSI      AF
Sbjct: 99  DSIINAASMWFSANLVIASYALGGLGPIVFNLNFGTSVLVIIFFNILGLLSI------AF 152

Query: 276 FSMYAPLYVFGGGLRNVIQSVHRIFPFARGLFEDKVANFWCVTNIF--IKYKILYTQKEL 333
           FS++   +    GLR +I S        R L  +  A  + + NI   + + ++ T    
Sbjct: 153 FSVFGAEF----GLRQMILS--------RYLLGNITARIFAIINIIACVGWGVVNTVASS 200

Query: 334 QLYSLIAT 341
           QL +++ T
Sbjct: 201 QLLNMVNT 208

>NCAS0F03850 Chr6 (772412..774649) [2238 bp, 745 aa] {ON} Anc_3.540
           YER041W
          Length = 745

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 47/110 (42%), Gaps = 10/110 (9%)

Query: 95  EYWGLDYPPLTAYHSYVLGVIG-SFLNKSWFALNDSRGYE-SENNDLKTYMRTTVIISEI 152
           E W  D   L  +H +  G +  S  N +   ++ + GY+  + N+L  Y++T       
Sbjct: 369 EDWPTDLVVLHYFHPFTAGTLNHSIFNSNHSNVSGNLGYDLIKFNELGDYLKT------- 421

Query: 153 IFYIPGVIYFTKWVGRHRQQSLIGQYIAAAAILFQPSLMLIDHGHFQYNS 202
            F +PGV +F KW      QS +  +I  +   F   L + +      N+
Sbjct: 422 -FNLPGVTHFDKWFHETMHQSFLLHFILYSKSSFDSILKITEEKELLINN 470

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.144    0.472 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,122,407
Number of extensions: 2607792
Number of successful extensions: 7057
Number of sequences better than 10.0: 59
Number of HSP's gapped: 7104
Number of HSP's successfully gapped: 75
Length of query: 546
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 431
Effective length of database: 40,294,809
Effective search space: 17367062679
Effective search space used: 17367062679
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 68 (30.8 bits)