Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1037.266.21ON34234214210.0
TPHA0J003406.21ON3383469931e-134
SAKL0E01210g6.21ON3233328761e-116
YOR007C (SGT2)6.21ON3463398441e-111
KAFR0L004106.21ON3313418401e-111
Smik_15.1766.21ON3453358291e-109
Skud_15.1686.21ON3483388291e-109
NDAI0D008106.21ON3493418221e-108
NCAS0H008306.21ON3383398131e-107
KNAG0M011706.21ON3393418091e-106
Kwal_56.224336.21ON3223348051e-106
ZYRO0C07788g6.21ON3343298011e-105
TBLA0G010506.21ON3503377961e-104
Suva_15.1826.21ON3463347891e-103
TDEL0G044806.21ON3433437771e-101
CAGL0E02739g6.21ON3433277711e-100
KLTH0C11220g6.21ON3273367492e-97
KLLA0D01155g6.21ON3353447441e-96
Ecym_30256.21ON3183397031e-90
ACR005W6.21ON3273426372e-80
Kpol_1032.86.21ON3433325531e-67
NCAS0D026706.21ON3512383806e-42
NDAI0I022406.21ON3503333735e-41
TPHA0M002706.21ON3773743554e-38
TBLA0A072706.21ON3733403196e-33
CAGL0H08195g5.617ON583942286e-20
KLTH0E02178g5.617ON593932279e-20
Kwal_55.199355.617ON593942252e-19
NDAI0F009105.617ON583952233e-19
TBLA0E033005.617ON582942223e-19
TPHA0D028805.617ON5851212206e-19
NCAS0G008105.617ON584952198e-19
YOR027W (STI1)5.617ON589942172e-18
SAKL0G07084g5.617ON585932092e-17
Skud_15.1925.617ON589952092e-17
Smik_15.2055.617ON589942083e-17
KLLA0A07062g5.617ON581932073e-17
Suva_8.805.617ON586942056e-17
Kpol_1018.695.617ON590942048e-17
Ecym_55825.617ON584942002e-16
TDEL0A048405.617ON576931993e-16
ZYRO0A05676g5.617ON572941994e-16
KNAG0B032005.617ON579951984e-16
KAFR0C058905.617ON575971976e-16
AEL224W5.617ON580941976e-16
NCAS0A00490singletonON620921763e-13
KLLA0F24046g2.152ON6041141505e-10
Ecym_44133.481ON510711434e-09
NDAI0B057903.481ON5231071417e-09
KAFR0B066103.481ON5111131362e-08
TBLA0C039503.481ON5121131353e-08
KNAG0A079003.481ON512711336e-08
AAR083C3.481ON5381481328e-08
TDEL0D055003.481ON512711311e-07
TPHA0D032203.481ON5131471301e-07
CAGL0D05060g3.481ON510711292e-07
Smik_6.2153.481ON513671292e-07
YGR123C (PPT1)3.481ON513671282e-07
SAKL0F03102g3.481ON513711282e-07
Ecym_82042.152ON597821283e-07
ABR131W2.152ON594821273e-07
Kwal_33.147672.152ON594821273e-07
Skud_7.4323.481ON513671274e-07
NCAS0F034903.481ON512971274e-07
NCAS0G024802.152ON596761256e-07
Suva_7.4083.481ON513671247e-07
NDAI0F028102.152ON609821249e-07
NCAS0B070102.152ON6251001249e-07
KLTH0B05170g2.152ON593821231e-06
Kwal_27.118908.506ON3341461193e-06
Smik_2.2958.506ON385851184e-06
KLTH0F14542g3.481ON5131491176e-06
ZYRO0G06512g2.152ON6041001168e-06
Suva_4.4058.506ON385851131e-05
Kpol_505.413.481ON513711132e-05
Skud_8.1782.152ON6381331132e-05
CAGL0L04048g2.152ON587821122e-05
NDAI0B043402.152ON664821123e-05
TDEL0B051402.152ON5991001104e-05
KAFR0F007202.152ON608671105e-05
TBLA0C055302.152ON6101001096e-05
Kwal_55.211753.481ON511841087e-05
KLLA0B10912g3.481ON5121321079e-05
Suva_15.3142.152ON644941071e-04
SAKL0E10956g2.152ON600821071e-04
KNAG0A039508.506ON386721061e-04
YBR155W (CNS1)8.506ON385851061e-04
KLLA0B09966g8.506ON3701261052e-04
CAGL0L12936g2.152ON600941052e-04
Skud_2.2828.506ON385551042e-04
YHR117W (TOM71)2.152ON639941043e-04
Kpol_1006.43.367ON7321031043e-04
Kpol_1043.605.689ON7061031043e-04
KAFR0E029808.506ON3801301024e-04
SAKL0H10934g8.506ON380881015e-04
NCAS0B024008.506ON380581015e-04
TPHA0I015102.152ON603671015e-04
KNAG0H035302.152ON614671016e-04
Smik_8.1952.152ON635941017e-04
YNL121C (TOM70)2.152ON61794990.001
CAGL0H07425g8.506ON38094980.001
ZYRO0B04224g3.481ON513107980.001
NDAI0C052908.506ON37954980.001
SAKL0A01672g6.328ON12857920.001
AGL268C8.506ON37956970.002
Kpol_1048.212.152ON59767970.002
Skud_14.2112.152ON61794960.002
CAGL0K09240g6.328ON14263910.002
NCAS0B025608.470ON57879950.003
KLTH0F18150g5.689ON68994950.003
ADR230W5.689ON68570950.003
TBLA0H033808.506ON375130940.003
Suva_14.2192.152ON61794940.004
Smik_14.2072.152ON61794940.004
Ecym_20906.328ON17288900.004
Kpol_513.28.506ON37459930.005
TDEL0B013108.506ON38055880.016
Ecym_40315.689ON688112890.017
KLTH0H14872g5.352ON623139860.034
SAKL0E14542g5.689ON69053860.039
KLTH0E11748g8.506ON37888850.040
TPHA0D038606.328ON12093810.040
Kpol_1028.516.328ON11771780.083
KNAG0I025206.328ON11779770.11
NDAI0C051308.470ON59049820.12
Kwal_27.107407.412ON62889820.13
AAR054C6.328ON13357770.13
TPHA0L014208.506ON37489810.15
CAGL0E01573g3.32ON90499810.17
Smik_4.4918.470ON61249800.22
Skud_4.5068.470ON61149800.23
NCAS0D045006.328ON12155750.24
Suva_2.4108.470ON61149790.24
Ecym_20333.32ON90996790.26
Ecym_25598.506ON37085780.31
Kwal_55.218395.689ON69097780.33
CAGL0K11209g8.470ON59050770.41
AGL294W7.412ON65691780.41
TBLA0I023106.328ON11657730.43
YDR244W (PEX5)8.470ON61248770.48
CAGL0J09570g8.470ON54981770.49
ZYRO0F08624g8.506ON37969760.55
Kpol_1018.1067.412ON75391760.62
KLTH0C06204g7.412ON62789760.63
Smik_3.1596.328ON11581710.65
TPHA0B039701.456ON39694750.75
TBLA0B086803.32ON91489760.77
KAFR0E028208.470ON56264741.0
YCR060W (TAH1)6.328ON11185701.0
NCAS0E024907.412ON80997741.0
SAKL0D11110g1.456ON43294741.1
KAFR0L018707.412ON71285741.1
TPHA0E007407.412ON74691741.2
KLLA0E20857g7.412ON71087741.2
Kpol_1031.648.470ON60754741.2
Kwal_27.117378.470ON57548731.3
AFR453W8.470ON56991731.3
NCAS0C044903.32ON91899731.5
Ecym_71427.412ON67591721.7
KLTH0E10934g8.470ON56848721.7
KAFR0J025706.328ON12156681.7
YBL084C (CDC27)7.412ON758112722.2
KLTH0F19272g3.26ON50358712.4
TBLA0A016908.470ON66249712.4
Suva_2.347.412ON76391712.6
TBLA0H019705.352ON84085712.7
CAGL0M08030g1.456ON38796702.9
Smik_2.367.412ON75191712.9
KLLA0C15455g8.470ON56688703.2
TPHA0G004305.689ON72856703.4
TDEL0B016608.470ON54949703.4
NDAI0J001307.546ON140357694.4
Ecym_13968.470ON57386694.4
KNAG0A041208.470ON60249685.3
Skud_2.247.412ON769112685.5
NDAI0F004005.689ON76457685.8
Skud_14.263.32ON93289685.9
Ecym_13661.456ON39297676.2
ZYRO0C02970g3.32ON89689686.3
NDAI0I004406.328ON12868646.4
KLLA0D09020g3.395ON53023676.5
TPHA0L012108.470ON58883686.6
CAGL0I03718g7.322ON120162687.0
SAKL0H11946g8.470ON57349677.7
Kwal_34.159775.352ON59761677.8
KLTH0F19140g3.32ON92484678.1
AEL062C1.456ON38373668.7
AEL281C7.546ON139083679.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1037.26
         (342 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...   551   0.0  
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...   387   e-134
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...   342   e-116
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...   329   e-111
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...   328   e-111
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...   323   e-109
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...   323   e-109
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...   321   e-108
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...   317   e-107
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...   316   e-106
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...   314   e-106
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...   313   e-105
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...   311   e-104
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...   308   e-103
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...   303   e-101
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...   301   e-100
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...   293   2e-97
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...   291   1e-96
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...   275   1e-90
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...   249   2e-80
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...   217   1e-67
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...   150   6e-42
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...   148   5e-41
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...   141   4e-38
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...   127   6e-33
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    92   6e-20
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    92   9e-20
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    91   2e-19
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     91   3e-19
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    90   3e-19
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    89   6e-19
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    89   8e-19
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    88   2e-18
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    85   2e-17
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    85   2e-17
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    85   3e-17
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    84   3e-17
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    84   6e-17
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    83   8e-17
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    82   2e-16
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    81   3e-16
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    81   4e-16
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    81   4e-16
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    80   6e-16
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    80   6e-16
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       72   3e-13
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...    62   5e-10
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    60   4e-09
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    59   7e-09
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    57   2e-08
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    57   3e-08
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    56   6e-08
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    55   8e-08
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    55   1e-07
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    55   1e-07
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    54   2e-07
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    54   2e-07
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    54   2e-07
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    54   2e-07
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...    54   3e-07
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...    54   3e-07
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...    54   3e-07
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    54   4e-07
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    54   4e-07
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...    53   6e-07
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    52   7e-07
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...    52   9e-07
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    52   9e-07
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...    52   1e-06
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    50   3e-06
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    50   4e-06
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    50   6e-06
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    49   8e-06
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    48   1e-05
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    48   2e-05
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...    48   2e-05
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...    48   2e-05
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...    48   3e-05
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    47   4e-05
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    47   5e-05
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...    47   6e-05
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    46   7e-05
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    46   9e-05
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...    46   1e-04
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...    46   1e-04
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    45   1e-04
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    45   1e-04
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    45   2e-04
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...    45   2e-04
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    45   2e-04
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...    45   3e-04
Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON...    45   3e-04
Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON} (1235...    45   3e-04
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    44   4e-04
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    44   5e-04
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    44   5e-04
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...    44   5e-04
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...    44   6e-04
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...    44   7e-04
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...    43   0.001
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    42   0.001
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    42   0.001
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    42   0.001
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    40   0.001
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    42   0.002
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...    42   0.002
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...    42   0.002
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    40   0.002
NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {O...    41   0.003
KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weak...    41   0.003
ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic ...    41   0.003
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    41   0.003
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...    41   0.004
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...    41   0.004
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    39   0.004
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    40   0.005
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    39   0.016
Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON} s...    39   0.017
KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]...    38   0.034
SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weak...    38   0.039
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    37   0.040
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    36   0.040
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    35   0.083
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    34   0.11 
NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON} Anc_8...    36   0.12 
Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {...    36   0.13 
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    34   0.13 
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    36   0.15 
CAGL0E01573g Chr5 complement(149084..151798) [2715 bp, 904 aa] {...    36   0.17 
Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W ...    35   0.22 
Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W ...    35   0.23 
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    33   0.24 
Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W ...    35   0.24 
Ecym_2033 Chr2 complement(51082..53811) [2730 bp, 909 aa] {ON} s...    35   0.26 
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    35   0.31 
Kwal_55.21839 s55 (998426..1000498) [2073 bp, 690 aa] {ON} YOR08...    35   0.33 
CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON} sim...    34   0.41 
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    35   0.41 
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    33   0.43 
YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}  PEX5Peroxi...    34   0.48 
CAGL0J09570g Chr10 complement(941571..943220) [1650 bp, 549 aa] ...    34   0.49 
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    34   0.55 
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    34   0.62 
KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {...    34   0.63 
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    32   0.65 
TPHA0B03970 Chr2 (938053..939243) [1191 bp, 396 aa] {ON} Anc_1.4...    33   0.75 
TBLA0B08680 Chr2 (2070444..2073188) [2745 bp, 914 aa] {ON} Anc_3...    34   0.77 
KAFR0E02820 Chr5 (570013..571701) [1689 bp, 562 aa] {ON} Anc_8.4...    33   1.0  
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    32   1.0  
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    33   1.0  
SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} simila...    33   1.1  
KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7....    33   1.1  
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    33   1.2  
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    33   1.2  
Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON} (1611...    33   1.2  
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    33   1.3  
AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic ...    33   1.3  
NCAS0C04490 Chr3 complement(919665..922421) [2757 bp, 918 aa] {O...    33   1.5  
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    32   1.7  
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    32   1.7  
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    31   1.7  
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    32   2.2  
KLTH0F19272g Chr6 (1558288..1558366,1558617..1560049) [1512 bp, ...    32   2.4  
TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {O...    32   2.4  
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    32   2.6  
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...    32   2.7  
CAGL0M08030g Chr13 complement(800149..801312) [1164 bp, 387 aa] ...    32   2.9  
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    32   2.9  
KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} simi...    32   3.2  
TPHA0G00430 Chr7 complement(77860..80046) [2187 bp, 728 aa] {ON}...    32   3.4  
TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {O...    32   3.4  
NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {O...    31   4.4  
Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar t...    31   4.4  
KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {O...    31   5.3  
Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON} Y...    31   5.5  
NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}...    31   5.8  
Skud_14.26 Chr14 complement(38826..41624) [2799 bp, 932 aa] {ON}...    31   5.9  
Ecym_1366 Chr1 (753035..754213) [1179 bp, 392 aa] {ON} similar t...    30   6.2  
ZYRO0C02970g Chr3 (230414..233104) [2691 bp, 896 aa] {ON} simila...    31   6.3  
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    29   6.4  
KLLA0D09020g Chr4 (758818..760410) [1593 bp, 530 aa] {ON} simila...    30   6.5  
TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8....    31   6.6  
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    31   7.0  
SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]...    30   7.7  
Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320...    30   7.8  
KLTH0F19140g Chr6 (1550056..1552830) [2775 bp, 924 aa] {ON} simi...    30   8.1  
AEL062C Chr5 complement(519416..520567) [1152 bp, 383 aa] {ON} S...    30   8.7  
AEL281C Chr5 complement(111535..115707) [4173 bp, 1390 aa] {ON} ...    30   9.5  

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/342 (82%), Positives = 282/342 (82%)

Query: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60
           MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ
Sbjct: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60

Query: 61  GNSLSSYLNGXXXXXXXXXXXDETVKVNVXXXXXXXXXXXXXXXXXGNKAMAGKDYELAI 120
           GNSLSSYLNG           DETVKVNV                 GNKAMAGKDYELAI
Sbjct: 61  GNSLSSYLNGSTSASAATTTADETVKVNVTEDDTEASEAAEALKLEGNKAMAGKDYELAI 120

Query: 121 KKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFA 180
           KKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFA
Sbjct: 121 KKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFA 180

Query: 181 QGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAEXXXXX 240
           QGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAE     
Sbjct: 181 QGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAESDSAS 240

Query: 241 XXXPFAGMGGMPDFSSMXXXXXXXXXXXXXXXXXXXXXXXXDPEAMKQVESMMQNPSVKQ 300
              PFAGMGGMPDFSSM                        DPEAMKQVESMMQNPSVKQ
Sbjct: 241 AADPFAGMGGMPDFSSMLGGGGLGNLLNNPQLMQAAQQMMQDPEAMKQVESMMQNPSVKQ 300

Query: 301 MADQFSSGNGTPDFSALMNDPSIRDMAKNMFGNGGFQGAPPS 342
           MADQFSSGNGTPDFSALMNDPSIRDMAKNMFGNGGFQGAPPS
Sbjct: 301 MADQFSSGNGTPDFSALMNDPSIRDMAKNMFGNGGFQGAPPS 342

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  387 bits (993), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 212/346 (61%), Positives = 243/346 (70%), Gaps = 15/346 (4%)

Query: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60
           M+ SNK+IAALI+D+L+ VVDK EVS DNADSLNVAMDCIAEAFEFERDSV   VKS+F 
Sbjct: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60

Query: 61  GNSLSSYLNGXXXXXXXXXXXDETVKVNVXXXXXXXXXXXXXX--XXXGNKAMAGKDYEL 118
           GN L+S+L+G              ++VN+                   GNKAMA KDYE 
Sbjct: 61  GNGLTSFLSGSAT---------NDIQVNIADDAADEEQKATAEGLKLEGNKAMATKDYES 111

Query: 119 AIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAK 178
           AIKKY+EAI  LPTNAVY+ANRAAAYSSLKKYD+AV DA SAIK+NPTYSKGYSRLGFAK
Sbjct: 112 AIKKYSEAIEVLPTNAVYYANRAAAYSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAK 171

Query: 179 FAQGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNAT-AEXX 237
           FAQGK EDAL+AYKKVLDIEGDKAT++MKRDYETAKKKVEQSLNLEK T     T +   
Sbjct: 172 FAQGKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEAETESNAD 231

Query: 238 XXXXXXPFAGMGGMPDFSSMXXXXXXXXXXXXXXX---XXXXXXXXXDPEAMKQVESMMQ 294
                    GMGG PD SSM                           +P AM+Q+ESMMQ
Sbjct: 232 AGTGAAGMGGMGGFPDLSSMLGGGLGGGLGDLLKNPQIMQAAQQMMQNPNAMQQMESMMQ 291

Query: 295 NPSVKQMADQFSSGNGTPDFSALMNDPSIRDMAKNMFGNGGFQGAP 340
           NP+V+QMA+ F+SG GTPD SA+MN+P ++DMAKNMFGNGGF GAP
Sbjct: 292 NPAVRQMAENFASGEGTPDLSAMMNNPDLKDMAKNMFGNGGFPGAP 337

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score =  342 bits (876), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 185/332 (55%), Positives = 225/332 (67%), Gaps = 11/332 (3%)

Query: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60
           M+ SNK+IAALI+DFLS+ V+KN VSED ADSLNVA+DCI+EAFEFERD+V+ +VK+SF 
Sbjct: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60

Query: 61  GNSLSSYLNGXXXXXXXXXXXDETVKVNVXXXXXXXXXXXXXXXXXGNKAMAGKDYELAI 120
              L   L              E VKVN+                 GNKAMA KD+E AI
Sbjct: 61  NRKLDELLKSAATALPTQS---EPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAI 117

Query: 121 KKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFA 180
           KKYTEAI  LP+NAVY+ANRAAAYSSLKKY+E+V+DA SAIK+NP+YSKGYSRLGFAK+A
Sbjct: 118 KKYTEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYA 177

Query: 181 QGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAEXXXXX 240
            GK E+ALEAYK VLDIEGDKAT++MKRDYETAK+KVEQSLNLEKS  +     E     
Sbjct: 178 LGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESSTDA 237

Query: 241 XXXPFAGMGGMPDFSSMXXXXXXXXXXXXXXXXXXXXXXXXDPEAMKQVESMMQNPSVKQ 300
                AG  G PD +S+                        +P AM +   MM+NP+V+Q
Sbjct: 238 G----AGASGFPDMASL-LGGGLGGLLNNPQVMSAAQKLMQNPGAMDE---MMKNPAVRQ 289

Query: 301 MADQFSSGNGTPDFSALMNDPSIRDMAKNMFG 332
           MA+ FSSG GTP+   LM++P+I+DMAKN+FG
Sbjct: 290 MAENFSSGGGTPNLGDLMSNPAIKDMAKNLFG 321

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score =  329 bits (844), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 174/339 (51%), Positives = 224/339 (66%), Gaps = 7/339 (2%)

Query: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVV-KSSF 59
           MS S ++IAALI+++ S++V+K E+SED ADSLNVAMDCI+EAF FER++V+G++ KS F
Sbjct: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60

Query: 60  QGNSLSSYLNGXXXXXXXXXXXD-ETVKVNVXXXXXXXXXXXXXXXXXGNKAMAGKDYEL 118
           +G  L+  LN            D E V++N+                 GNKAMA KDYEL
Sbjct: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 119 AIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAK 178
           AI KYTEAI  LPTNA+Y+ANRAAA+SSLK+YD+AV+DA SAI I+P+Y +GYSRLGFAK
Sbjct: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK 180

Query: 179 FAQGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAEXXX 238
           +AQGK E+ALEAYKKVLDIEGD ATE MKRDYE+AKKKVEQSLNLEK+    +  A+   
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADVDA 240

Query: 239 XXXXXPFAGMGGMPDFSSMXXXXXXXXXXXXXXXXXXXXXXXXDPEAMKQVESMMQNPSV 298
                      G                               +P AM+ ++ MMQ+PS+
Sbjct: 241 SQ-----GASAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSI 295

Query: 299 KQMADQFSSGNGTPDFSALMNDPSIRDMAKNMFGNGGFQ 337
           +QMA+ F+SG GTP+ S LMN+P++R+MA N+FG  G Q
Sbjct: 296 RQMAEGFASGGGTPNLSDLMNNPALRNMAGNLFGGAGAQ 334

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score =  328 bits (840), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 179/341 (52%), Positives = 220/341 (64%), Gaps = 15/341 (4%)

Query: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60
           M +SNK+I+ LI+D+L  V +KN+VSED  DSLNVA+DCI ++FEFERDS +G++KS F 
Sbjct: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60

Query: 61  GNSLSSYLNGXXXXXXXXXXXDETVKVNV----XXXXXXXXXXXXXXXXXGNKAMAGKDY 116
             SL   L              E V VNV                     GNKAMA KD+
Sbjct: 61  NLSLPELL-----EVAMENSAKENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDF 115

Query: 117 ELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGF 176
           +LAI KY+EAI+  P NA+Y+ANRAAAYSSLK +++A EDA SAI+++P YSKGYSRLGF
Sbjct: 116 DLAIAKYSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAESAIRVDPNYSKGYSRLGF 175

Query: 177 AKFAQGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAEX 236
           AK+A  K E+ALEAYKKVLD+EGDKATE+MKRDYETAKK+VEQSLNLEK      +T + 
Sbjct: 176 AKYALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKE----STPKE 231

Query: 237 XXXXXXXPFAGMGGMPDFSSMXXXXXXXXXXXXXXXXXXXXXXXXDPEAMKQVESMMQNP 296
                    A  GG PD SSM                        DP AM +++SMMQNP
Sbjct: 232 ESVTESAANAAAGGFPDMSSM-LGGGLNGLLNNPQLMQAAQQMMSDPNAMSKIQSMMQNP 290

Query: 297 SVKQMADQFSSGNGTPDFSALMNDPSIRDMAKNMFGNGGFQ 337
           S++QMA+ F +GN TPDFS LMNDP+I+DMAKN FG    Q
Sbjct: 291 SIRQMAENFQNGN-TPDFSQLMNDPNIKDMAKNFFGGNNQQ 330

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score =  323 bits (829), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 172/335 (51%), Positives = 219/335 (65%), Gaps = 9/335 (2%)

Query: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVV-KSSF 59
           M  S ++IAALI+++ S++V+K E+SED ADSLNVAMDCI+EAF FERD+ +G++ KS F
Sbjct: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60

Query: 60  QGNSLSSYLNGXXXXXXXXXXXD-ETVKVNVXXXXXXXXXXXXXXXXXGNKAMAGKDYEL 118
           +G SL+  LN            D + V+VN+                 GNKAMA KDYEL
Sbjct: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPEEDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 119 AIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAK 178
           AI KYTEAI  LPTNA+Y+ANRAAA+SSL++YDEAV+DA S+I I+P+Y +GYSRLGFAK
Sbjct: 121 AINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK 180

Query: 179 FAQGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAEXXX 238
           +AQGK E+ALEAYKKVLDIEGD ATE MKRDYE+AKKKVEQSLNLEK      A  E   
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEK------AVPEQSR 234

Query: 239 XXXXXPFAGMG-GMPDFSSMXXXXXXXXXXXXXXXXXXXXXXXXDPEAMKQVESMMQNPS 297
                   G G                                 +P AM+ ++ MMQ+PS
Sbjct: 235 DADANASQGAGSSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPS 294

Query: 298 VKQMADQFSSGNGTPDFSALMNDPSIRDMAKNMFG 332
           ++QMA+ F+SG G P+ S LMN+P++R+MA N+FG
Sbjct: 295 IRQMAEGFTSGGGAPNLSDLMNNPALRNMAGNLFG 329

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score =  323 bits (829), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 173/338 (51%), Positives = 221/338 (65%), Gaps = 7/338 (2%)

Query: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSS-F 59
           MS S  +IA+LI+++ S++V+K E+SED+ADSLNVAMDCI+EAF FER++V  ++++S F
Sbjct: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60

Query: 60  QGNSLSSYLNGXXXXXXXXXXXD-ETVKVNVXXXXXXXXXXXXXXXXXGNKAMAGKDYEL 118
           +G +L+  LN            D + V+VN+                 GNKAMA KDYEL
Sbjct: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPEEDAEIKAKAEDLKMQGNKAMANKDYEL 120

Query: 119 AIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAK 178
           AI KYTEAI  LPTNA+Y+ANRAAA+SSLK YDEAVEDA SAI I+PTY +GYSRLGFAK
Sbjct: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAK 180

Query: 179 FAQGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAEXXX 238
           +AQGK E+ALEAYKKVLDIEGD ATE MKRDYE+AKKKVEQSLNLEK+    +  A+   
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADANA 240

Query: 239 XXXXXPFAGMG-GMPDFSSMXXXXXXXXXXXXXXXXXXXXXXXXDPEAMKQVESMMQNPS 297
                   G G                                 +P AM+ ++ MMQ+P+
Sbjct: 241 DASQ----GAGTSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPN 296

Query: 298 VKQMADQFSSGNGTPDFSALMNDPSIRDMAKNMFGNGG 335
           +KQMA+ F+SG G P+ S LMN+P++R MA N+FG  G
Sbjct: 297 IKQMAEGFTSGGGAPNLSDLMNNPALRSMAGNLFGGAG 334

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score =  321 bits (822), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 174/341 (51%), Positives = 225/341 (65%), Gaps = 14/341 (4%)

Query: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60
           MS++NKDI ALI+DFLST+++KNEVSEDNADSLNVAMDCI+EA EF+R+ V   +K+ F 
Sbjct: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60

Query: 61  GNSLSSYLNGXXXXXXXXX-XXDETVKVNVXXXXXXXXXXXXXXXXXGNKAMAGKDYELA 119
           G +L   LN             +E+V+VN+                 GNKAMA KD+ LA
Sbjct: 61  GKTLVDILNTTSTATANTTIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLA 120

Query: 120 IKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKF 179
           ++KYTEAI  LPTNA+Y+ANRAAA+SSLK+++EA++DA SAIKI+P+YSKGYSRL FAK+
Sbjct: 121 VEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKY 180

Query: 180 AQGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTV-----SGNATA 234
             GK E+ALE+YKKVLDIEGD AT  MKRDYETAKK+VE+S+N+EKS           T 
Sbjct: 181 GLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQTN 240

Query: 235 EXXXXXXXXPFAGMGGMPDFSSMXXXXXXXXXXXXXXXX----XXXXXXXXDPEAMKQVE 290
           E        PFA  GGMPD SS+                            DP AM+QV+
Sbjct: 241 ESAQGNAPNPFA--GGMPDMSSLFGGAGMGGGLGSLLSNPDFMSTAQKLMSDPNAMQQVQ 298

Query: 291 SMMQNPSVKQMADQFSSGNGTPDFSALMNDPSIRDMAKNMF 331
           SMM +PS++ +A+ F +GN   D + +MN+P+IR+MA N+F
Sbjct: 299 SMMSDPSMRDLANNFKNGNT--DMNDIMNNPAIRNMASNLF 337

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  317 bits (813), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 166/339 (48%), Positives = 218/339 (64%), Gaps = 8/339 (2%)

Query: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60
           MS+SNK++ +LI+DFLSTV+   E+SED+ADSLNVA+DCI E+FEFERD+VA  ++  F 
Sbjct: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60

Query: 61  GNSLSSYLNGXXXXXXXXXXXDETVKVNVXXXXXXXXXXXXXXXXXGNKAMAGKDYELAI 120
           G +L   L             +E+VKVN+                 GNKAMA KDY LAI
Sbjct: 61  GKTLKEIL-SSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAI 119

Query: 121 KKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFA 180
           +KY+EAI TLPTN +Y+ANRAAAYSS+K+YD A++DA  AI+I+P YSKGYSRL FAK+A
Sbjct: 120 EKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYA 179

Query: 181 QGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAEXXXXX 240
             K E+ALE YKKVLD+EGDKAT  MKRD+E AK +VE S+NLEKS+ +    +      
Sbjct: 180 LNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAGQQ 239

Query: 241 XXXPFAGMGGMPDFSSMXXXXXXXXXXXX----XXXXXXXXXXXXDPEAMKQVESMMQNP 296
              PFAG  GMPD SS+                            DP +M++++ MMQNP
Sbjct: 240 PANPFAG-SGMPDMSSLFGNGGGMGGLSSFLNNPQVMQAAQQMMSDPNSMQKMQEMMQNP 298

Query: 297 SVKQMADQFSSGNGTPDFSALMNDPSIRDMAKNMFGNGG 335
           ++++MA   +SG+   D   LMN+PS++DMA N+FG  G
Sbjct: 299 NLREMAQNLASGDANLD--DLMNNPSVKDMANNLFGPNG 335

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score =  316 bits (809), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 167/341 (48%), Positives = 225/341 (65%), Gaps = 10/341 (2%)

Query: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60
           M+ SNK++++LIID+L+ VV K EVS D+ DSLNVA+DC+ E F  E+D+++  ++S F 
Sbjct: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60

Query: 61  GNSLSSYLNGXXXXX-XXXXXXDETVKVNVXXXXXXXXXXXXXXXXXGNKAMAGKDYELA 119
           G SL+  L+              ETVK+N+                 GNKA+A KDY+LA
Sbjct: 61  GKSLTELLDAASQNAGNTDECKTETVKINIPQEDAETKAKAEALKLEGNKAVASKDYDLA 120

Query: 120 IKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKF 179
           ++KYTEAI  LPTNAVYFANRAAAY++ + YDEAV+DA  AIK++P YSKGYSRL +AK+
Sbjct: 121 VEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKY 180

Query: 180 AQGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAEXXXX 239
            Q   E++LEAYKKVL+IEGD ATE+ KR YETAKK+VE+SLNLEKS  + +A  +    
Sbjct: 181 VQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGGQ---- 236

Query: 240 XXXXPFAGMGGMPDFSSMXXXXXXXXXXXXXXXXXXXXXXXXDPEAMKQVESMMQNPSVK 299
               P AG GG PDFSS+                        +P AM++++SMMQNP+++
Sbjct: 237 --TNPAAG-GGFPDFSSL-MSGGLEGLMNNPQMMQAAQSMMSNPGAMEKIQSMMQNPAIQ 292

Query: 300 QMADQFSSGNGTPDFSALMNDPSIRDMAKNMFGNGGFQGAP 340
           QMA+QF  GN TPDFS +MN+P++R+MA ++F   G   AP
Sbjct: 293 QMAEQFKGGN-TPDFSEMMNNPAVRNMASSLFSGAGEPAAP 332

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score =  314 bits (805), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 176/334 (52%), Positives = 216/334 (64%), Gaps = 14/334 (4%)

Query: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60
           MS SNKD+A LI+DFLS  V+  EVSED  DSLNVA+DCI EAFEF+R+SVA  ++ +F 
Sbjct: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60

Query: 61  GNSLSSYLNGXXXXXXXXXXXDETVKVNVXXXXXXXXXXXXXXXXXGNKAMAGKDYELAI 120
           G SL   +              E+VKVN+                 GNKAMA KD+E A+
Sbjct: 61  GRSLKQVVEAASVGSSSP---QESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAV 117

Query: 121 KKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFA 180
            KY+EAI  LPTNAVY+ANRAAA+SSLKKY+EAV+DA  AIK+NP+YSKGYSRLGFA++A
Sbjct: 118 LKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYA 177

Query: 181 QGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAEXXXXX 240
            GK E+AL+AYKKVLDIEG+ AT+ MKRDY+TA KKV QSLN+EKS       A      
Sbjct: 178 LGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKS-------APAATRD 230

Query: 241 XXXPFAGMGGMPDFSSMXXXXXXXXXXXXXXXXXXXXXXXXDPEAMKQVESMMQNPSVKQ 300
                 G GG+PD SSM                        +P AM++V   M NP+VKQ
Sbjct: 231 GAGSATGSGGLPDISSM-LGGGLGGLLNNPQLMQAAQQMMQNPNAMQEV---MNNPAVKQ 286

Query: 301 MADQFSSGNGTPDFSALMNDPSIRDMAKNMFGNG 334
           MA++F SG GTP  + LMN+P++ DMAKNMFG G
Sbjct: 287 MAEKFQSGGGTPSMADLMNNPALMDMAKNMFGGG 320

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score =  313 bits (801), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 170/329 (51%), Positives = 220/329 (66%), Gaps = 18/329 (5%)

Query: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60
           M+ SNKDI++LI+D+L+ VVDK  VSED+ DSLNVA++CI EAF  E+    G   ++F 
Sbjct: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEK----GSSSAAFG 56

Query: 61  GNSLSSYLNGXXXXXXXXXXXDETVKVNVXXXXXXXXXXXXXXXXXGNKAMAGKDYELAI 120
           G +L+  L+             E VKVN+                 GNKAMAGKDYELAI
Sbjct: 57  GKNLAELLSAGAGAPSSQG---ENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAI 113

Query: 121 KKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFA 180
           KKY+EAI+ +PTNAVY+ANRAAA+SSLK YDEA++DA SA+K++ +YSKGYSRLG+AKFA
Sbjct: 114 KKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFA 173

Query: 181 QGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEK---STVSGNATAEXX 237
           QGK+E+ALEAYKKVLDIEGD AT++MKRDYETAK+KVEQ+L L K   +  S   T E  
Sbjct: 174 QGKSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGEPA 233

Query: 238 XXXXXXPFAGMGGMPDFSSMXXXXXXXXXXXXXXXXXXXXXXXXDPEAMKQVESMMQNPS 297
                   A  GG  D SSM                        +P+AM Q+E+MMQNP+
Sbjct: 234 G-------ANPGGGFDLSSM-LGGGLGGLLNNPQVMQAAQQMMQNPQAMSQMETMMQNPN 285

Query: 298 VKQMADQFSSGNGTPDFSALMNDPSIRDM 326
           V+QMA++F+ GNGTP+ + +MN+P++RDM
Sbjct: 286 VRQMAEKFAGGNGTPNLNDIMNNPALRDM 314

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score =  311 bits (796), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 173/337 (51%), Positives = 217/337 (64%), Gaps = 20/337 (5%)

Query: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60
           MS SNKDIA L++DFLST ++K  VS DNADSLNVA+DCI EAFEFE+D V   + S F 
Sbjct: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60

Query: 61  GNSLSSYLNGXXXXXXXXXXXDETVKVNVX----XXXXXXXXXXXXXXXXGNKAMAGKDY 116
           G SL+  L+             E +KV++                     GNKAMA KDY
Sbjct: 61  GKSLTELLDAATNAKGRSSSP-EDIKVSISDKDEEEDKELAAKAEALKLEGNKAMAAKDY 119

Query: 117 ELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGF 176
            LA++KY  AI  +PT AVY+ANRAAAYSS +KYDEA++DA SAIK+ P +SKGYSRLGF
Sbjct: 120 NLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGF 179

Query: 177 AKFAQGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAEX 236
           AKFAQGK+++ALEAYKK L+++GDKAT++MKRDYETAKKKVEQSLN+EKS     + +  
Sbjct: 180 AKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKSATPSASASAS 239

Query: 237 XXXXXXXPFAGMGGMPDFSSMXXXXXXXXXXXXXXXXXXXXXXXXDPEAMKQVESMMQNP 296
                       GGMPD +SM                        +P AM+Q+ESMMQNP
Sbjct: 240 ASA---------GGMPDMASM-LGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQNP 289

Query: 297 SVKQMADQFSSGN--GTPDFSALMNDPSIRDMAKNMF 331
           S++QMA+  SSG+  G  DF   MN+P+IR+MA N+F
Sbjct: 290 SIRQMAENLSSGSSEGMGDF---MNNPAIREMASNLF 323

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score =  308 bits (789), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 167/334 (50%), Positives = 225/334 (67%), Gaps = 7/334 (2%)

Query: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVV-KSSF 59
           MS S ++IA+LI+++ S++V+K EVSED+ADSLNVAMDCI+EAF FERD+V+ ++ KS+F
Sbjct: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60

Query: 60  QGNSLSSYLNGXXXXXXXXXXXD-ETVKVNVXXXXXXXXXXXXXXXXXGNKAMAGKDYEL 118
           +G SL++ L+            D + V+VN+                 GNKAMA K+YEL
Sbjct: 61  KGQSLNNLLSSSSKLPESGKKDDAQNVEVNIPEEDAETKAKAEELKIQGNKAMANKEYEL 120

Query: 119 AIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAK 178
           AIKKYTEAI  LPTNA+Y+ANRAAA+SSLK+YDEA++DA SAI ++P+Y +GYSRLGFAK
Sbjct: 121 AIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK 180

Query: 179 FAQGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAEXXX 238
           +AQGK E+ALEAYKKVLDIEGD AT+ MKRDYE+AKK+VEQSLNLEK+     A  +   
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKT-----APEQPRD 235

Query: 239 XXXXXPFAGMGGMPDFSSMXXXXXXXXXXXXXXXXXXXXXXXXDPEAMKQVESMMQNPSV 298
                      G                               +P AM+ +++MMQ+PS+
Sbjct: 236 AGANAGQGAGAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQNMMQDPSI 295

Query: 299 KQMADQFSSGNGTPDFSALMNDPSIRDMAKNMFG 332
           +QMA+ F+SG GTP+ S LM +P++R+MA ++FG
Sbjct: 296 RQMAEGFTSGGGTPNLSDLMKNPALRNMAGSLFG 329

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score =  303 bits (777), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 175/343 (51%), Positives = 222/343 (64%), Gaps = 12/343 (3%)

Query: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60
           MS SNK++A+LI+D+LS +V+K  VSE+  DSLNVA+DCI E+FE ++    G  K+ F 
Sbjct: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQK----GDSKAVFG 56

Query: 61  GNSLSSYL-NGXXXXXXXXXXXDETVKVNVXXXXXXXXXXXXXXXXXGNKAMAGKDYELA 119
           G  L   L N             E++KVN+                 GNKAMA KD++LA
Sbjct: 57  GKGLVELLQNESGSSSETATTQAESIKVNIPAEDAETKAKAETLKLEGNKAMACKDFDLA 116

Query: 120 IKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKF 179
           IKKY++AI  LPTNAVY+ANRAAA+SS+K Y+EA++DA SAIK +PTYSKGYSRLG+AKF
Sbjct: 117 IKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKF 176

Query: 180 AQGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAEXXXX 239
           A G+AEDALEAYKKVLDIEGDKA+++MKRDYETAKKKVEQSL+LEK       T      
Sbjct: 177 ALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKP----ETQARGAD 232

Query: 240 XXXXPFAGMGGMPDFSSMXXXXXXXXXXXXXXXXXXXXXXXXDPEAMKQVESMMQNPSVK 299
                  G GG  DF+SM                        +P+AM Q+ESMMQNP V+
Sbjct: 233 AGAGGAGGSGGFGDFASM-LGGGLGGLLNNPQLMQAAQQMMQNPQAMSQMESMMQNPGVR 291

Query: 300 QMADQFSSGNGTPDFSALMNDPSIRDMAKNMFGNGGFQGAPPS 342
           QMA+ F+ GNG P+   LMN+P++RDMA ++F  GG  G  P+
Sbjct: 292 QMAENFAQGNGMPNMGDLMNNPALRDMAGSLF--GGANGNAPN 332

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score =  301 bits (771), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 167/327 (51%), Positives = 214/327 (65%), Gaps = 9/327 (2%)

Query: 5   NKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQGNSL 64
           +K++AA+II +L  VV +  V ED  DS+NVA+DCIAE+FE ER  V  V+K S     +
Sbjct: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQS----GI 57

Query: 65  SSYLNGXXXXXXXXXXXDETVKVNVXXXXXXXXXXXXXXXXXGNKAMAGKDYELAIKKYT 124
           S  L              E VKVN+                 GNKAMAGKD+ELAI KY+
Sbjct: 58  SKGLEECLECMKGGAVKSEDVKVNIPAEDAETKAKAEALKLEGNKAMAGKDFELAIAKYS 117

Query: 125 EAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKA 184
           EAI  LPTNA+Y+ANRAAA+SSLK+YDEAV DA  AI+I+P YSKGYSRLGFAK+AQ K 
Sbjct: 118 EAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKP 177

Query: 185 EDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAEXXXXXXXXP 244
           E+ALEAYKKV+D+EGDKAT++MKRDYETAKKKVEQSLNLEK+  +  A +          
Sbjct: 178 EEALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDARGADSGAGAGAGAGG 237

Query: 245 FAGMGGMPDFSSMXXXXXXXXXXXXXXXXXXXXXXXXDPEAMKQVESMMQNPSVKQMADQ 304
             G     DFSSM                        +P+A++Q++SMMQ+PS++QMA+Q
Sbjct: 238 AGGF----DFSSM-LSGGLSGLMNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQ 292

Query: 305 FSSGNGTPDFSALMNDPSIRDMAKNMF 331
           F+SGNGTP+   LM++P++R+MA +MF
Sbjct: 293 FTSGNGTPNMDDLMSNPALRNMASSMF 319

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score =  293 bits (749), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 168/336 (50%), Positives = 213/336 (63%), Gaps = 17/336 (5%)

Query: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60
           M+ + K++A+LIID+L    +  E+ ED  DSLNVA+DC+ EAFE E++S + V++ SF 
Sbjct: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60

Query: 61  GNSLSSYLNGXXXXXXXXXXXDETVKVNVXXXXXXXXXXXXXXXXXGNKAMAGKDYELAI 120
           G SL   +              E VKVN+                 GNKAMA KD+E AI
Sbjct: 61  GQSLEQIVGASSKGPTATQ--QEPVKVNIPVEDAEIKAKAEALKLEGNKAMATKDFEHAI 118

Query: 121 KKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFA 180
            KY+EAI TLP+NAVYFANRAAAYSSLKKY EAVEDA +AIK+NP+YSKGYSRLGFA++A
Sbjct: 119 SKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYA 178

Query: 181 QGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKST-VSGNATAEXXXX 239
            G+ E+AL+AYKKVLDIEG  AT+ MKRDY+TA KKVEQSLN+E+S   + NA +     
Sbjct: 179 LGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAESPDA-- 236

Query: 240 XXXXPFAGMGGMPDFSSMXXXXXXXXXXXXX---XXXXXXXXXXXDPEAMKQVESMMQNP 296
                 AG  G PD +SM                           +P AM++   MM NP
Sbjct: 237 ------AGGSGFPDIASMLGGGLGGGLGGLLKNPQVMQAAQQMMQNPNAMQE---MMSNP 287

Query: 297 SVKQMADQFSSGNGTPDFSALMNDPSIRDMAKNMFG 332
           ++KQMAD+F SG GTP  + LMN+P++ DMAKNMFG
Sbjct: 288 AIKQMADKFQSGGGTPSMADLMNNPALMDMAKNMFG 323

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score =  291 bits (744), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 174/344 (50%), Positives = 218/344 (63%), Gaps = 24/344 (6%)

Query: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60
           MS+SNK+IAALI+DFLS+    + V+ED  DSLNVA+DCI EAF+FERD    ++   F 
Sbjct: 1   MSLSNKEIAALIVDFLSSS--SSSVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFN 58

Query: 61  GNSLSSYLNGXXXXXXXXXXXDETVKVNVXXXXXXXXXXXXXXXXXGNKAMAGKDYELAI 120
           G  L   L              E VKV++                 GNKAMA K ++ AI
Sbjct: 59  GKKLPELL---ASAPSSGGVSGEPVKVHIPVEDAAAKAKAEELKLQGNKAMAAKKFDEAI 115

Query: 121 KKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFA 180
           +KYT AI   P+NAVY++NRAAAYSSLK+Y++AV+DA  AI+++PTYSKG+SRLGFAK+A
Sbjct: 116 EKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYA 175

Query: 181 QGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAEXXXXX 240
             K E+AL+AYKKVLDIEG+KAT++MKRDYETAKKKVE S+NLEKS+ S ++        
Sbjct: 176 LNKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLEKSSTSASSEDVSDKSA 235

Query: 241 XXXPFAGMGGMPDFSSMXXXXXXXXXXXXXXXXXXXXXXXXDPEAMKQVESMMQ------ 294
              P AG GG+PD SS                         +P+ M+  E MMQ      
Sbjct: 236 TEGPGAGAGGLPDLSS---------LLGGGGLGGGLGALLNNPQVMQAAEKMMQNPGLMQ 286

Query: 295 ----NPSVKQMADQFSSGNGTPDFSALMNDPSIRDMAKNMFGNG 334
               NP++KQMA+QFSSG G PD S +MNDPSIRDMAKNMFG G
Sbjct: 287 DMMSNPAMKQMANQFSSGGGMPDLSQMMNDPSIRDMAKNMFGGG 330

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score =  275 bits (703), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 158/339 (46%), Positives = 197/339 (58%), Gaps = 30/339 (8%)

Query: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60
           M  SNK+IAALI+ FLST     +V E+  DSLNVA+DCIAEAFE ER+    +V  ++ 
Sbjct: 1   MPGSNKEIAALIVQFLSTST--KDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYN 58

Query: 61  GNSLSSYLNGXXXXXXXXXXXDETVKVNVXXXXXXXXXXXXXXXXXGNKAMAGKDYELAI 120
           G  L   +              E    N                  GNKA A KD+E A+
Sbjct: 59  GRGLVDLVK--SGASEPTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAV 116

Query: 121 KKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFA 180
           KKYTEAI  +P NAV++ NRAAAYSS KK++EAV DA SA++INP+YS+GYSRLG AK+A
Sbjct: 117 KKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYA 176

Query: 181 QGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNL-------EKSTVSGNAT 233
            GK E+A+EAYKKVLDIEGD ATE MKRDYE+AKKKVE+SLNL       E+ T  G++ 
Sbjct: 177 LGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLEALPKGEEQQTSEGSSA 236

Query: 234 AEXXXXXXXXPFAGMGGMPDFSSMXXXXXXXXXXXXXXXXXXXXXXXXDPEAMKQVESMM 293
                          GG PD SSM                        +P AM++   MM
Sbjct: 237 ---------------GGFPDLSSM-LGGGLGGLLNNPQVMQAAQKMMQNPSAMQE---MM 277

Query: 294 QNPSVKQMADQFSSGNGTPDFSALMNDPSIRDMAKNMFG 332
            NP++KQMA  F+SG GTP+   +M DP+I+DMA   FG
Sbjct: 278 NNPAIKQMAQNFASGGGTPNLGDMMKDPNIKDMAGKFFG 316

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score =  249 bits (637), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 153/342 (44%), Positives = 196/342 (57%), Gaps = 27/342 (7%)

Query: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60
           MS SNKDIAALI+DFL+T      V ED  DSL VA+DCI EAFE        +V     
Sbjct: 1   MSPSNKDIAALIVDFLTTSA--KTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCG 58

Query: 61  GNSLSSYLNGXXXXXXXXXXXDETVKVNVXXXXXXXXXXXXXXXXXGNKAMAGKDYELAI 120
           G SLS  L                 KV                   GN+AMA KDYE AI
Sbjct: 59  GRSLSQLLTTGMAHTSDAGEP----KV----AAEELKKEAEALKLEGNRAMAAKDYETAI 110

Query: 121 KKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFA 180
           +KYT AI  LPT+AVY+ANRAAAYSSL++Y++AVEDA  A K++ +YSKG+SRLG+AK+A
Sbjct: 111 QKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYA 170

Query: 181 QGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAEXXXXX 240
            G+ E+ALEAYK+VLDIEGD ATE M+RDYE+AK+KVE+S+N+++     NA        
Sbjct: 171 LGRHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDR-----NAEV-TESGD 224

Query: 241 XXXPFAGMGGMPDFSSMXXXXXXXXXXXXXXXXXXXXXXXXDPEAMKQVESMMQNPS--- 297
                AG  G+PD +SM                        +P+ M+  + MMQNPS   
Sbjct: 225 SAAGSAGGSGLPDLASM-FGGGGLGGGLGGGLGGGLGGLLNNPQVMQAAQKMMQNPSAIQ 283

Query: 298 -------VKQMADQFSSGNGTPDFSALMNDPSIRDMAKNMFG 332
                  +K+MA+ F+SGNG+     LM DP++R+MA   FG
Sbjct: 284 EMMSNPAIKKMAENFASGNGSSGLGDLMADPAVRNMASKFFG 325

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score =  217 bits (553), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 126/332 (37%), Positives = 186/332 (56%), Gaps = 12/332 (3%)

Query: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60
           MS++NKD  ALI+++L  ++D  EVSEDNA+SLNVA+DCI++ FE +  S   ++   F 
Sbjct: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60

Query: 61  GNSLSSY-LNGXXXXXXXXXXXDETVKVNVXXXXXXXXXXXXXXXXXGNKAMAGKDYELA 119
            + L +  L G              ++V                   GNK M+ K+Y+ A
Sbjct: 61  KSDLKTITLKGLGLQNVSDVVE---LEVKNEEISEDKKKEAEALKLEGNKQMSLKNYKSA 117

Query: 120 IKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKF 179
           I KY++AI   P+N  Y++NRAAAY  ++ +  AV DAN+AIK++PTYSK YSRLG AK 
Sbjct: 118 IDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKL 177

Query: 180 AQGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAEXXXX 239
           A+G  EDA+ A+KKVL++EGDK+TE+MK DYE AKK V+  + L K+    +        
Sbjct: 178 AEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSGPPPLNTT 237

Query: 240 XXXXPFAGMGGMPDFSSMXXXXXXXXXXXXXXXXXXXXXXXXDPEAMKQVESMMQNPSVK 299
                 A + G   F S+                        +PE M+QVE +MQNP V+
Sbjct: 238 DVLTDIATVLG-SSFGSL-------MNNTQMMQRAQQMMQTQNPEMMQQVEGLMQNPVVR 289

Query: 300 QMADQFSSGNGTPDFSALMNDPSIRDMAKNMF 331
           Q A+  ++GNG    S ++N+PS++++A  + 
Sbjct: 290 QFAENVANGNGPGGLSDVLNNPSVKEVANGLM 321

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score =  150 bits (380), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 89/238 (37%), Positives = 142/238 (59%), Gaps = 22/238 (9%)

Query: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60
           MS+SNK+IA+ I+ +LS+++   +V+ED A+S++VA++CI ++F+ + +  A    ++  
Sbjct: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSADSDLATVL 60

Query: 61  GNSLSSYLNGXXXXXXXXXXXDETVKVNVXXXXXXXXXXXXXXXXXGNKAMAGKDYELAI 120
             +L+                ++ +K+ +                 GNKA+  ++Y+ AI
Sbjct: 61  LANLNLEPEPKLSEKERELVNEQAIKLKLE----------------GNKAVERENYKDAI 104

Query: 121 KKYTEAIATLPTNAV-----YFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLG 175
            KYT AI  L  N +     Y +N++ A +   +Y+EA +DA + IKI+PT+SKGYSRL 
Sbjct: 105 DKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLA 164

Query: 176 FAKFAQGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNAT 233
            AK  Q K EDA+ AYK+VLD+EG+KAT+ MKRD+E  K+K E +LN      SG+AT
Sbjct: 165 EAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFE-TLNFSTHIDSGSAT 221

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score =  148 bits (373), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 106/333 (31%), Positives = 155/333 (46%), Gaps = 33/333 (9%)

Query: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60
           MS++ +  A+LII +LS + + N + ED  +SL VA+ CI E+F  + D +   +K    
Sbjct: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTSLKERTL 60

Query: 61  GNSLSSYLNGXXXXXXXXXXXDETVKVNVXXXXXXXXXXXXXXXXXGNKAMAGKDYELAI 120
              L   LN             E +K                    GN+AM    YE AI
Sbjct: 61  KTILQENLNTLEATQKIHNEEAEALK------------------KEGNEAMIEGQYEEAI 102

Query: 121 KKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFA 180
           KKYTEAI     N  Y++NR+ AYS L +Y++AV DA  AI I+P++SK YSRLG+AK  
Sbjct: 103 KKYTEAIQ-FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCC 161

Query: 181 QGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAEXXXXX 240
           Q K ED + AYK+ +D+EG  A++ +  DYE A+ K EQ   L+K+  S    +      
Sbjct: 162 QDKLEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQ---LKKNDDSEERKSIKEVTS 218

Query: 241 XXXPFAGMGGMPDFSSMXXXXXXXXXXXXXXXXXXXXXXXXDPEAMKQ-----VESMMQN 295
              P         F+++                        D   + +     V  +M N
Sbjct: 219 EECPEKNNNQDEGFTAVNHYAQNNDNKSKEETKEENRSQAADLSNIARLLGSGVGGLMNN 278

Query: 296 PSVKQMADQFSSGNGTPDFSA----LMNDPSIR 324
           P +KQM   F + N  PD S     ++N+P +R
Sbjct: 279 PQLKQMV--FQAINDNPDASRQVKDVLNNPLLR 309

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score =  141 bits (355), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 100/374 (26%), Positives = 174/374 (46%), Gaps = 63/374 (16%)

Query: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60
           M+ ++++IA++I+D+ +  +   ++++DN DSLNVA+DCIA+ F+ ++D ++ ++K++++
Sbjct: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60

Query: 61  GNSLSSYLNGXXXXXXXXXXXDETVKVNVXXXXXXXX----------------------- 97
            N L +YL             + T+ V+V                               
Sbjct: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120

Query: 98  -----------XXXXXXXXXGNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSS 146
                               GN+ M  K Y  AI  Y++AI   PTN  Y+ NRA AY  
Sbjct: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180

Query: 147 LKKYDEAVEDANSAI----KINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDI----- 197
              +D A+ DAN +I    KI+PT  K Y RLG AK+  G  E +L A+K++++I     
Sbjct: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240

Query: 198 EGDKATEMMKRDYETAKKKVEQS--LNLEKST---VSGNATAEXXXXXXXXPFAGMGGMP 252
           +GD+ T+ M  DYE AK+KV++   + + KST    SGN+  +               + 
Sbjct: 241 KGDEITKQMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVT--------LN 292

Query: 253 DFSSMXXXXXXXXXXXXXXXXXXXXXXXXDPEAMKQVESMMQNPSVKQMADQFSSGNGTP 312
           D  +M                        +P+A +Q +++M +P V+QM +  +S     
Sbjct: 293 DILNMAGNNLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENVNS----- 347

Query: 313 DFSALMNDPSIRDM 326
              ++ N P ++D+
Sbjct: 348 --DSMSNIPILKDL 359

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score =  127 bits (319), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 86/340 (25%), Positives = 146/340 (42%), Gaps = 39/340 (11%)

Query: 3   VSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQGN 62
           +++KD+A LI++FL  V+ K E+S+DN DSLNVA+DCI + +      ++  +   F  +
Sbjct: 6   INDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYISSSLILKFSKS 65

Query: 63  SLSSY---------------------------LNGXXXXXXXXXXXDETVKVNVXXXXXX 95
            L+S                            LN            D   K+++      
Sbjct: 66  DLTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTS 125

Query: 96  XXXXXXXXXXX-------GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLK 148
                             GN+ M  +DY+ AI+ YT AI+  P + +Y++NR+ AY  + 
Sbjct: 126 KNNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVN 185

Query: 149 KYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGDKATEMMKR 208
            Y+ A+ DAN  I I+  +SK Y RL   K  Q +  DAL+ YKK +++  D   E + R
Sbjct: 186 DYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITR 245

Query: 209 DYETAKKKVEQSLNLEKSTVSGNATAEXXXXXXXXPFAGMGGMPDFSSMXXXXXXXXXXX 268
           ++E  K KV+  ++L +  +S + +                  PD  S+           
Sbjct: 246 EFEDLKLKVQTDISLRE--ISNDHSNNNYNENSY---NSTKNSPDIGSILGDGFAALLSN 300

Query: 269 XXXXXXXXXXXXXDPEAMKQVESMMQNPSVKQMADQFSSG 308
                        +P+A K +  ++ NP++K +   F +G
Sbjct: 301 PMLQQMIFKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNG 340

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 92.4 bits (228), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 46/94 (48%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPT-NAVYFANRAAAYSSLKKYDEAVEDANSAIKINP 165
           GN A   KDYE AI  +++AI    T N V+++NR+A Y+SLKK+ EA+ DA   +KINP
Sbjct: 11  GNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDAEECVKINP 70

Query: 166 TYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEG 199
           T+SKGY+RLG A    G  ++A  +YKK L+++G
Sbjct: 71  TWSKGYNRLGAAHLGLGDLDEAEGSYKKALELDG 104

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (60%)

Query: 115 DYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRL 174
           D+  A+K YTE I   P +A  ++NRAAA S L  + EA+ED N AI+ +P + + Y R 
Sbjct: 405 DWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCNKAIEKDPNFIRAYIRK 464

Query: 175 GFAKFA 180
             A+ A
Sbjct: 465 ATAQIA 470

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 60/129 (46%), Gaps = 10/129 (7%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAY-------SSLKKYDEAVEDANS 159
           GNKA   + ++ AI  Y +A   L  +  Y  NR+AA        ++LK  DEAVE    
Sbjct: 263 GNKAYKARQFDEAIAHY-DAAWNLHQDITYLNNRSAAEFEKGDAETALKTLDEAVEKGRE 321

Query: 160 AIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEG--DKATEMMKRDYETAKKKV 217
                   +K ++R+G         + A+E Y+K L      +  T++   + E  K++ 
Sbjct: 322 MRTDYKLIAKSFARMGNVHHKTNNLKKAIEFYQKSLTEHRTPEILTKLRNTEKELKKQEA 381

Query: 218 EQSLNLEKS 226
           E+ +N EK+
Sbjct: 382 EEYINPEKA 390

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 92.0 bits (227), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 67/93 (72%), Gaps = 1/93 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAI-ATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINP 165
           GN A   KDYE A + +T+AI A+   N V ++NR+A ++SLKK++EA+ DAN  +KINP
Sbjct: 10  GNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDANECVKINP 69

Query: 166 TYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIE 198
            +SKGY+R+G A F  GK ++A + YKK L+I+
Sbjct: 70  AWSKGYNRVGAAYFGLGKLDEAEQGYKKALEID 102

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 48/91 (52%), Gaps = 4/91 (4%)

Query: 115 DYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRL 174
           D+  A+K YTE     P +A  ++NRAAA + L  + EA++D + AI  +P + + Y R 
Sbjct: 416 DWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDCDMAISKDPNFIRAYIRK 475

Query: 175 GFAKFAQGKAEDALEAYKKVLDIEGDKATEM 205
             A+ A  +   A+E     LD    K TE+
Sbjct: 476 ATAQIAVREFASAIE----TLDAARAKDTEL 502

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 47/96 (48%), Gaps = 8/96 (8%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAI----K 162
           GNK    + ++ AI+ Y +A   L  +  Y  NR+AA      Y++A++    A+    +
Sbjct: 274 GNKFYKARKFDEAIEHYNKAW-DLHKDVTYLNNRSAAEYEKGDYEQAIKTLTEAVEQGRE 332

Query: 163 INPTY---SKGYSRLGFAKFAQGKAEDALEAYKKVL 195
           +   Y   SK ++R+G A       + A+E Y+K L
Sbjct: 333 MRADYKLISKSFARIGNAYLKLEDFKKAIEFYQKSL 368

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 91.3 bits (225), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 45/94 (47%), Positives = 67/94 (71%), Gaps = 1/94 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPT-NAVYFANRAAAYSSLKKYDEAVEDANSAIKINP 165
           GN A   KD+E A + +++AI +  T N V ++NR+A Y+SLKK+ EA+EDA   +KINP
Sbjct: 10  GNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAEECVKINP 69

Query: 166 TYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEG 199
           T+SKGY+R+G A++  G  +DA + YKK L+I+ 
Sbjct: 70  TWSKGYNRVGAAQYGLGNLDDAEKEYKKALEIDS 103

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 37/66 (56%)

Query: 115 DYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRL 174
           D+  A+  YTE I   P +A  ++NRAA  + L  + +A++D + AI  +P + + Y R 
Sbjct: 416 DWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCDVAISKDPNFVRAYIRK 475

Query: 175 GFAKFA 180
             A+ A
Sbjct: 476 ASAQIA 481

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 47/96 (48%), Gaps = 8/96 (8%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAI----K 162
           GNK    + ++ AI+ Y +A   L  +  Y  NR+AA      Y++A++    A+    +
Sbjct: 274 GNKYYKARKFDEAIEHYNKAW-DLHRDVTYLNNRSAAEYEKGDYEQAIKTLTEAVDQGRE 332

Query: 163 INPTY---SKGYSRLGFAKFAQGKAEDALEAYKKVL 195
           +   Y   SK ++R+G A       + A+E Y++ L
Sbjct: 333 MRADYKLISKSFARIGNAYLKMDDLKKAIEFYQRSL 368

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 90.5 bits (223), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 66/95 (69%), Gaps = 1/95 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPT-NAVYFANRAAAYSSLKKYDEAVEDANSAIKINP 165
           GN A   KD+  AI+ +T+AI   PT N V ++NR+AAY+S K++ EA+ DA   +KINP
Sbjct: 12  GNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDATECVKINP 71

Query: 166 TYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGD 200
           T+SKGY+RLG A+F  G  E+A + YK+ L ++ +
Sbjct: 72  TWSKGYNRLGAAEFGLGNLEEAEKNYKEALKLDNN 106

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 46/75 (61%)

Query: 115 DYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRL 174
           D+  A+K Y+E I   P +A  ++NRAAA S L  + EA++D ++AIK +P + + Y R 
Sbjct: 404 DWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCDNAIKKDPNFVRAYIRK 463

Query: 175 GFAKFAQGKAEDALE 189
             A+ A  +  +AL+
Sbjct: 464 ATAQIAIKEYANALD 478

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 65/129 (50%), Gaps = 10/129 (7%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAI----K 162
           GNK      ++ AI++Y +A A L  +  Y  NR+AA      ++ A+   N A+    +
Sbjct: 262 GNKLYKAHKFDEAIEQYNKAWA-LNKDITYLNNRSAAEFEKGDFETAIATLNEAVDQGRE 320

Query: 163 INPTY---SKGYSRLGFAKFAQGKAEDALEAYKKVL--DIEGDKATEMMKRDYETAKKKV 217
           +   Y   +K ++R+G A   +G  + +++ Y+K L      D  T++   + E  K++ 
Sbjct: 321 LRADYKIIAKSFARIGNAYHKKGDLKKSIDYYQKSLTEHRTADILTKLRNCEKELKKQEA 380

Query: 218 EQSLNLEKS 226
           EQ ++ EK+
Sbjct: 381 EQYIDPEKA 389

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 90.1 bits (222), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 44/94 (46%), Positives = 67/94 (71%), Gaps = 1/94 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPT-NAVYFANRAAAYSSLKKYDEAVEDANSAIKINP 165
           GN A   K+Y+ AI+K+T+AI    T N V ++NR+A Y+S K++ + +EDAN  +KINP
Sbjct: 12  GNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDANECVKINP 71

Query: 166 TYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEG 199
           T+SKGY+R+G A F  G  ++A +AYKK L+++ 
Sbjct: 72  TWSKGYNRVGAAHFGMGDLDEAEKAYKKALELDS 105

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (63%)

Query: 115 DYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRL 174
           D+  A+K YTE IA  P++A  ++NRAAA S L  + EA+ D N+AI+ +P + + Y R 
Sbjct: 404 DWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDCNTAIEKDPNFIRAYIRK 463

Query: 175 GFAKFA 180
             A+ A
Sbjct: 464 ATAQIA 469

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 89.4 bits (220), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 48/121 (39%), Positives = 76/121 (62%), Gaps = 6/121 (4%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLP-TNAVYFANRAAAYSSLKKYDEAVEDANSAIKINP 165
           GN A + K+YE A+  +++AI   P  N V ++NR+A Y+SLKK+ +A+ DAN   KINP
Sbjct: 12  GNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDANECTKINP 71

Query: 166 TYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIE-----GDKATEMMKRDYETAKKKVEQS 220
           T+SKGY+R+G A +  G  ++A ++YKK L+++       +  E +KR  E  K + +  
Sbjct: 72  TWSKGYNRVGAAHYGLGDLDEAEKSYKKALELDASNKVAQEGLEQVKRTQEARKAQPDMG 131

Query: 221 L 221
           L
Sbjct: 132 L 132

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 48/87 (55%), Gaps = 4/87 (4%)

Query: 119 AIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAK 178
           A+K YTE IA  P +A  ++NRAAA S L  + EA+ D   A++ +P + K Y R   A+
Sbjct: 411 AVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEKALEKDPNFVKAYIRKATAQ 470

Query: 179 FAQGKAEDALEAYKKVLDIEGDKATEM 205
            A  +   ALE     LDI   K TE+
Sbjct: 471 IAIKEYSSALE----TLDIARSKDTEL 493

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 89.0 bits (219), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 64/95 (67%), Gaps = 1/95 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPT-NAVYFANRAAAYSSLKKYDEAVEDANSAIKINP 165
           GN A A KD+  AI+ +TEAIA   T N V ++NR+A Y+SLK++ EA+ DA   +KINP
Sbjct: 11  GNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALNDAQQCVKINP 70

Query: 166 TYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGD 200
            +SKGY+R+G A    G  +DA   YKK L+++ +
Sbjct: 71  DWSKGYNRMGAAHLGLGDLDDAESNYKKALELDSN 105

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 55/106 (51%), Gaps = 5/106 (4%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           G +     D+  A+K YTE I   P +A  ++NRAAA + L  + EA++D   AI+ +P 
Sbjct: 397 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCEKAIEKDPN 456

Query: 167 YSKGYSRLGFAKFAQG---KAEDALEAYKKVLDI--EGDKATEMMK 207
           + + Y R   A+ A     KA + LE  KK  D    G  + E+MK
Sbjct: 457 FVRAYLRKATAQIAIKDFVKALETLEEAKKKDDEVNNGASSNEIMK 502

 Score = 37.4 bits (85), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 61/129 (47%), Gaps = 10/129 (7%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAY-------SSLKKYDEAVEDANS 159
           GNK      ++ AI +Y +A   L  +  Y  NR+AA        +++   +EAVE    
Sbjct: 263 GNKLYKSHKFDEAIAEYNKAW-DLHKDITYLNNRSAAEFEKGDFETAMNTLNEAVEQGRE 321

Query: 160 AIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVL--DIEGDKATEMMKRDYETAKKKV 217
                   +K ++R+G A   Q   + A+E Y+K L      D  T++   + E  K+++
Sbjct: 322 LRADYKLIAKSFARMGNAYSKQKNLKKAIEYYQKSLTEHRTADILTKLRTCEKELKKQEI 381

Query: 218 EQSLNLEKS 226
           E+ +N EK+
Sbjct: 382 EEYINPEKA 390

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 88.2 bits (217), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/94 (46%), Positives = 64/94 (68%), Gaps = 1/94 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPT-NAVYFANRAAAYSSLKKYDEAVEDANSAIKINP 165
           GN A   KDY+ AI+ +T+AI    T N V ++NR+A Y+SLKK+ +A+ DAN  +KINP
Sbjct: 12  GNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDANECVKINP 71

Query: 166 TYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEG 199
           ++SKGY+RLG A    G  ++A   YKK L+++ 
Sbjct: 72  SWSKGYNRLGAAHLGLGDLDEAESNYKKALELDA 105

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 45/83 (54%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           G +     D+  A+K YTE I   P +A  ++NRAAA + L  + EA+ D N AI+ +P 
Sbjct: 403 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 167 YSKGYSRLGFAKFAQGKAEDALE 189
           + + Y R   A+ A  +   ALE
Sbjct: 463 FVRAYIRKATAQIAVKEYASALE 485

 Score = 38.1 bits (87), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 61/129 (47%), Gaps = 10/129 (7%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIK---- 162
           GNK    + ++ AI+ Y +A   L  +  Y  NRAAA     +Y+ A+   N A++    
Sbjct: 269 GNKFYKARQFDEAIEHYNKAW-ELHKDITYLNNRAAAEYEKGEYETAISTLNDAVEQGRE 327

Query: 163 INPTY---SKGYSRLGFAKFAQGKAEDALEAYKKVLDIE--GDKATEMMKRDYETAKKKV 217
           +   Y   SK ++R+G A    G  +  +E Y+K L      D  T++   + E  K + 
Sbjct: 328 MRADYKVISKSFARIGNAYHKLGDLKKTIEYYQKSLTEHRTADILTKLRNAEKELKKAEA 387

Query: 218 EQSLNLEKS 226
           E  +N EK+
Sbjct: 388 EAYVNPEKA 396

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 65/93 (69%), Gaps = 1/93 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAI-ATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINP 165
           GN A A KD+E AI+ +T+AI  +   N V ++NR+A Y+S K++++A+EDA   + INP
Sbjct: 10  GNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAKQCVNINP 69

Query: 166 TYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIE 198
            +SKGY+R+G A F  G  ++A + YKK L+++
Sbjct: 70  AWSKGYNRVGAAHFGLGDLDEAEQGYKKALELD 102

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 39/66 (59%)

Query: 115 DYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRL 174
           D+  A+K YTE I   P +A  ++NRAAA S L  + EA++D N AI  +P + + Y R 
Sbjct: 408 DWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCNVAISKDPNFIRAYIRK 467

Query: 175 GFAKFA 180
             A+ A
Sbjct: 468 ATAQIA 473

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 8/96 (8%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAY-------SSLKKYDEAVEDANS 159
           GNK    + ++ AI+ Y++A   L  +  Y  NRAAA        +++K   EAVE    
Sbjct: 266 GNKFYKARKFDEAIEHYSKAW-ELHKDITYLNNRAAAEYEKGEYETAIKTLTEAVEQGRE 324

Query: 160 AIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVL 195
                   SK ++R+G +     + + A+E Y+K L
Sbjct: 325 LRADYKVISKSFARIGNSYHKLNELKKAIEFYQKSL 360

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 65/95 (68%), Gaps = 1/95 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPT-NAVYFANRAAAYSSLKKYDEAVEDANSAIKINP 165
           GN A   K+Y+ AI+ +T+AI    T + V F+NR+A Y+SLKK+ +A+ DAN  +KINP
Sbjct: 12  GNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDANECVKINP 71

Query: 166 TYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGD 200
           ++SKGY+RLG A    G  ++A   YKK L+++ +
Sbjct: 72  SWSKGYNRLGAAHLGLGDLDEAESDYKKALELDAN 106

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 53/101 (52%), Gaps = 4/101 (3%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           G +     D+  A+K YTE I   P +A  ++NRAAA + L  + EA+ D N AI+ +P 
Sbjct: 403 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGDKATEMMK 207
           + + Y R+  A+ A  +   ALE     LD+   K  E+ K
Sbjct: 463 FVRAYIRMAAAQIAVKEFAAALE----TLDVARTKDAEVNK 499

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 54/120 (45%), Gaps = 10/120 (8%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIK---- 162
           GNK      ++ AI+ Y  A   L  +  Y  NRAAA      Y+  +   N A++    
Sbjct: 269 GNKFYKAHQFDEAIEHYNRAW-ELHKDITYLNNRAAAEYEKGDYETVIATLNDAVEKGRD 327

Query: 163 INPTY---SKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGDKATEMMK-RDYETAKKKVE 218
           +   Y   SK ++R+G A    G  +  +E Y+K L  E   A  + K R+ E  +KK E
Sbjct: 328 MRADYKVISKSFARIGNAYHKLGDLKKTIEYYQKSL-TEHRTADILAKLRNVEKEQKKAE 386

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 84.7 bits (208), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/94 (45%), Positives = 62/94 (65%), Gaps = 1/94 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPT-NAVYFANRAAAYSSLKKYDEAVEDANSAIKINP 165
           GN A   KDY+ AI+ +T+AI    T N V ++NR+A Y+SLKK+ +A+ DA   I INP
Sbjct: 12  GNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAKECININP 71

Query: 166 TYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEG 199
           ++SKGY+RLG A    G  ++A   YKK L+++ 
Sbjct: 72  SWSKGYNRLGAAHLGLGDLDEAENNYKKALELDA 105

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 43/75 (57%)

Query: 115 DYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRL 174
           D+  A+K YTE I   P +A  ++NRAAA + L  + EA+ D N AI+ +P + + Y R 
Sbjct: 411 DWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRK 470

Query: 175 GFAKFAQGKAEDALE 189
             A+ A  +   ALE
Sbjct: 471 ATAQIAVQEYAAALE 485

 Score = 37.0 bits (84), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 60/129 (46%), Gaps = 10/129 (7%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIK---- 162
           GNK    + ++ AI+ Y +A   L  +  Y  NRAAA     +Y  A+   N A++    
Sbjct: 269 GNKFYKARQFDEAIEHYNKAW-ELHRDITYLNNRAAAEYEKGEYKTAIATLNDAVEQGRE 327

Query: 163 INPTY---SKGYSRLGFAKFAQGKAEDALEAYKKVL--DIEGDKATEMMKRDYETAKKKV 217
           +   Y   S+ ++R+G A    G  +  +E Y+K L      D  T++   + E  K + 
Sbjct: 328 MRADYKVISRSFARIGNAYHKLGDLKKTIEYYQKSLTEHRTADILTKLRNAEKELKKAEA 387

Query: 218 EQSLNLEKS 226
           E  +N EK+
Sbjct: 388 EAYINPEKA 396

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 84.3 bits (207), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 67/93 (72%), Gaps = 1/93 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAI-ATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINP 165
           GN+A A KDY  AI+ +T+AI  +   N V F+NR+A Y+S K + +A++DAN  +KINP
Sbjct: 10  GNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDANECVKINP 69

Query: 166 TYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIE 198
           +++KGY+RLG A +  G  ++A ++YKK L+++
Sbjct: 70  SWAKGYNRLGAAHYGLGDLDEAEQSYKKALELD 102

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 40/74 (54%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           G +     D+  A++ YTE I   P +A  ++NRAAA S L  + +A+ D + AI+ +P 
Sbjct: 396 GKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDKAIEKDPN 455

Query: 167 YSKGYSRLGFAKFA 180
           + + Y R    + A
Sbjct: 456 FVRAYIRKATGQIA 469

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 63/129 (48%), Gaps = 10/129 (7%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAI----K 162
           GNK    + ++ AI+KY EA  T   +  Y  NRAAA      Y+ A+E    A+    +
Sbjct: 262 GNKLYKQRKFDEAIEKYNEAWETH-NDITYLNNRAAAEYEKGDYEAAIETLTKAVEQGRE 320

Query: 163 INPTY---SKGYSRLGFAKFAQGKAEDALEAYKKVLDIEG--DKATEMMKRDYETAKKKV 217
           +   Y   SK ++R+G +    G  + A++ Y+K L      D  T++   + E  +K+ 
Sbjct: 321 LRADYKVISKSFARMGNSYHKLGDLKKAIDYYEKSLTEHRTPDILTKLRNTEKELKQKEA 380

Query: 218 EQSLNLEKS 226
           E  ++ EK+
Sbjct: 381 ESYMDPEKA 389

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 83.6 bits (205), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 43/94 (45%), Positives = 61/94 (64%), Gaps = 1/94 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAI-ATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINP 165
           GN A   KDY  AI  +T+AI  +   N V ++NR+A Y+SLKK+ +A+ DA   +KINP
Sbjct: 12  GNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDATECVKINP 71

Query: 166 TYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEG 199
           ++SKGY+RLG A    G  +DA   YKK L+++ 
Sbjct: 72  SWSKGYNRLGAAHLGLGDLDDAESNYKKALELDA 105

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 45/83 (54%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           G +     D+  A+K YTE I   P +A  ++NRAAA + L  + EA+ D N AI+ +P 
Sbjct: 400 GKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 459

Query: 167 YSKGYSRLGFAKFAQGKAEDALE 189
           + + Y R   A+ A  +   ALE
Sbjct: 460 FVRAYIRKATAQIAVQEFAGALE 482

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 59/129 (45%), Gaps = 10/129 (7%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIK---- 162
           GNK    + +E AI+ Y +A   L  +  Y  NRAAA      Y+ A+     A++    
Sbjct: 266 GNKFYKARQFEEAIEHYNKAW-ELHRDITYLNNRAAAEYEKGDYETAIATLTDAVEQGRE 324

Query: 163 INPTY---SKGYSRLGFAKFAQGKAEDALEAYKKVL--DIEGDKATEMMKRDYETAKKKV 217
           +   Y   SK ++R+G A    G  +  ++ Y+K L      D  T++   + E  K + 
Sbjct: 325 MRADYKVISKSFARIGNAYHKLGDLKKTIDNYQKSLTEHRTADILTKLRNAEKELKKAEA 384

Query: 218 EQSLNLEKS 226
           E  +N EK+
Sbjct: 385 EAYINPEKA 393

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 83.2 bits (204), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 63/94 (67%), Gaps = 1/94 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAI-ATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINP 165
           GN A   KDY+ AI  +++AI  +   N V ++NR+A Y+SLKK+  A++DA   +KINP
Sbjct: 12  GNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAEECVKINP 71

Query: 166 TYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEG 199
           ++SKGY+R+G A F  G  ++A   YKK L+++ 
Sbjct: 72  SWSKGYNRVGAAHFGMGDLDEAEAGYKKALELDA 105

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 43/75 (57%)

Query: 115 DYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRL 174
           D+  A+K YTE I   P +A  ++NRAA  S L  + EA++D N AI+ +P + + Y R 
Sbjct: 412 DWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDCNKAIEKDPNFVRAYIRK 471

Query: 175 GFAKFAQGKAEDALE 189
             A+ A  +   ALE
Sbjct: 472 ATAQIAVREFSSALE 486

 Score = 33.5 bits (75), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 43/96 (44%), Gaps = 8/96 (8%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAY-------SSLKKYDEAVEDANS 159
           GNK    + ++ A+ KY EA      +  Y  NR+AA        +S+K  +EAVE    
Sbjct: 270 GNKLYKARQFDEAVAKYNEAWEAH-NDITYLNNRSAAEFEKGDYETSIKTLEEAVEKGRE 328

Query: 160 AIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVL 195
                   +K ++R+G         + A++ YKK L
Sbjct: 329 MRADYKVIAKSFARMGNCYTKLNDLKKAIDFYKKSL 364

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 63/94 (67%), Gaps = 1/94 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIA-TLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINP 165
           GN A   KD++ A++ +T AI  +   N V ++NR+ AY+SLKK+DEA+ DA   +KI  
Sbjct: 11  GNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDATECVKIKA 70

Query: 166 TYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEG 199
            +SKG++RLG A F  G  ++A E+YKK L+++ 
Sbjct: 71  DWSKGHNRLGAAHFGLGNLDEAEESYKKALELDA 104

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 52/91 (57%), Gaps = 4/91 (4%)

Query: 115 DYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRL 174
           D+  A+K Y+E I   P +A  ++NRAAA S L  + +A++D + AI+I+P++ + Y R 
Sbjct: 407 DWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCDKAIEIDPSFVRAYIRK 466

Query: 175 GFAKFAQGKAEDALEAYKKVLDIEGDKATEM 205
             A+ A  +   A+E     LD+   K  E+
Sbjct: 467 ATAQIAVQEYSAAIE----TLDVARTKDAEV 493

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 61/129 (47%), Gaps = 10/129 (7%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAY-------SSLKKYDEAVEDANS 159
           GN+    + ++ AI KY EA   L  +  Y  NRAAA        S++K  +EAVE    
Sbjct: 265 GNQLYKQRKFDEAIAKYEEAW-NLQKDITYLNNRAAAEYEKGDYNSAIKTLNEAVEQGRE 323

Query: 160 AIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEG--DKATEMMKRDYETAKKKV 217
                   +K ++RLG A +   + + A+E Y+K L      D   ++   + E  K++ 
Sbjct: 324 LRADYKVIAKSFARLGNAYYKLDEVKKAVEYYEKSLTEHRTPDVLNKLRNLEREIKKREA 383

Query: 218 EQSLNLEKS 226
           E  ++ EK+
Sbjct: 384 EAYIDPEKA 392

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 81.3 bits (199), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 63/93 (67%), Gaps = 1/93 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAI-ATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINP 165
           GN A   KDYE A + + +AI  +   N V ++NR+A Y+SLKK+ E ++DA   +KINP
Sbjct: 11  GNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDAEECVKINP 70

Query: 166 TYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIE 198
            +SKGY+R+G A+F     EDA ++Y+K L+++
Sbjct: 71  GWSKGYNRVGAAQFGLNNLEDAEKSYQKALELD 103

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 42/74 (56%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           G +  +  D+  A+K YTE I   P +A  ++NRAAA + L  + EA+ D + AI+ +P 
Sbjct: 389 GKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCDRAIEKDPN 448

Query: 167 YSKGYSRLGFAKFA 180
           + + Y R   A+ A
Sbjct: 449 FIRAYIRKASAQIA 462

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 81.3 bits (199), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 66/94 (70%), Gaps = 1/94 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPT-NAVYFANRAAAYSSLKKYDEAVEDANSAIKINP 165
           GN A   KDY  AI  +T+AI    T N V ++NR+A Y+S KK++EA++DA   +KI+P
Sbjct: 10  GNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAEECVKISP 69

Query: 166 TYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEG 199
           ++SKGY+R+G A+F   + ++A ++YK+ L+++ 
Sbjct: 70  SWSKGYNRVGAAQFGLSQLDEAEKSYKRALELDS 103

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 40/66 (60%)

Query: 115 DYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRL 174
           D+  A+K YTE +   P +A  F+NRAAA + L  + EA+ED N A+ I+P + + Y R 
Sbjct: 395 DWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCNKAVSIDPNFVRAYIRK 454

Query: 175 GFAKFA 180
             A+ A
Sbjct: 455 ATAQIA 460

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 45/96 (46%), Gaps = 8/96 (8%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKIN-- 164
           GNK    + +E AI+ Y +A   L  +  Y  NR+AA      YD A++  N A++    
Sbjct: 253 GNKLYKARQFEEAIEHYNKAW-ELHKDITYLNNRSAAEFEKGDYDTAIKTLNDAVEQGRE 311

Query: 165 -----PTYSKGYSRLGFAKFAQGKAEDALEAYKKVL 195
                 T +K ++R+G A +       A+E Y + L
Sbjct: 312 LRADYKTIAKSFARIGNAYYKLKDLRKAIEHYNRSL 347

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 80.9 bits (198), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 65/95 (68%), Gaps = 1/95 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPT-NAVYFANRAAAYSSLKKYDEAVEDANSAIKINP 165
           GN A A K Y+ A+  +T+AI    T N V ++NR+A+Y+S +K++EA++DA    KINP
Sbjct: 12  GNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDALECTKINP 71

Query: 166 TYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGD 200
           +++KGY+R G A F  G  +DA  +YKK L+++ +
Sbjct: 72  SWAKGYTREGAAHFGMGNLDDAEASYKKALELDAN 106

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 39/66 (59%)

Query: 115 DYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRL 174
           D+  A+K YTE I   P +A  ++NRAAA S L  + +A+ D N AI+ +P + + Y R 
Sbjct: 400 DWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCNKAIEKDPNFVRAYIRK 459

Query: 175 GFAKFA 180
             A+ A
Sbjct: 460 ATAQIA 465

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 49/96 (51%), Gaps = 8/96 (8%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAI----K 162
           GNKA   ++++ AI  Y +A   L  N  Y  NR+AA     +YD A+   N AI    +
Sbjct: 258 GNKAYKARNFDEAIACYNKAW-ELDNNITYLNNRSAAEFEKGEYDTAINTLNEAIEKGRE 316

Query: 163 INPTY---SKGYSRLGFAKFAQGKAEDALEAYKKVL 195
           +   Y   +K ++R+G A    G  ++A+  Y+K L
Sbjct: 317 MRADYKIIAKSFARIGNAYVKMGNLKEAINHYQKSL 352

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 80.5 bits (197), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 64/97 (65%), Gaps = 1/97 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPT-NAVYFANRAAAYSSLKKYDEAVEDANSAIKINP 165
           GN A   KDY+ AI  +T+AI    T N V ++NR+AAY+S K+Y++A+ DA+  IKINP
Sbjct: 12  GNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSDADECIKINP 71

Query: 166 TYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGDKA 202
           +++KGY+R G A     K E+A + Y + L I+ + A
Sbjct: 72  SWAKGYTRKGAALQGLHKYEEAEQCYNETLKIDPNNA 108

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 41/74 (55%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           G +     D+  A+K YTE I   P +A  ++NRAAA + L  + +A+ D N AI+ +P+
Sbjct: 392 GKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCNKAIEKDPS 451

Query: 167 YSKGYSRLGFAKFA 180
           + + Y R    + A
Sbjct: 452 FIRAYLRKATCQIA 465

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 57/127 (44%), Gaps = 15/127 (11%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAY-------SSLKKYDEAVEDANS 159
           GNKA   + ++ AI  Y +A  T   +  Y  NR+AA        + +K   EAVE+A  
Sbjct: 258 GNKAYKARQFDEAISHYNQAWETF-KDITYLNNRSAAEYEKGDYETCIKTLTEAVENARE 316

Query: 160 AIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQ 219
                   +K ++R+G A       + A+E Y+K L       TE    D  +  +K E+
Sbjct: 317 LRTDYKIVAKSFARMGNAYAKLDDLKKAIEYYQKSL-------TEHRTPDILSKLRKAEK 369

Query: 220 SLNLEKS 226
            L  +++
Sbjct: 370 DLKQQEA 376

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 80.5 bits (197), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 64/94 (68%), Gaps = 1/94 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAI-ATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINP 165
           GN A A KD+E AI+ + +AI  +   N V ++NR+A Y+S++K+ EA+ DA   ++I P
Sbjct: 11  GNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQECVRIKP 70

Query: 166 TYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEG 199
            +SKG++RLG A +  G  ++A E+YKK L+++ 
Sbjct: 71  DWSKGHNRLGAAHYGLGDLDEAEESYKKALELDS 104

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 42/74 (56%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           G +     D+  A+K YTE I   P +A  ++NRAAA + L  + +A++D + AI+ +P 
Sbjct: 395 GKEYFTNADWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCDMAIQKDPN 454

Query: 167 YSKGYSRLGFAKFA 180
           + + Y R   A+ A
Sbjct: 455 FVRAYIRKATAQIA 468

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 8/96 (8%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAY-------SSLKKYDEAVEDANS 159
           GN+    + ++ AI  Y +A   L  +  Y  NRAAA        S++K  ++AVE+   
Sbjct: 261 GNELYKKRQFDEAIANYEKAW-DLHKDITYLNNRAAAEYEKGDYESAIKTLEKAVEEGRE 319

Query: 160 AIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVL 195
                   +K ++RLG A +     + A+E Y+K L
Sbjct: 320 LRADYKVIAKSFARLGNAHYKLADLKKAIEYYEKSL 355

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 56/92 (60%), Gaps = 1/92 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTN-AVYFANRAAAYSSLKKYDEAVEDANSAIKINP 165
           GNK    K YE A+  +T A++   TN  + ++NRAAA+  LK Y EA+ED  + +++ P
Sbjct: 15  GNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGKNCVELAP 74

Query: 166 TYSKGYSRLGFAKFAQGKAEDALEAYKKVLDI 197
            + KGYSR+G A     K ++A E +KK L +
Sbjct: 75  NWDKGYSRVGVAYLGLQKLDEAEENFKKALQL 106

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 51/86 (59%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           G +    ++Y  A+K YTE I T PT+ V + NRAA +  L    + ++D + AI ++P+
Sbjct: 436 GKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKAISVDPS 495

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYK 192
           Y K Y R GFA+  +   ++ALE ++
Sbjct: 496 YIKAYVRKGFAQITERDLDEALETWE 521

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 64/114 (56%), Gaps = 4/114 (3%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN+    KD+E AI+ YT AI +L  + V+++NR+AAY S+  +++ VED  +A+K+ P 
Sbjct: 111 GNEFFKAKDFEKAIEYYTLAI-SLKEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPD 169

Query: 167 YSKGYSRLGFAKFAQGKAEDA---LEAYKKVLDIEGDKATEMMKRDYETAKKKV 217
           YSK + R   A    G+  DA   L A   + +  G    ++++R+      KV
Sbjct: 170 YSKCWLRRASAYENLGQFSDAMFDLSAVSLLGEYSGQSVEQLLERNMNKQATKV 223

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 46/71 (64%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GNK +A KDY  AI+ YT+AI      +++F+NRA A   L ++  A+ED++ AI+++ +
Sbjct: 16  GNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSKAIELDSS 75

Query: 167 YSKGYSRLGFA 177
             KGY R G A
Sbjct: 76  NVKGYHRRGMA 86

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 58/107 (54%), Gaps = 5/107 (4%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GNK +  K Y  A++ YT+AI    T +++F+NRA A   L  +   ++D NSA++++P 
Sbjct: 20  GNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNSALELDPK 79

Query: 167 -----YSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGDKATEMMKR 208
                + +G S+LG   F + K + ++    K  D    +A +M ++
Sbjct: 80  NIKAYHRRGLSQLGLLHFKKAKNDLSIVLKAKPSDATAKRALDMCEK 126

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 60/113 (53%), Gaps = 2/113 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GNK +  +D++ A + YT+AI T PT +++++NRA A   L  +  A+ D  +AI++N +
Sbjct: 16  GNKFLKQQDFQRANELYTKAIETDPTQSIFYSNRALANLKLDNFMNALNDCTNAIELNSS 75

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQ 219
             K Y R G A       + A   +  VL  + +    + K  ++T +K + +
Sbjct: 76  NLKAYHRRGLANIGLLNFKSARNDFNIVLKYKPNDI--IAKNGFDTCEKVIRE 126

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 60/113 (53%), Gaps = 2/113 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN A+  +DY  AI+ YTEAI    T ++YF+NRA  +  +  +   + D + A++I+P 
Sbjct: 19  GNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDKALEIDPK 78

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQ 219
             K Y R G +     + ++A +  K VL  + + AT   KR  +  +K + +
Sbjct: 79  NIKAYHRRGMSYIGLLEFKNAQKDLKIVLASKPNDAT--AKRGLDVCEKFIRE 129

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 43/71 (60%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN  +  +DY+ AI+ YT+AI    T++++++NRA A+  L  +  A+ D N AIK++  
Sbjct: 19  GNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDCNDAIKLDNN 78

Query: 167 YSKGYSRLGFA 177
             K Y R G A
Sbjct: 79  NIKAYHRRGLA 89

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 76/148 (51%), Gaps = 28/148 (18%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN+ +  KDY  A++ YT AI    T +++F+NRA A   L ++  A+ED+  AI+++  
Sbjct: 45  GNEWVKAKDYARAVEAYTRAIEADGTQSIFFSNRALANLKLDRFQSALEDSARAIELDAG 104

Query: 167 YSKGYSRLGFAK---FAQGKAEDAL----------EAYKKVLDIEGDKATEMMKRD-YET 212
             K Y R G A       G A+  L          EA ++ L++       M++R+ +E 
Sbjct: 105 NVKAYHRRGLAHCGLLEWGPAKRDLEVVVRAKPGDEAVRRALEV----CERMLRRERFER 160

Query: 213 A--------KKKVEQSLNLEKSTVSGNA 232
           A        ++++ ++L+L  ++ +GNA
Sbjct: 161 AIRADGDEEQRRLCKTLSL--ASFAGNA 186

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 42/71 (59%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN  +  +D+  AI  YT+AI    T ++YF+NRA A+  L  +  ++ D + A+K++P 
Sbjct: 19  GNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSLNDCDEALKLDPK 78

Query: 167 YSKGYSRLGFA 177
            +K Y R G +
Sbjct: 79  NAKAYHRRGLS 89

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 72/147 (48%), Gaps = 22/147 (14%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN+ +   DY+ AI+ Y++AIA   T ++YF+NRA A+     +  AV D ++A+K++P 
Sbjct: 19  GNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYSAVVDCDNALKLDPK 78

Query: 167 YSKGYSR-----LGFAKFAQGKAEDALEAYKKVLDIEGD---KATEMMKRDY-------- 210
             K Y R     +G  +F + K +  +    K  DI      K  E   R+         
Sbjct: 79  NIKAYHRRGLSYVGILEFRKAKNDLNVVLKAKPNDITASNALKVCENFIREERFKNAIGG 138

Query: 211 --ETAKKKVEQSLNLEKSTVSGNATAE 235
             + AK  + Q+LNLE    S NA A+
Sbjct: 139 SGDNAKSNICQTLNLE----SFNANAD 161

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 40/71 (56%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN  +  +DY  AI+KY +AI    T +VYF+NRA  +  L  +  A +D + A+ ++P 
Sbjct: 16  GNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDKALALDPK 75

Query: 167 YSKGYSRLGFA 177
             K Y R G A
Sbjct: 76  NVKAYHRRGLA 86

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 40/67 (59%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN  +  K +  AI+KYTEAI    T ++YF+NRA A+  +  +  A+ D + AIK++P 
Sbjct: 19  GNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPK 78

Query: 167 YSKGYSR 173
             K Y R
Sbjct: 79  NIKAYHR 85

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 40/67 (59%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN  +  K +  AI+KYTEAI    T ++YF+NRA A+  +  +  A+ D + AIK++P 
Sbjct: 19  GNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPK 78

Query: 167 YSKGYSR 173
             K Y R
Sbjct: 79  NIKAYHR 85

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 42/71 (59%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN  + GK++  A + Y++AI    T ++YF+NRA A+  L  +  A+ D N AI+++P 
Sbjct: 19  GNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDCNKAIELDPK 78

Query: 167 YSKGYSRLGFA 177
             K Y R G +
Sbjct: 79  NVKAYHRRGLS 89

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN+    K YE AIK Y+ A+  L  + V+++NR+A +  L K ++ VED  +A+++ P 
Sbjct: 105 GNECFKEKKYEEAIKYYSCAL-RLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPD 163

Query: 167 YSKGYSRLGFAKFAQGKAEDAL 188
           YSK   R   A  + G   DA+
Sbjct: 164 YSKCLLRRATANESLGNFADAM 185

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN+    + YE AIK Y  A+  L  + V+++NR+A Y  L K ++ VED  +A+K+ P 
Sbjct: 102 GNECFKDQRYEEAIKFYDCAL-KLKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPD 160

Query: 167 YSKGYSRLGFAKFAQGKAEDAL 188
           YSK   R   A  + G   DA+
Sbjct: 161 YSKCLLRRATANESLGNYADAM 182

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN+    K +E A+K Y+ AI  +  + V+++NR+A Y SL + ++ VED  +A+K+ P 
Sbjct: 103 GNEFFKNKQFEDALKYYSLAI-EVKEDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPD 161

Query: 167 YSKGYSRLGFAKFAQGKAEDAL 188
           YSK   R   A  + GK  DA+
Sbjct: 162 YSKCLLRRASANESLGKFADAM 183

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 39/67 (58%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN  +  K +  AI+KYTEAI    T  +YF+NRA ++  +  +  A+ D + AIK++P 
Sbjct: 19  GNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDEAIKLDPK 78

Query: 167 YSKGYSR 173
             K Y R
Sbjct: 79  NIKAYHR 85

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 50/97 (51%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN  +  ++Y  AI+ Y++AI   PT +++F+NRA A   L  +   + D + A++++P 
Sbjct: 19  GNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQSCMNDCDVALRLDPK 78

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGDKAT 203
             K Y R G +     + + A    + VL  +   AT
Sbjct: 79  NIKAYHRRGLSHLGLLQCKKARNDLQVVLKAKPTDAT 115

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 44/76 (57%), Gaps = 8/76 (10%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN     KD+E AIK YT A+ +L  + VY++N +A YSSL  Y++ +E A  A+ + P 
Sbjct: 102 GNALFKKKDFENAIKYYTFAL-SLKEDPVYYSNISACYSSLLNYEKVIEMATKALALRPD 160

Query: 167 YSK-------GYSRLG 175
           YSK        Y +LG
Sbjct: 161 YSKVLVRRANAYEKLG 176

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 40/67 (59%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN  +  K +  AI+KYT+AI    T ++YF+NRA A+  +  +  A+ D + A+K++P 
Sbjct: 19  GNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEALKLDPK 78

Query: 167 YSKGYSR 173
             K Y R
Sbjct: 79  NIKAYHR 85

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN+      +E AIK Y  A+  L  + +Y++N +A Y+SL +Y++ +E A  A+K+ PT
Sbjct: 117 GNELFKTSKFEDAIKYYHYAL-KLKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPT 175

Query: 167 YSKGYSRLGFAKFAQGKAEDAL 188
           +SK   R   A  A G   DA+
Sbjct: 176 FSKVLMRRALAYEAMGNFGDAM 197

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 52/100 (52%), Gaps = 14/100 (14%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GNK    KDY  AIK Y  A+  L  + ++++N +A Y SL + D+ +E +  A+++NP 
Sbjct: 129 GNKYFKAKDYTNAIKYYNLAL-DLNKDPIFYSNISACYVSLGQLDKVIESSTKALELNPN 187

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYK------KVLDIEGD 200
           YSK   R       +  A ++LE Y        VL + GD
Sbjct: 188 YSKALLR-------RASANESLENYSDALFDLSVLSLNGD 220

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN+    K Y+ AI+ Y+ AI  +  + V+++NR+A Y SL + ++ VED  +A+K+ P 
Sbjct: 102 GNEFFKNKKYDEAIQYYSWAI-EVKEDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPD 160

Query: 167 YSKGYSRLGFAKFAQGKAEDAL 188
           YSK   R   A  + G   DA+
Sbjct: 161 YSKCLLRRASANESLGNFADAM 182

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 62/146 (42%), Gaps = 22/146 (15%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATL----PTNAVYFANRAAAYSSLKKYDEAVEDANSAIK 162
           GN+    K Y+ A + Y + I         N   F+NRAA    LK Y   V D   A++
Sbjct: 85  GNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELKNYRRCVNDCRQALQ 144

Query: 163 INPTYSKGYSRLGFAKFAQGKAEDALEA-----------------YKKVLDIEGDKATEM 205
            NPT  K + R+  A F   K EDA EA                  +KV+  E DK    
Sbjct: 145 FNPTNIKCFYRIARAFFLLDKCEDAKEAIEFGLKLDSESAALKALLQKVIKREEDKKAHE 204

Query: 206 MKRDYETAKKKVEQSLNLEKSTVSGN 231
            KR  E  +K+  ++L LE S +  N
Sbjct: 205 AKRLREETEKEKLKTL-LEASLILRN 229

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 42/85 (49%), Gaps = 4/85 (4%)

Query: 107 GNKAMAGKDYELAIKKYTEAIAT----LPTNAVYFANRAAAYSSLKKYDEAVEDANSAIK 162
           GN+    K ++ A + YT+ IA        N   FANRAA    LK Y   +ED + A+ 
Sbjct: 90  GNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNYRRCIEDCSKALT 149

Query: 163 INPTYSKGYSRLGFAKFAQGKAEDA 187
           INP   K Y R   A F+  K E+A
Sbjct: 150 INPKNIKCYYRTSKAFFSLSKLEEA 174

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 73/149 (48%), Gaps = 30/149 (20%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINP- 165
           GN  +  K Y  A++ Y++AI    T +++F+NRA +   L  +  A+ED N +I+++P 
Sbjct: 19  GNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNKSIELDPK 78

Query: 166 ----TYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGD-----KATEMMKR-------- 208
                + +G S +G  +F++ + +      K +L ++ +     KA E+ +R        
Sbjct: 79  NIKAIHRRGLSYVGLLEFSKARKD-----LKTILQVKPNEQSALKALEVCERFIREERFK 133

Query: 209 -----DYETAKKKVEQSLNLEKSTVSGNA 232
                D E +K  V  SL L  S+  GNA
Sbjct: 134 KAISGDGEESKVNVCASLQL--SSFDGNA 160

 Score = 33.9 bits (76), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 38/75 (50%)

Query: 134 AVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKK 193
           A+ F N+  A+   KKY EAVE  + AI+++ T S  +S   F++        ALE   K
Sbjct: 12  ALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNK 71

Query: 194 VLDIEGDKATEMMKR 208
            ++++      + +R
Sbjct: 72  SIELDPKNIKAIHRR 86

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 54/100 (54%), Gaps = 14/100 (14%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN+    KDY+ A+K Y  A+ TL  + V+++N +A Y S+ + D+ VE++  A+++ P 
Sbjct: 113 GNEFFKQKDYDNALKYYDYAL-TLKKDPVFYSNISACYVSMNQLDKVVENSTKALELKPD 171

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYK------KVLDIEGD 200
           YSK   R       +  A ++LE Y        VL + GD
Sbjct: 172 YSKALLR-------RASANESLENYPDAMFDLSVLSLNGD 204

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 42/85 (49%), Gaps = 4/85 (4%)

Query: 107 GNKAMAGKDYELAIKKYTEAIAT----LPTNAVYFANRAAAYSSLKKYDEAVEDANSAIK 162
           GN+    K ++ A + YT+ +A        N   FANRAA    LK Y + VED   A+ 
Sbjct: 90  GNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNYRKCVEDCGKALT 149

Query: 163 INPTYSKGYSRLGFAKFAQGKAEDA 187
           INP   K Y R+  + F   K E+A
Sbjct: 150 INPKNIKCYYRISKSFFQLRKLEEA 174

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 38/71 (53%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN  +  ++Y  AI+ YT+AI   P  +++++NRA A   L  +  A  D N A+ ++  
Sbjct: 19  GNVFIKEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDNFQSAYNDCNEALTLDSK 78

Query: 167 YSKGYSRLGFA 177
             K Y R G A
Sbjct: 79  NVKAYHRRGLA 89

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 62/133 (46%), Gaps = 8/133 (6%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN     K+++ AIK Y  AI   P + V+++N +A Y S    ++ VE    A++I P 
Sbjct: 132 GNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPD 191

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGD----KATEMMKRDYETAKKKVEQSLN 222
           +SK   R   A  + G   DA+     VL + GD        M++R+      KV   LN
Sbjct: 192 HSKALLRRASANESLGNFTDAMFDL-SVLSLNGDFDGASIEPMLERNLNKQAMKV---LN 247

Query: 223 LEKSTVSGNATAE 235
              S  SG+  +E
Sbjct: 248 ANLSKNSGDRGSE 260

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 37/75 (49%)

Query: 134 AVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKK 193
           AV   ++   + + K +D+A++    AI+++P     YS +     + G     +E   K
Sbjct: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184

Query: 194 VLDIEGDKATEMMKR 208
            L+I+ D +  +++R
Sbjct: 185 ALEIKPDHSKALLRR 199

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN     KDYE AI  Y  A+  L  + V+++N AA Y SL+   EA+E  + A+++NP 
Sbjct: 93  GNAYFKVKDYENAINYYKFAL-QLKNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151

Query: 167 YSKGYSRLGFAKFAQGKAEDAL 188
           YSK   +        GK  DAL
Sbjct: 152 YSKVLLKRAAVYENIGKFADAL 173

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN+    KD E AIK Y  A+  L  + V+++N +A Y ++ + D+ +E +N A+++ P 
Sbjct: 165 GNQYFKSKDNENAIKYYEYAL-RLDQDPVFYSNISACYFAMNQLDKVIESSNKALELKPD 223

Query: 167 YSKGYSRLGFAKFAQGKAEDAL 188
           YSK   R   A  A G  ++AL
Sbjct: 224 YSKALLRRANAYEALGNNKEAL 245

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 53/100 (53%), Gaps = 14/100 (14%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN+    KDY+ A+K Y  A+  +  + V+++N +A Y SL + D+ VE++  A+++ P 
Sbjct: 108 GNEFFKKKDYDNALKYYNYAL-VVKKDPVFYSNISACYVSLGQLDKVVENSTKALELKPD 166

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYK------KVLDIEGD 200
           YSK   R       +  A ++LE Y        VL + GD
Sbjct: 167 YSKALLR-------RASANESLENYADAMFDLSVLSLNGD 199

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN+    KDYE A+K Y  A+  L  + V+++N +A Y SL + D+ +E +  A+++ P 
Sbjct: 115 GNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTKALELKPD 173

Query: 167 YSKGYSR 173
           YSK   R
Sbjct: 174 YSKALLR 180

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 48/100 (48%), Gaps = 14/100 (14%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN       +E AIK Y  AI  L  N ++++N +A Y SL K +E ++  N A+++ P 
Sbjct: 118 GNSLFKADKFEEAIKYYNWAI-ELKENPIFYSNLSACYVSLNKLEEIIKYCNKALELKPD 176

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYK------KVLDIEGD 200
           YSK   R       +  A + LE Y        VL + GD
Sbjct: 177 YSKVLLR-------RANANEKLENYADAMFDLSVLSLNGD 209

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 46/84 (54%), Gaps = 5/84 (5%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINP- 165
           GN  +  K Y+ A++ Y++AI    T ++YF+NRA +   L  +  A ED + AI ++P 
Sbjct: 17  GNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCDKAIALDPK 76

Query: 166 ----TYSKGYSRLGFAKFAQGKAE 185
                + +G S +G  +F + + +
Sbjct: 77  NIKAIHRRGLSYVGLLEFFKARKD 100

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 27/46 (58%)

Query: 134 AVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKF 179
           A+ F N+  AY   KKY EAVE  + AI+++ T S  +S   F++ 
Sbjct: 10  ALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRL 55

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 62/132 (46%), Gaps = 13/132 (9%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GNK +  K Y  A + YT+AI   P N + ++NRA     L  +  +++DA  AI+++  
Sbjct: 20  GNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLDNFQSSLDDAKRAIELDNN 79

Query: 167 YSKGYSR-----LGFAKFAQGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSL 221
             K Y R     +G  +F + +        K ++ +   K  E+  ++      KV Q  
Sbjct: 80  NLKAYHRRAMSYIGLLEFRKAR--------KDLIIVLKFKPNELTAKNALAICDKVIQKE 131

Query: 222 NLEKSTVSGNAT 233
           N EK+   G+++
Sbjct: 132 NFEKAISGGDSS 143

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 45/94 (47%), Gaps = 1/94 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN     K +  AIK Y  AI   P + V+++N +A Y S    D+ VE    A++I P 
Sbjct: 138 GNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPD 197

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGD 200
           +SK   R   A  + G   DA+     VL + GD
Sbjct: 198 HSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 230

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN+    K ++ AIK Y  A+  L  + V+++NR+A Y S+ + ++ VED  +A+K+   
Sbjct: 109 GNEFFKEKKFDDAIKYYNLAL-ELKKDPVFYSNRSACYVSMGQLEKVVEDTTAALKLKSD 167

Query: 167 YSKGYSRLGFAKFAQGKAEDAL 188
           YSK   R   A  + G   DA+
Sbjct: 168 YSKCLLRRASANESLGNYADAM 189

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 36/72 (50%), Gaps = 4/72 (5%)

Query: 123 YTEAIATL----PTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAK 178
           YT+ I         N   FANRAA    LK Y   V D   A++INP   K + R+G A 
Sbjct: 108 YTKGIKVFCEDKSINESLFANRAACELELKNYRSCVADCQKAMEINPMNLKCFYRMGKAF 167

Query: 179 FAQGKAEDALEA 190
            A GK ++A +A
Sbjct: 168 LALGKFKEAHDA 179

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 41/85 (48%), Gaps = 4/85 (4%)

Query: 107 GNKAMAGKDYELAIKKYTEAIAT----LPTNAVYFANRAAAYSSLKKYDEAVEDANSAIK 162
           GN+    K ++ A + Y++ +A        N   +ANRAA    LK Y   +ED + A+ 
Sbjct: 90  GNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCIEDCSKALT 149

Query: 163 INPTYSKGYSRLGFAKFAQGKAEDA 187
           INP   K Y R   A F   K E+A
Sbjct: 150 INPKNVKCYYRTSKAFFQLNKLEEA 174

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 56/126 (44%), Gaps = 13/126 (10%)

Query: 107 GNKAMAGKDYELAIKKYTEAIAT----LPTNAVYFANRAAAYSSLKKYDEAVEDANSAIK 162
           GN    GK ++ A   Y +A+      L  N   + N AA    +K Y   +     A+K
Sbjct: 77  GNDLYKGKRFKDARAMYLKALDVKCDVLSINESLYLNLAACELEIKNYRSCINYCREALK 136

Query: 163 INPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGD---------KATEMMKRDYETA 213
           +N    K + R+G A    G+ ED+LEA +  L ++ +         KATE +KR  E  
Sbjct: 137 LNAKNVKAFFRIGKAYLELGRFEDSLEAVQVGLAVDPENGALKSIQSKATEKLKRKKELE 196

Query: 214 KKKVEQ 219
            + + Q
Sbjct: 197 NRTLAQ 202

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 48/94 (51%), Gaps = 2/94 (2%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN     K +E AI+ Y  AI  L  + V+ +N +A Y SL   D+ VE +  A+++ P 
Sbjct: 100 GNALFKEKRFEDAIEFYNHAI-KLHEDPVFHSNISACYVSLGDLDKVVESSTRALELKPD 158

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGD 200
           YSK   R   A    G+ +DA+     VL + GD
Sbjct: 159 YSKALLRRASAYENMGRYQDAMFDI-SVLSLNGD 191

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 29/55 (52%)

Query: 133 NAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDA 187
           N   FAN+AA    LK Y   +ED + A+ INP  +K Y R   A F   K E+A
Sbjct: 120 NESLFANKAACELELKNYRRCIEDCSKALSINPKNTKCYYRTSKAFFQLNKLEEA 174

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 45/94 (47%), Gaps = 1/94 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN     K++  AIK Y  AI   P   V+++N +A Y S    ++ +E    A++I P 
Sbjct: 134 GNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPD 193

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGD 200
           +SK   R   A  + G   DA+     VL + GD
Sbjct: 194 HSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 226

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 38/75 (50%)

Query: 134 AVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKK 193
           AV   NR   + + K ++EA++    AI+++P     YS +     + G  E  +E   K
Sbjct: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTK 186

Query: 194 VLDIEGDKATEMMKR 208
            L+I+ D +  +++R
Sbjct: 187 ALEIKPDHSKALLRR 201

>Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON}
           complement(17836..20034) [2199 nt, 733 aa]
          Length = 732

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 51/103 (49%), Gaps = 2/103 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           G   M   DY  A + + +A+     N +++ +    Y  + +Y +A++    AI++NP 
Sbjct: 293 GRIHMIRSDYNAAYEAFQQAVNRDARNPIFWCSIGVLYYQIYQYRDALDAYTRAIRLNPY 352

Query: 167 YSKGYSRLG-FAKFAQGKAEDALEAYKKVLDIEGDKATEMMKR 208
            S+ +  LG   +    +  DAL+AYK+   +E D  T + +R
Sbjct: 353 ISEVWYDLGTLYETCNNQLTDALDAYKQAARLEPDN-THIRER 394

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 36/76 (47%)

Query: 120 IKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKF 179
           I+ Y   +A  P +     + A  Y S   +D+AV     A+ ++ T ++ +S LG +  
Sbjct: 55  IRAYHSVLAHDPLSVTALVSLANFYRSTDAFDKAVHYYEKAVALDSTLAEVWSLLGHSYL 114

Query: 180 AQGKAEDALEAYKKVL 195
              + + A  AY++ L
Sbjct: 115 MLDELQKAYNAYQQAL 130

>Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON}
           (123502..125622) [2121 nt, 707 aa]
          Length = 706

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 50/103 (48%), Gaps = 12/103 (11%)

Query: 131 PTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEA 190
           P     + N +A Y  L++ D+A E ++  I I P   KGY R+G     QGK  +A + 
Sbjct: 68  PKLVKLYDNLSATYEKLQELDKAYESSSRMIHIEPYNMKGYIRMGKVLQRQGKDPEAYKC 127

Query: 191 YKKVL-----------DIEGDKATEMMKRDYETAKKKV-EQSL 221
           YKK L            +  +K  +++K+  +  KK++  QSL
Sbjct: 128 YKKGLLMSREMLQKFDIVVPEKFRDIIKQQRDIVKKRINNQSL 170

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 56/130 (43%), Gaps = 19/130 (14%)

Query: 107 GNKAMAGKDYELAIKKYTEAIA----TLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIK 162
           GN     K +  A + YT+ I         N   +ANRAA    LK +   + D  +A+ 
Sbjct: 85  GNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRSCISDCKTALT 144

Query: 163 INPTYSKGYSRLGFAKFAQGKAEDALE-------------AYKKVLDIEGDKATEMMKRD 209
            NP   K Y R+G A  A  K E A E             +++ +L+I  +K  E+  R 
Sbjct: 145 YNPKNIKCYFRMGKAFTAINKFESARESIEFGQKIDNDNKSFENLLNIIKNKEEEI--RK 202

Query: 210 YETAKKKVEQ 219
           YE  K K +Q
Sbjct: 203 YEEKKLKAQQ 212

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 40/88 (45%), Gaps = 4/88 (4%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATL----PTNAVYFANRAAAYSSLKKYDEAVEDANSAIK 162
           GN     + Y+ A + Y + +         N   F NRAA    LK +   + D   A++
Sbjct: 87  GNDLYRARRYKDARELYNKGVEVHCDDDAINESLFLNRAACELELKNHRRCINDCKEALR 146

Query: 163 INPTYSKGYSRLGFAKFAQGKAEDALEA 190
            NP   K + R+G A F+  K E+A EA
Sbjct: 147 YNPKNVKCFYRMGRAFFSLNKLEEAKEA 174

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 29/58 (50%)

Query: 133 NAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEA 190
           N   FANRAA    LK Y   + D   A+ +NP   K Y R+G A +     E+A E+
Sbjct: 117 NEALFANRAACQLELKNYRSCINDCKHALTLNPKNIKCYYRMGKAFYLLNNIEEAKES 174

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 39/67 (58%), Gaps = 1/67 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN     +D+E A+K Y  A+ TL  + V+++N +A Y SL + ++ VE +  A+K+   
Sbjct: 112 GNDYFKKQDFENALKYYNYAL-TLKQDPVFYSNISACYVSLGQLEKVVESSTEALKLKHD 170

Query: 167 YSKGYSR 173
           YSK   R
Sbjct: 171 YSKALLR 177

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN+    K  E AIK Y  A+     + V++AN +A Y SL  +++ +E+ N A+++ P 
Sbjct: 113 GNELFKEKAVEEAIKYYQWAL-EFKKDPVFYANISACYVSLNDFEKVLENCNKALELKPD 171

Query: 167 YSKGYSR 173
           YSK   R
Sbjct: 172 YSKVLLR 178

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 46/94 (48%), Gaps = 1/94 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN     K++  AIK Y  AI   P + V+++N +A Y S    ++ +E    A++I P 
Sbjct: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPD 190

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGD 200
           +SK   R   A  + G   DA+     VL + GD
Sbjct: 191 HSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 223

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 37/77 (48%)

Query: 132 TNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAY 191
           T AV   N+   + + K + EA++    AI+++P     YS +     + G     LE  
Sbjct: 122 TYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYT 181

Query: 192 KKVLDIEGDKATEMMKR 208
            K L+I+ D +  +++R
Sbjct: 182 TKALEIKPDHSKALLRR 198

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 48/94 (51%), Gaps = 2/94 (2%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN+    K Y+ AIK Y  A+  L  + V+++N +A Y S+    + VE +  A+++ P 
Sbjct: 106 GNQFFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGD 200
           YSK   R   A    GK  DA+     VL + GD
Sbjct: 165 YSKVLLRRASANEGLGKFADAMFDL-SVLSLNGD 197

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 50/94 (53%), Gaps = 2/94 (2%)

Query: 133 NAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAYK 192
           N   +ANRAA    +K Y   + D   A+++NP   K Y R+  A  A  + ++ALE+ +
Sbjct: 118 NESLYANRAACELEIKNYRRCINDCKQALQLNPKNIKCYYRIAKAFTALERLDEALESIE 177

Query: 193 KVLDIEG-DKATEMMKRDYETAKKKVE-QSLNLE 224
               I+  +K+ + +K   ET + ++E + L LE
Sbjct: 178 FGEKIDNTNKSLKTLKLHIETKQLEIEARRLKLE 211

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 54/107 (50%), Gaps = 5/107 (4%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN  +  +D+  A + YT+AI    T +++F+NRA A+     +  ++ D + A++++  
Sbjct: 19  GNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCDKALELDSK 78

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYKKVL-----DIEGDKATEMMKR 208
             K Y R G +     + + A    K VL     D+  D+A ++ ++
Sbjct: 79  NIKAYHRRGLSYVGLLEFKKARTDLKTVLKSKPGDVAADRALQICEK 125

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%)

Query: 137 FANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEA 190
           FAN+AA    LK +   + D  +A+++NP   K Y R+  A FA  K E+A E+
Sbjct: 118 FANKAACELELKNFRRCINDCKNALQLNPKNVKCYFRMTRAFFALDKLEEAKES 171

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKI 163
           GN      DYE A+  Y +AI   P+N + ++N A     L+K+ EAV+  N  +K+
Sbjct: 11  GNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACNKGLKM 67

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 28/56 (50%)

Query: 135 VYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEA 190
           +   NRAA    LK Y   + D   A+K+NP   K + R+G A     K E+A EA
Sbjct: 116 LLLLNRAACELELKNYRRCINDCREALKLNPKNPKAFFRIGKAFLQLDKLEEAAEA 171

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN+    + YE A+K Y  A+  L  + V+++N +A Y SL   ++ VE +  A+++ P 
Sbjct: 106 GNQFFKEQKYEDALKYYNYAL-DLKQDPVFYSNISACYVSLGNLEKVVESSTKALELKPD 164

Query: 167 YSKGYSR 173
           YSK   R
Sbjct: 165 YSKALLR 171

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 47/94 (50%), Gaps = 2/94 (2%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN+    K Y+ AIK Y  A+  L  + V+++N +A Y S+    + VE +  A++I P 
Sbjct: 106 GNQYFRNKKYDDAIKYYNWAL-ELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPD 164

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGD 200
           YSK   R   A    G   DA+     VL + GD
Sbjct: 165 YSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 39/63 (61%), Gaps = 4/63 (6%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN+     +Y+LAI++Y + I+  PTNAV ++N A AY  LK  +   ++A +A ++  +
Sbjct: 42  GNEHFKKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAY--LK--NRCPDEAKTACEMGLS 97

Query: 167 YSK 169
           Y K
Sbjct: 98  YCK 100

>NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {ON}
           Anc_8.470
          Length = 578

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 120 IKKYTEAIATLPTN-AVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAK 178
           IKK+     +LP + A     R   Y +   +D+ +E    ++KINP     ++RLG + 
Sbjct: 416 IKKFNRLAESLPEHDAKLELIRGLLYYAEDDFDKTIECFKESLKINPNDEVMWNRLGASL 475

Query: 179 FAQGKAEDALEAYKKVLDI 197
               K EDA++AY + L++
Sbjct: 476 ANSNKPEDAIQAYHRALNL 494

>KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 689

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 46/94 (48%), Gaps = 10/94 (10%)

Query: 139 NRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAED--ALEAYKKVLD 196
           NRAA +  +    +A++DAN A +  P   K Y R G  K  Q    D  ALE Y+    
Sbjct: 76  NRAATWEKIGDLKKALKDANRATRFEPYNLKCYLRRG--KILQKLRMDGQALENYE---- 129

Query: 197 IEGDKATEMMKRDYET-AKKKVEQSLNLEKSTVS 229
            EG KA   M R Y     KK+ ++L  +K+ VS
Sbjct: 130 -EGVKAIRDMTRKYHLDPPKKLYEALEYQKNLVS 162

>ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR080W (DIA2)
          Length = 685

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 34/70 (48%)

Query: 131 PTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEA 190
           P   V   NRAA +  L K D A+ DA   I ++    KGY R G      G+ E+AL+ 
Sbjct: 67  PRFFVLLDNRAATFEKLNKLDRALADAAYMITVDAYNLKGYIRRGKVLQKLGRYEEALQV 126

Query: 191 YKKVLDIEGD 200
           Y+  L   G+
Sbjct: 127 YENGLKQAGE 136

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 60/130 (46%), Gaps = 11/130 (8%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATL----PTNAVYFANRAAAYSSLKKYDEAVEDANSAIK 162
           GN+    K Y  A + YT+ I         N   +ANRAA    LK + + +ED   A+ 
Sbjct: 81  GNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNFRKCIEDCKKALS 140

Query: 163 INPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGDKAT------EMMKRDYETAKKK 216
            N    K Y R+G A  +  + +++ E+ +  L I+ +  +       + KR  E  ++K
Sbjct: 141 FNVKNIKCYYRMGKAFLSVDRFDESKESIEFGLKIDSENKSLKNLLQAIEKRQLEIQRRK 200

Query: 217 -VEQSLNLEK 225
            +E  + LEK
Sbjct: 201 DMEMKIKLEK 210

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 47/94 (50%), Gaps = 2/94 (2%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN+    K Y+ AIK Y  A+  L  + V+++N +A Y S+    + VE +  A+++ P 
Sbjct: 106 GNQYFRNKKYDDAIKYYNWAL-ELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGD 200
           YSK   R   A    G   DA+     VL + GD
Sbjct: 165 YSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 47/94 (50%), Gaps = 2/94 (2%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN+    K Y+ AIK Y  A+  L  + V+++N +A Y S+    + VE +  A+++ P 
Sbjct: 106 GNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGD 200
           YSK   R   A    G   DA+     VL + GD
Sbjct: 165 YSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 42/88 (47%), Gaps = 11/88 (12%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN      DYE AI  Y +A A   +N +YF+N A A   L+++ EAV   +        
Sbjct: 48  GNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAVNACD-------- 99

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYKKV 194
             KG +++ F      K +  LE ++++
Sbjct: 100 --KGLNKVSFKTGMDSKTKQKLE-WRRI 124

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 28/59 (47%)

Query: 132 TNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEA 190
            N   +ANRAA    LK Y   + D   A+ +NP   K Y R+  A  A  K +D  EA
Sbjct: 110 INESLYANRAACELELKNYRRCINDCKMALSLNPKNIKCYFRMAKAFLAIEKFDDCKEA 168

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%)

Query: 133 NAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDA 187
           N   +ANRAA    +K Y   + D  +A++ NP   K Y R+G A  A    E+A
Sbjct: 115 NESLYANRAACELEIKNYRRCLNDCKTALQYNPKNLKCYYRMGKAFLALELLEEA 169

>Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON}
           similar to Ashbya gossypii ADR230W
          Length = 688

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 52/112 (46%), Gaps = 11/112 (9%)

Query: 131 PTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAED--AL 188
           P   +   NRAA++  +    +A+ DA+  IK++    KGY R G  K  Q  A+D  AL
Sbjct: 67  PRYLILLDNRAASWERINNLGKALIDADRMIKVDAYNLKGYIRKG--KILQKMAQDKEAL 124

Query: 189 EAYKKVL-------DIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNAT 233
             Y++ L        +  +K         E  K +V + LNL+K T +  A+
Sbjct: 125 YVYREGLSKAKEAYQLHFEKPPSKFVEIVEHQKNEVIKRLNLQKLTPTTGAS 176

>KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|Q06677 Saccharomyces
           cerevisiae YDR320C SWA2 auxilin-like protein
          Length = 623

 Score = 37.7 bits (86), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 68/139 (48%), Gaps = 31/139 (22%)

Query: 115 DYELAIKKYTEAIATLPT----NAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYS-- 168
           DY  A + Y +++ +LP       V F+N       + +Y EA+ DA+SA+K+ P  S  
Sbjct: 340 DYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSDASSALKLIPQGSMN 399

Query: 169 ---------KGYSRLGFAKFAQGKA---------EDALEAYKKVLDIEGDKATEMMKRDY 210
                    K Y    ++K    KA         E ALE Y+++++  G  ++++++   
Sbjct: 400 SNIPNLNPPKTYKEF-WSKIMNNKAVAFERVENYEKALETYQQLIEA-GVTSSKVLE--- 454

Query: 211 ETAKKKVEQSLNLEKSTVS 229
             A+++ ++++ LEK  VS
Sbjct: 455 --ARRQCQKAIALEKKPVS 471

>SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 690

 Score = 37.7 bits (86), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 3/53 (5%)

Query: 139 NRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAY 191
           NRAA++  L K D+A++DA + I++ P   K Y R G  K  Q   +D  EAY
Sbjct: 76  NRAASWEKLGKLDKALKDAKNMIRVEPHNLKCYIRCG--KILQKLNKDK-EAY 125

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 37.4 bits (85), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 36/88 (40%), Gaps = 4/88 (4%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATL----PTNAVYFANRAAAYSSLKKYDEAVEDANSAIK 162
           GN     K Y+ A + Y   I         N   F+NRAA    LK Y   V D   A++
Sbjct: 85  GNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELELKNYRRCVNDCKRALQ 144

Query: 163 INPTYSKGYSRLGFAKFAQGKAEDALEA 190
            N    K Y R+  A     K EDA +A
Sbjct: 145 YNVKNIKCYYRIAKAFLLLNKLEDAKQA 172

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 35.8 bits (81), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 42/93 (45%), Gaps = 7/93 (7%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINP- 165
           GN+      Y++A + Y + +   P N + ++N+A A   L +Y E VE     +   P 
Sbjct: 10  GNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKGLTFTPN 69

Query: 166 TYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIE 198
           T    Y +L +      + E AL+  K V D E
Sbjct: 70  TTDTVYKKLNY------RLEMALKNMKHVNDQE 96

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 34.7 bits (78), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIK-INP 165
           GN      +Y  A++ Y + I   P N + ++N A +   L KY EA+E   + +K +N 
Sbjct: 10  GNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTGLKYVND 69

Query: 166 TYSKGYSRLGF 176
             S+ Y +L +
Sbjct: 70  ADSQVYKKLQY 80

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 34/79 (43%), Gaps = 7/79 (8%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAI----- 161
           GN A    ++  A + Y + I   P N + ++NRA A   L+K+ E ++     +     
Sbjct: 11  GNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQRGLGKLED 70

Query: 162 --KINPTYSKGYSRLGFAK 178
             K  P   K   RL  A+
Sbjct: 71  NEKDEPIRKKLLYRLHLAQ 89

>NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON}
           Anc_8.470
          Length = 590

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 32/49 (65%)

Query: 150 YDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIE 198
           +D+ +E   +A+KINP     ++RLG +     ++E+A++AY K ++++
Sbjct: 457 FDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLK 505

>Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {ON}
           YBL084C (CDC27) - component of the anaphase-promoting
           complex [contig 33] FULL
          Length = 628

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 41/89 (46%)

Query: 115 DYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRL 174
            YE  +  + +A +  P N +       A   L   + A+++ + A ++ P  S    + 
Sbjct: 493 QYEECLLHFEKARSINPVNVILICCCGVALEKLSHQERALQNYDLACELQPMSSLALFKR 552

Query: 175 GFAKFAQGKAEDALEAYKKVLDIEGDKAT 203
                A GK   ALE+++K++ I  D+AT
Sbjct: 553 AQLLLAMGKYNYALESFEKLVKIAPDEAT 581

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 38/91 (41%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN     KD+E +IK +  +    P+    +  +   YSS   +D A+     A+  N  
Sbjct: 417 GNLFSLKKDHEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKALASNSQ 476

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYKKVLDI 197
           +   Y  LG      G+ E+ L  ++K   I
Sbjct: 477 HYNAYYGLGMCSLKLGQYEECLLHFEKARSI 507

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 34.3 bits (77), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 32/57 (56%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKI 163
           GN   +  +YE A+  Y  A    P+N V+ AN + A   L+++++A+   + A++I
Sbjct: 15  GNDLYSKGEYETAVLYYKNASLAEPSNPVHLANMSMALLKLERWEDALSACDRALEI 71

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 35/89 (39%), Gaps = 11/89 (12%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATL----PTNAVYFANRAAAYSSLKKYDEAVEDANSAIK 162
           GN+A   K Y  A   Y   I         N + F N+AA    +K Y   + D   A+ 
Sbjct: 81  GNEAYKLKQYRNARVLYERGIEVNCNNDKINELLFVNKAACELEMKNYRSCINDCKKALS 140

Query: 163 INPTYSKGYSRLGFAKFAQGKAEDALEAY 191
            NP   K Y R+        KA  A+E Y
Sbjct: 141 FNPLNVKCYFRM-------AKAFSAIEKY 162

>CAGL0E01573g Chr5 complement(149084..151798) [2715 bp, 904 aa] {ON}
           similar to uniprot|P42842 Saccharomyces cerevisiae
           YNL313c
          Length = 904

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 47/99 (47%), Gaps = 1/99 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           G  A+     E+A + +T   A  PT+A+ ++N +AAY    K  EA      AI  +  
Sbjct: 640 GCIALECNKMEIAAEAFTRCTALDPTHAMSWSNLSAAYVQQGKLKEAHSCLKQAISSDSQ 699

Query: 167 YS-KGYSRLGFAKFAQGKAEDALEAYKKVLDIEGDKATE 204
            + + +           + ED L A K++++I+ DK+ E
Sbjct: 700 KNWRIWENFLLVSVKLDEWEDVLAACKQLIEIKKDKSGE 738

>Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W
           (REAL)
          Length = 612

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 31/49 (63%)

Query: 150 YDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIE 198
           +D+ ++   SA+K+NP     ++RLG +     ++E+A++AY + L ++
Sbjct: 474 FDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 522

>Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 31/49 (63%)

Query: 150 YDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIE 198
           +D+ ++   SA+K+NP     ++RLG +     ++E+A++AY + L ++
Sbjct: 473 FDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 33.5 bits (75), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 28/55 (50%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAI 161
           GN+     DY  A K Y   I   PTN + ++N+A +    + +D+A+   N+ +
Sbjct: 10  GNRLFKLGDYTAANKFYDLCIMEEPTNPIGYSNKAMSLIKQEHFDQAIRTCNTGL 64

>Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 31/49 (63%)

Query: 150 YDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIE 198
           +D+ ++   SA+K+NP     ++RLG +     ++E+A++AY + L ++
Sbjct: 473 FDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

>Ecym_2033 Chr2 complement(51082..53811) [2730 bp, 909 aa] {ON}
           similar to Ashbya gossypii ADL177C
          Length = 909

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 48/96 (50%), Gaps = 15/96 (15%)

Query: 117 ELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEA--------VEDANSAIKINPTYS 168
           ELA + ++  ++   T+A+ ++N +AAY+ L K+ EA          DA S  +I   Y 
Sbjct: 658 ELAAEAFSRCVSLDETHALSWSNLSAAYTELGKFKEAHSCLKRAVSSDAQSNWRIWENYM 717

Query: 169 KGYSRLGFAKFAQGKAEDALEAYKKVLDIEGDKATE 204
                L  AK  Q   +D L A K+++ I+ DK  E
Sbjct: 718 -----LVSAKIDQW--DDVLVACKRLVQIKRDKTGE 746

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 35/85 (41%), Gaps = 4/85 (4%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATL----PTNAVYFANRAAAYSSLKKYDEAVEDANSAIK 162
           GN     K Y+ A   Y++ I         N   + NRAA    L+ +   + D   A+ 
Sbjct: 86  GNDLYKVKRYKDARTMYSKGIEVKCEDDSINGSLYLNRAACELELRNFRSCINDCKKALN 145

Query: 163 INPTYSKGYSRLGFAKFAQGKAEDA 187
            N    K + R+G A F   K E+A
Sbjct: 146 FNAKCVKAFYRMGQAYFKLKKLEEA 170

>Kwal_55.21839 s55 (998426..1000498) [2073 bp, 690 aa] {ON} YOR080W
           (DIA2) - may be involved in regulation of invasive
           growth and budding pattern [contig 126] FULL
          Length = 690

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 46/97 (47%), Gaps = 8/97 (8%)

Query: 139 NRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAED--ALEAYKKVLD 196
           NRAA +  L    +A++DAN A+K  P   K Y R G  K  Q    D  AL+ Y++ L 
Sbjct: 76  NRAATWEKLGDLTKALKDANRAVKYEPYNLKCYLRKG--KILQKLQLDDMALKNYEEGL- 132

Query: 197 IEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNAT 233
               KA EM  R      +K+ + +  +KS +    T
Sbjct: 133 ---QKADEMRSRYGLEPPQKLSRIVEHQKSLIKSRIT 166

>CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244w PAS10 peroxisomal targeting signal receptor
          Length = 590

 Score = 34.3 bits (77), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 31/50 (62%)

Query: 149 KYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIE 198
           ++D  ++   +A+K+NP     ++RLG +     ++E+A++AY + L ++
Sbjct: 439 EFDRTIDCFQAALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 488

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 42/91 (46%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN     +D++ AIK   +A +  P  A  +  +   YS+   +D A      A+ INP 
Sbjct: 445 GNLFSLNRDHDEAIKALKKATSLNPQFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPN 504

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYKKVLDI 197
           +   +  LG +    G+ ++AL  ++K   I
Sbjct: 505 HYNAHYGLGMSCIKLGQYDEALLHFEKARSI 535

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 32.7 bits (73), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 28/57 (49%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKI 163
           GN +     Y  AI  Y   I+  P+N + ++N+A A     ++DEA+      +++
Sbjct: 10  GNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKGLQL 66

>YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}
           PEX5Peroxisomal membrane signal receptor for the
           C-terminal tripeptide signal sequence (PTS1) of
           peroxisomal matrix proteins, required for peroxisomal
           matrix protein import; also proposed to have
           PTS1-receptor independent functions
          Length = 612

 Score = 34.3 bits (77), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 30/48 (62%)

Query: 150 YDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDI 197
           +D+ ++   SA+++NP     ++RLG +     ++E+A++AY + L +
Sbjct: 473 FDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQL 520

>CAGL0J09570g Chr10 complement(941571..943220) [1650 bp, 549 aa]
           {ON} some similarities with uniprot|P35056 Saccharomyces
           cerevisiae YDR244w PAS10 peroxisomal targeting signal
           receptor
          Length = 549

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 17/81 (20%), Positives = 41/81 (50%)

Query: 119 AIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAK 178
           AIK + + +   P + + + +  A  ++ K+YD A++   + I++ P++ +    LG   
Sbjct: 410 AIKCFEKLLEQDPKDEITWNHLGATLANSKRYDTAIQVYMNTIELKPSFVRARYNLGSTL 469

Query: 179 FAQGKAEDALEAYKKVLDIEG 199
              G+ +  +E+    L ++G
Sbjct: 470 VKNGELQRGIESLLTALVMQG 490

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 33.9 bits (76), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 32/69 (46%)

Query: 132 TNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAY 191
            N   FAN AA    +K +   +     A++ NP   K Y R+  A +   K ++A E+ 
Sbjct: 114 VNESLFANLAACELEIKNFRRCINLCQKALQFNPKNMKCYYRIAKAFYQLNKLDEAKESV 173

Query: 192 KKVLDIEGD 200
           K  L I+ +
Sbjct: 174 KFGLTIDSE 182

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 33.9 bits (76), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 41/91 (45%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN     KD+E AIK + +A    P  A  +  +   +SS   +D A      A+  +P 
Sbjct: 542 GNFLSLQKDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKALACDPQ 601

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYKKVLDI 197
           +   Y  LG +    G+ ++AL  ++K   I
Sbjct: 602 HYNAYYGLGMSCMKLGQYDEALLHFEKARSI 632

>KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {ON}
           some similarities with uniprot|P38042 Saccharomyces
           cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 627

 Score = 33.9 bits (76), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 40/89 (44%)

Query: 115 DYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRL 174
            YE  +  + +A +  P N +       A   L   ++A++  + A ++ P  S    + 
Sbjct: 492 QYEECLLHFEKARSINPVNVILICCCGVALEKLSHQEKALQYYDLACELQPVSSLALFKR 551

Query: 175 GFAKFAQGKAEDALEAYKKVLDIEGDKAT 203
                A GK   ALE ++K++ I  D+AT
Sbjct: 552 AQLLLAMGKYNFALENFEKLVTIAPDEAT 580

 Score = 33.5 bits (75), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 39/91 (42%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN     KD+E +IK +  +    P+    +  +   YSS   +D A+     A+  NP 
Sbjct: 416 GNLFSLKKDHEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKALGSNPQ 475

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYKKVLDI 197
           +   +  LG      G+ E+ L  ++K   I
Sbjct: 476 HYNAHYGLGMCCLKLGQYEECLLHFEKARSI 506

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 32.0 bits (71), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 38/81 (46%), Gaps = 3/81 (3%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIK--IN 164
           GN       Y  A+  Y + I   P N V ++N+A A   L +Y  A++     ++  + 
Sbjct: 15  GNALFKQGLYREAVDSYDQLITAQPQNPVGYSNKAMALIKLAEYTHAIQTCQEGLRYALG 74

Query: 165 PTYSKGYSRLGF-AKFAQGKA 184
           P ++   S+L +  K +Q +A
Sbjct: 75  PEHAAIRSKLQYRLKLSQTEA 95

>TPHA0B03970 Chr2 (938053..939243) [1191 bp, 396 aa] {ON} Anc_1.456
           YJR032W
          Length = 396

 Score = 33.5 bits (75), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 48/94 (51%), Gaps = 8/94 (8%)

Query: 137 FANRAAAYSSLKKYDEAVEDANSAIKINPT----YSKGYSRLGFAKFAQGKAEDALEAYK 192
           + N +  Y +LK YDE +  AN  + ++       +K Y R G +   + + EDAL +YK
Sbjct: 295 YLNMSLNYYNLKMYDECMTYANYLLDLDNIPDIDQAKAYYRRGNSYLMKKRYEDALASYK 354

Query: 193 KVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKS 226
             L  E +   +++ +  E+ K  +E   N+EK+
Sbjct: 355 --LCKEKNPEDKVIDQKIESVKSLIEA--NIEKT 384

>TBLA0B08680 Chr2 (2070444..2073188) [2745 bp, 914 aa] {ON} Anc_3.32
           YNL313C
          Length = 914

 Score = 33.9 bits (76), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 46/89 (51%), Gaps = 1/89 (1%)

Query: 117 ELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYS-KGYSRLG 175
           +LA + ++  ++   TNA+ ++N +AAY +  K  EA    N A + +   + + +    
Sbjct: 663 QLAAEAFSRCVSLDDTNAMAWSNLSAAYVNQGKLKEAFSCLNRATRTDSQKNWRIWENYM 722

Query: 176 FAKFAQGKAEDALEAYKKVLDIEGDKATE 204
              F   + ++ L + KK++DI  D+A E
Sbjct: 723 IVAFKLREWDEVLLSCKKLIDINKDRAGE 751

>KAFR0E02820 Chr5 (570013..571701) [1689 bp, 562 aa] {ON} Anc_8.470
           YDR244W
          Length = 562

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 35/64 (54%), Gaps = 8/64 (12%)

Query: 135 VYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKV 194
           +Y+AN          +D+ +E   +A+  NPT    ++RLG A     ++ED+++AY K 
Sbjct: 415 LYYAN--------DDFDKTIECFKAALNENPTDELMWNRLGAALANSNRSEDSIKAYYKA 466

Query: 195 LDIE 198
           + ++
Sbjct: 467 IQLK 470

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 31.6 bits (70), Expect = 1.0,   Method: Composition-based stats.
 Identities = 23/85 (27%), Positives = 36/85 (42%), Gaps = 6/85 (7%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN       Y  A+  Y + I   P N V ++N+A A   L +Y +A++     ++   T
Sbjct: 11  GNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTST 70

Query: 167 ------YSKGYSRLGFAKFAQGKAE 185
                  SK   RL  A+ A G  +
Sbjct: 71  AEHVAIRSKLQYRLELAQGAVGSVQ 95

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 46/97 (47%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           G  +M   +YE A+  + +A +  P+NA+           L   ++A+     A +I PT
Sbjct: 665 GMCSMKLGEYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQEKALNYYELACQIQPT 724

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGDKAT 203
            S    +     ++  K   AL+A+++++ I  ++AT
Sbjct: 725 SSLAKFKRAHLLYSMAKYTQALDAFEELIKIAPEEAT 761

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 43/92 (46%), Gaps = 7/92 (7%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN+  A   YELA +         PT+++    RA    S+ KY +A++     IKI P 
Sbjct: 706 GNQEKALNYYELACQ-------IQPTSSLAKFKRAHLLYSMAKYTQALDAFEELIKIAPE 758

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYKKVLDIE 198
            +     LG      G+ +DA++ Y   ++++
Sbjct: 759 EATVQFILGQLYQIMGRKKDAIKRYTIAMNLD 790

>SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} similar
           to uniprot|P47103 Saccharomyces cerevisiae YJR032W CPR7
           Peptidyl-prolyl cis-trans isomerase (cyclophilin)
           catalyzes the cis-trans isomerization of peptide bonds
           N-terminal to proline residues binds to Hsp82p and
           contributes to chaperone activity
          Length = 432

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 45/94 (47%), Gaps = 13/94 (13%)

Query: 137 FANRAAAYSSLKKYDEAVEDANSAIKIN--PTY--SKGYSRLGFAKFAQGKAEDALEAYK 192
           + N +    +LKKYD A+  A   +++   PT   +K Y R G    A+ + E+AL+ YK
Sbjct: 334 YLNISLVLFNLKKYDSAITHATYLLEMEKVPTLDKAKAYYRRGNCYLAKNRLEEALKDYK 393

Query: 193 ---------KVLDIEGDKATEMMKRDYETAKKKV 217
                    KV+D + +    +++   E  +K +
Sbjct: 394 NCKENNPDDKVIDQKIESVENLLEERKEKTRKNI 427

>KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7.412
           YBL084C
          Length = 712

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 42/85 (49%)

Query: 114 KDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSR 173
           ++YELA+K Y  A    P +A+    +A    SL +Y  AVE     IK++      +  
Sbjct: 610 RNYELALKYYDFASKLQPNSALAKYRKAELLFSLGRYSLAVELFEDLIKLDSENPNLHYM 669

Query: 174 LGFAKFAQGKAEDALEAYKKVLDIE 198
           LG      G+ +DA++ Y   ++++
Sbjct: 670 LGKIYQTMGRKKDAVKEYTVAMNLD 694

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 39/91 (42%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN     K++  AIK + +A    P  A  +  +   Y+S   +D A      AI  +P 
Sbjct: 535 GNFLSLQKNHHEAIKAFEKATQVDPKFAYAYTLQGHEYTSSDSFDVAKRCYRKAIACDPG 594

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYKKVLDI 197
           +   Y  LG      G+ E+AL  ++K   I
Sbjct: 595 HYNAYYGLGMVSMKLGQYEEALLFFEKARSI 625

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 38/87 (43%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN     KD++ AI  + +AI   P  A  +  +   YS+   +D A      A+ I  T
Sbjct: 499 GNLHSLNKDHDEAITAFGKAIQLDPFFAYAYTLQGHEYSNNDAFDNAKSCFRKALTIEKT 558

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYKK 193
           +      LG      GK E+AL  ++K
Sbjct: 559 HYNALYGLGMCCVKLGKFEEALLFFEK 585

>Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON}
           (161135..162958) [1824 nt, 608 aa]
          Length = 607

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 34/54 (62%)

Query: 144 YSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDI 197
           + S  ++D+ ++   +A+K++P     ++RLG +     ++E+A++AY K L++
Sbjct: 460 FYSNNEFDKTIDCFKAALKVSPNDELLWNRLGASLANSNRSEEAIQAYHKALNL 513

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 29/48 (60%)

Query: 150 YDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDI 197
           YD+ V+   +A+ + P     ++RLG +     ++E+A++AY+K L +
Sbjct: 442 YDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQL 489

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/88 (20%), Positives = 42/88 (47%), Gaps = 3/88 (3%)

Query: 115 DYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRL 174
           DY+  +  +  A+A  P + + +    A+ ++  + +EA++    A+++ PT+ +    L
Sbjct: 441 DYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVRARCNL 500

Query: 175 GFAKFAQGKAEDALEAYKKVL---DIEG 199
             +    G  ++A E     L   ++EG
Sbjct: 501 AVSCMNMGCYKEAAEYLLTALSMHEVEG 528

>AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR244W (PEX5)
          Length = 569

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/91 (21%), Positives = 43/91 (47%), Gaps = 3/91 (3%)

Query: 112 AGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGY 171
           A +D++  I  +  A+A  P +   +    A+ ++  + +EA++  + AI++ PT+ +  
Sbjct: 429 ANEDFDKTIDCFRAALAVRPDDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPTFVRAR 488

Query: 172 SRLGFAKFAQGKAEDALEAYKKVL---DIEG 199
             L  +    G   +A E     L   ++EG
Sbjct: 489 YNLAVSSMNIGCYREAAEHLLTALSMHEVEG 519

>NCAS0C04490 Chr3 complement(919665..922421) [2757 bp, 918 aa] {ON}
           Anc_3.32 YNL313C
          Length = 918

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 48/99 (48%), Gaps = 1/99 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           G  A+     E+A + ++  ++  PT+A+ ++N +AAY  L K  EA      +I  +  
Sbjct: 651 GCVALECNKMEVAAEAFSRCVSLDPTHAMAWSNLSAAYVELNKLKEAFSCLKRSIACDSQ 710

Query: 167 YS-KGYSRLGFAKFAQGKAEDALEAYKKVLDIEGDKATE 204
            + + +           + +D L A K++++I  +K+ E
Sbjct: 711 RNWRIWENYMLVSAKLNEWDDVLIACKQLVNIRRNKSGE 749

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 41/91 (45%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN     +D++ AIK   +A    P  A  +  +   YS+   +D A      A+ INP 
Sbjct: 464 GNLFSLNRDHDEAIKALKKATNLDPRFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPN 523

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYKKVLDI 197
           +   +  LG +    G+ ++AL  ++K   I
Sbjct: 524 HYNAHYGLGMSCIKLGQYDEALLHFEKARSI 554

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 29/48 (60%)

Query: 150 YDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDI 197
           YD+ V+   +A+ + P     ++RLG +     ++E+A++AY+K L +
Sbjct: 435 YDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQL 482

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 18/88 (20%), Positives = 42/88 (47%), Gaps = 3/88 (3%)

Query: 115 DYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRL 174
           DY+  +  +  A+A  P + + +    A+ ++  + +EA++    A+++ PT+ +    L
Sbjct: 434 DYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVRARCNL 493

Query: 175 GFAKFAQGKAEDALEAYKKVL---DIEG 199
             +    G  ++A E     L   ++EG
Sbjct: 494 AVSCMNMGCFKEAAEYLLTALSMHEVEG 521

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 26/56 (46%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIK 162
           GN+     +Y  AIK Y + I   P N + ++N+A A     K  EAV      +K
Sbjct: 10  GNQYFKEGNYASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAVRTCQDGLK 65

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/112 (21%), Positives = 50/112 (44%), Gaps = 2/112 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           G  AM    YE A+  + +A +  P N V       +   L   ++A++    A  + PT
Sbjct: 615 GTSAMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQPT 674

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGDKATE--MMKRDYETAKKK 216
            S    ++G   ++  +   AL+ +++++ +  D AT   ++ + Y    +K
Sbjct: 675 SSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDDATAHYLLGQTYRIVGRK 726

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 40/91 (43%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN     KD++ AIK + +A    P  A  +  +   +SS    D A      A+  +P 
Sbjct: 547 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQ 606

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYKKVLDI 197
           +   Y  LG +    G+ E+AL  ++K   I
Sbjct: 607 HYNAYYGLGTSAMKLGQYEEALLYFEKARSI 637

>KLTH0F19272g Chr6 (1558288..1558366,1558617..1560049) [1512 bp, 503
           aa] {ON} similar to uniprot|Q12471 Saccharomyces
           cerevisiae YOL136C PFK27 6-phosphofructo-2-kinase has
           negligible fructose-2 6-bisphosphatase activity
           inhibited by phosphoenolpyruvate and sn-glycerol
           3-phosphate expression induced by glucose and sucrose
           transcriptional regulation involves protein kinase A
          Length = 503

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 132 TNAVYFANRAAAYSS-LKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDAL 188
           TN+++  NR A+YSS +  Y E  ED  +A+ +N  YS    R   A  A  +A D L
Sbjct: 133 TNSLFSLNRRASYSSVIDHYLEEAEDEPTALTLN--YSSRNRRSSVAAPAMAQAPDPL 188

>TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {ON}
           Anc_8.470 YDR244W
          Length = 662

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 29/49 (59%)

Query: 150 YDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIE 198
           YD+ ++   +A+ +NP     ++RLG +     ++E+A+ AY + L ++
Sbjct: 509 YDKTIDCFKTALTVNPNDELMWNRLGASLANSNRSEEAVAAYHRALTLK 557

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 40/91 (43%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN     KD++ AIK + +A    P  A  +  +   +SS    D A      A+  +P 
Sbjct: 552 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQ 611

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYKKVLDI 197
           +   Y  LG +    G+ E+AL  ++K   I
Sbjct: 612 HYNAYYGLGTSSMKLGQYEEALLYFEKARSI 642

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 45/85 (52%), Gaps = 11/85 (12%)

Query: 115 DYELAIKKYTEAIATLPTNA----VYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKG 170
           DY+ A+ +Y +++ TLP       + ++N  AA   + +Y ++V+D + A+++ P   K 
Sbjct: 561 DYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALELFPKNDKQ 620

Query: 171 YSRLGFAKFAQGKAEDALEAYKKVL 195
           +++     F Q    D  + YK++ 
Sbjct: 621 WTQ-----FIQD--SDPQKTYKEIW 638

>CAGL0M08030g Chr13 complement(800149..801312) [1164 bp, 387 aa]
           {ON} similar to uniprot|P47103 Saccharomyces cerevisiae
           YJR032w Peptidyl-prolyl cis-trans isomerase CYP7
          Length = 387

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 48/96 (50%), Gaps = 13/96 (13%)

Query: 137 FANRAAAYSSLKKYDEAVEDANSAIKINPT----YSKGYSRLGFAKFAQGKAEDALEAYK 192
           + N   A  +LK YDE+++  +  ++++       +K Y R+G + FA+ + ++AL+ Y+
Sbjct: 289 YLNICLALFNLKDYDESMKYGHYLLELDSVDDKDKAKAYYRIGNSLFAKKRYDEALKNYR 348

Query: 193 KVLDIEGD---------KATEMMKRDYETAKKKVEQ 219
              D   D         K   +++++ E  KK + +
Sbjct: 349 LCRDHNPDDNVIGQKIEKTENILEKEKERTKKNISK 384

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 40/91 (43%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           GN     KD++ AIK + +A    P  A  +  +   +SS    D A      A+  +P 
Sbjct: 540 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQ 599

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYKKVLDI 197
           +   Y  LG +    G+ E+AL  ++K   I
Sbjct: 600 HYNAYYGLGTSSMKLGQYEEALLYFEKARSI 630

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 23/112 (20%), Positives = 50/112 (44%), Gaps = 2/112 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           G  +M    YE A+  + +A +  P N V       +   L   ++A++    A  + PT
Sbjct: 608 GTSSMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQPT 667

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGDKATE--MMKRDYETAKKK 216
            S    ++G   ++  +   AL+ +++++ +  D AT   ++ + Y    +K
Sbjct: 668 SSLSKYKMGQLLYSMTRYSVALQTFEELVKLVPDDATAHYLLGQTYRIVGRK 719

>KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 566

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/88 (21%), Positives = 43/88 (48%), Gaps = 17/88 (19%)

Query: 120 IKKYTEAIATLPT---------NAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKG 170
           I KY +    LP            +++AN        +++ + ++   +A+++NP     
Sbjct: 401 ITKYLQVANALPQVDPEVQLGLGTLFYAN--------EEFGKTIDCFRTALEVNPNDELM 452

Query: 171 YSRLGFAKFAQGKAEDALEAYKKVLDIE 198
           ++RLG +     ++E+A++AY K L ++
Sbjct: 453 WNRLGASLANSNRSEEAIQAYHKALALK 480

>TPHA0G00430 Chr7 complement(77860..80046) [2187 bp, 728 aa] {ON}
           Anc_5.689 YOR080W
          Length = 728

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%)

Query: 137 FANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAYK 192
           + N +A Y  L+  D+A + +   I ++P   KGY  +G     Q K + A +AYK
Sbjct: 75  YGNLSATYDKLQNLDKASDCSQRMINVDPYNLKGYIMMGKILQKQNKDKLAYKAYK 130

>TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {ON}
           Anc_8.470 YDR244W
          Length = 549

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 30/49 (61%)

Query: 149 KYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDI 197
           ++D+ ++   +A+ +NP     ++RLG +     ++E+A++AY K L +
Sbjct: 411 EFDKTIDCFKAALSVNPNDELMWNRLGASLANSNRSEEAIQAYYKALQL 459

>NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1403

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 34/57 (59%)

Query: 143 AYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEG 199
           AY   ++   ++E   SAI+++P   + +  LG A  A G+ E +++ ++K ++++G
Sbjct: 678 AYLQNQQESSSIEWFQSAIRVDPNDIESWVGLGQAYLACGRIEASMKVFEKAMELDG 734

>Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AFR453W
          Length = 573

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 17/86 (19%), Positives = 42/86 (48%), Gaps = 17/86 (19%)

Query: 122 KYTEAIATLP---------TNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYS 172
           +Y + I TLP            +++AN         ++D+ ++   +A+ + P     ++
Sbjct: 408 QYLKVINTLPEIDPDVQLGLGVLFYAN--------DEFDKTIDCFKAALHVRPNDECMWN 459

Query: 173 RLGFAKFAQGKAEDALEAYKKVLDIE 198
           RLG +     ++E+A++AY + + ++
Sbjct: 460 RLGASLANSNRSEEAIQAYHRAIQLK 485

>KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {ON}
           Anc_8.470 YDR244W
          Length = 602

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 11/49 (22%), Positives = 31/49 (63%)

Query: 150 YDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIE 198
           +++ ++   +A+++NP     ++RLG A     ++E++++AY + L ++
Sbjct: 462 FNKTIDCFKTALQVNPNDELMWNRLGAALANSNRSEESIKAYHRALQLK 510

>Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON}
           YBL084C (REAL)
          Length = 769

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 23/112 (20%), Positives = 50/112 (44%), Gaps = 2/112 (1%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPT 166
           G  +M    YE A+  + +A +  P N V       +   L   ++A++    A  + PT
Sbjct: 626 GTSSMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQPT 685

Query: 167 YSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGDKATE--MMKRDYETAKKK 216
            S    ++G   ++  +   AL+ +++++ +  D AT   ++ + Y    +K
Sbjct: 686 SSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDDATAHYLLGQTYRIVGRK 737

>NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}
           Anc_5.689 YOR080W
          Length = 764

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 26/57 (45%)

Query: 139 NRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVL 195
           NRAA +  + + ++A+ DA     I P   K + R G       K +DA   YK  L
Sbjct: 99  NRAACWEKMGELEKALRDATKMCFIEPYNLKCFIRKGKILQKLHKLKDAYNTYKTAL 155

>Skud_14.26 Chr14 complement(38826..41624) [2799 bp, 932 aa] {ON}
           YNL313C (REAL)
          Length = 932

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 43/89 (48%), Gaps = 1/89 (1%)

Query: 117 ELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYS-KGYSRLG 175
           ELA + ++  ++  P +A+ ++N +AAY  + K  EA      AI  +   + K +    
Sbjct: 682 ELAAEAFSRCVSLDPYHALSWSNLSAAYMKMDKLKEAYSCLKRAIASDAQKNWKIWENYM 741

Query: 176 FAKFAQGKAEDALEAYKKVLDIEGDKATE 204
                  + +D L A ++++ I  DKA E
Sbjct: 742 LVAVKLNEWDDVLVACRQLVSIRRDKAGE 770

>Ecym_1366 Chr1 (753035..754213) [1179 bp, 392 aa] {ON} similar to
           Ashbya gossypii AEL062C
          Length = 392

 Score = 30.4 bits (67), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 45/97 (46%), Gaps = 6/97 (6%)

Query: 137 FANRAAAYSSLKKYDEAVEDANSAIKINPTYS----KGYSRLGFAKFAQGKAEDALEAYK 192
           + N +     L ++DE++  AN  I++    S    K Y R G     + + EDAL+ YK
Sbjct: 294 YLNLSFVLFILSRHDESITYANYLIEMEGVTSLDKAKAYYRRGNCYLVKKRLEDALQDYK 353

Query: 193 KVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVS 229
                E +   E++ +     + K+E+ L   K ++S
Sbjct: 354 NCK--EYNPNDEVVTKRILEIESKLEEKLEKTKKSIS 388

>ZYRO0C02970g Chr3 (230414..233104) [2691 bp, 896 aa] {ON} similar
           to uniprot|P42842 Saccharomyces cerevisiae YNL313C
           Protein required for cell viability
          Length = 896

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 41/89 (46%), Gaps = 1/89 (1%)

Query: 117 ELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYS-KGYSRLG 175
           ELA + ++  ++  PT+   ++N +AAY  L K  EA      A+  +   + + +    
Sbjct: 648 ELAAEAFSRCVSLDPTHGAAWSNLSAAYVELDKLKEAFSCLKQAVSTDARKNWRIWENYM 707

Query: 176 FAKFAQGKAEDALEAYKKVLDIEGDKATE 204
                  + +D L A K ++ I+ D+  E
Sbjct: 708 LVAMKLNEWQDVLMACKNLVTIKRDRVGE 736

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 29.3 bits (64), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 31/68 (45%), Gaps = 5/68 (7%)

Query: 158 NSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKV 217
           +  IK+ PT   GYS    +   QG    A+E  +     EG K T    ++  T K+K+
Sbjct: 27  DQCIKLEPTNPIGYSNKAMSLIKQGNHGLAVETCQ-----EGLKYTSSSTKEATTIKRKL 81

Query: 218 EQSLNLEK 225
           E  L L K
Sbjct: 82  EYRLELAK 89

>KLLA0D09020g Chr4 (758818..760410) [1593 bp, 530 aa] {ON} similar
           to uniprot|P20424 Saccharomyces cerevisiae YPR088C SRP54
           Signal recognition particle (SRP) subunit (homolog of
           mammalian SRP54) contains the signal sequence- binding
           activity of SRP interacts with the SRP RNA and mediates
           binding of SRP to signal receptor contains GTPase domain
          Length = 530

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 18/23 (78%)

Query: 286 MKQVESMMQNPSVKQMADQFSSG 308
           M+ +  MMQ+PS+++MA QFS G
Sbjct: 507 MQDIMGMMQDPSMQEMAKQFSGG 529

>TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8.470
           YDR244W
          Length = 588

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 41/83 (49%), Gaps = 1/83 (1%)

Query: 117 ELAIKKYTEAIATLPT-NAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLG 175
           E+  K++      LP  +A         + S  ++D+ ++   +A+ I+P     ++RLG
Sbjct: 413 EIVTKQFLNIANKLPNADADVQLGLGLLFYSNNEFDKTIDCFKTALVIHPEDELMWNRLG 472

Query: 176 FAKFAQGKAEDALEAYKKVLDIE 198
            +     + E+A++AY K L ++
Sbjct: 473 ASLANSSRPEEAIQAYHKALQLK 495

>CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] {ON}
            highly similar to uniprot|P53622 Saccharomyces cerevisiae
            YDL145c RET1 Coatomer alpha subunit
          Length = 1201

 Score = 30.8 bits (68), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 7/62 (11%)

Query: 175  GFAKFAQGKAEDALEAYKKV------LDIEGDKATEMMKRDYETAKKKVE-QSLNLEKST 227
            GF  F   K E+A+E +++V      L +E D   E+  +  ETAK+ +   S+ LE+ +
Sbjct: 997  GFKLFKANKLEEAIETFREVIYRVLFLTLEDDDEEELAHKALETAKEYILGLSIELERRS 1056

Query: 228  VS 229
            ++
Sbjct: 1057 LA 1058

>SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]
           {ON} similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 573

 Score = 30.4 bits (67), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 12/49 (24%), Positives = 29/49 (59%)

Query: 150 YDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIE 198
           YD+ ++   +A+ + P     ++RLG +     ++E+A++AY + L ++
Sbjct: 438 YDKTIDCFKAALTVKPDDELMWNRLGASLANSNRSEEAIQAYHRALQLK 486

>Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320C
           (SWA2) - auxilin-like protein [contig 272] FULL
          Length = 597

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 15/61 (24%), Positives = 33/61 (54%), Gaps = 4/61 (6%)

Query: 107 GNKAMAGKDYELAIKKYTEAIATLPTN----AVYFANRAAAYSSLKKYDEAVEDANSAIK 162
           G  + +  DY  A + + +++ +LP +    A+  +N       L +Y +A+ED++ A+K
Sbjct: 311 GTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIEDSSVALK 370

Query: 163 I 163
           +
Sbjct: 371 L 371

>KLTH0F19140g Chr6 (1550056..1552830) [2775 bp, 924 aa] {ON} similar
           to uniprot|P42842 Saccharomyces cerevisiae YNL313C
           Protein required for cell viability
          Length = 924

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 35/84 (41%), Gaps = 4/84 (4%)

Query: 114 KDYELAIKKYTEAIATLPT--NAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGY 171
           KDY   +K   E+++  P   +  YF           K D A E     + ++ T+S  +
Sbjct: 636 KDYNACLKHLNESLSLYPLAFDTWYFYGCIGLECG--KTDLAAEAFTRCVSLDDTHSLSW 693

Query: 172 SRLGFAKFAQGKAEDALEAYKKVL 195
           S L  A   QGK ++A     K +
Sbjct: 694 SNLSAAYIEQGKLKEAHSCLSKAI 717

>AEL062C Chr5 complement(519416..520567) [1152 bp, 383 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR032W
           (CPR7)
          Length = 383

 Score = 30.0 bits (66), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 34/73 (46%), Gaps = 4/73 (5%)

Query: 137 FANRAAAYSSLKKYDEAVEDANSAIKINPTYS----KGYSRLGFAKFAQGKAEDALEAYK 192
           + N   A  ++  YD A+   N  ++++   S    K Y R G    A+   E+AL  YK
Sbjct: 286 YLNMTLALFNMGSYDSAISYTNYVLEMDRVPSMDLAKAYYRRGNCYLAKNLLEEALSNYK 345

Query: 193 KVLDIEGDKATEM 205
           +  +   D+A +M
Sbjct: 346 RCKEHNSDEAVDM 358

>AEL281C Chr5 complement(111535..115707) [4173 bp, 1390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR189W
           (SKI3)
          Length = 1390

 Score = 30.4 bits (67), Expect = 9.5,   Method: Composition-based stats.
 Identities = 17/83 (20%), Positives = 37/83 (44%)

Query: 114 KDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSR 173
           K + +A+  + + +A  P N      ++      K++DEA       +  +P     +S 
Sbjct: 449 KYHSIALSLFDKVLADDPQNYRAKLKKSHILIERKQWDEAYALLKGVVDRHPHLYDAHSA 508

Query: 174 LGFAKFAQGKAEDALEAYKKVLD 196
            G+ +   G  E ALE ++ +++
Sbjct: 509 FGWCQLQLGDTESALETFQLIIN 531

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.125    0.337 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 27,888,967
Number of extensions: 973537
Number of successful extensions: 3698
Number of sequences better than 10.0: 207
Number of HSP's gapped: 3603
Number of HSP's successfully gapped: 289
Length of query: 342
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 232
Effective length of database: 40,868,139
Effective search space: 9481408248
Effective search space used: 9481408248
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 66 (30.0 bits)