Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1037.256.20ON1105110555920.0
ZYRO0C07810g6.20ON1099112116520.0
Suva_13.1606.20ON1090108316300.0
TDEL0G044906.20ON1093110516170.0
Sklu_YGOB_Anc_6.20b6.20ON1088110315920.0
Skud_13.1526.20ON1090108215770.0
Smik_13.1576.20ON1090108815480.0
TPHA0J003306.20ON1107110815060.0
Sklu_YGOB_Anc_6.20singletonOFF84987013801e-174
Ecym_30246.20ON1079109712831e-158
CAGL0L07634g6.20ON1130109012761e-156
ACR006C6.20ON1071111712581e-154
Kwal_56.224246.20ON1089108812251e-149
KLTH0C11242g6.20ON1097111212121e-147
YML002W6.20ON73772811131e-137
NCAS0H008206.20ON1146113211131e-132
KLLA0D01133g6.20ON1067109811021e-131
KNAG0M011606.20ON1131114710601e-125
NDAI0D008006.20ON1193119610281e-120
TBLA0A072606.20ON120412098741e-98
KAFR0L004006.20ON9428145762e-60
YML003WsingletonOFF2902913651e-37
NCAS0A017104.101ON23547761.7
NDAI0K001708.876ON50669753.1
NCAS0A075107.23ON12591696.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1037.25
         (1105 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON} (56141...  2158   0.0  
ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] ...   640   0.0  
Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML00...   632   0.0  
TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {...   627   0.0  
Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1...   617   0.0  
Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML00...   612   0.0  
Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML00...   600   0.0  
TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.2...   584   0.0  
Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF} A...   536   e-174
Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to...   498   e-158
CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa]...   496   e-156
ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON} ...   489   e-154
Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML00...   476   e-149
KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] ...   471   e-147
YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative p...   433   e-137
NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6....   433   e-132
KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some ...   429   e-131
KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6...   412   e-125
NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6....   400   e-120
TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_...   341   1e-98
KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20...   226   2e-60
YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative p...   145   1e-37
NCAS0A01710 Chr1 (332239..332946) [708 bp, 235 aa] {ON} Anc_4.10...    34   1.7  
NDAI0K00170 Chr11 complement(26066..27586) [1521 bp, 506 aa] {ON...    33   3.1  
NCAS0A07510 Chr1 complement(1493599..1493976) [378 bp, 125 aa] {...    31   6.1  

>Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON}
            (56141..59458) [3318 nt, 1106 aa]
          Length = 1105

 Score = 2158 bits (5592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1069/1105 (96%), Positives = 1069/1105 (96%)

Query: 1    MGELSYHMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEK 60
            MGELSYHMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEK
Sbjct: 1    MGELSYHMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEK 60

Query: 61   GLTLKELCYEFEFVASHIILDTDNSSNNLQVKGKNSNETLDNRYKSXXXXXXXXXXXXXX 120
            GLTLKELCYEFEFVASHIILDTDNSSNNLQVKGKNSNETLDNRYKS              
Sbjct: 61   GLTLKELCYEFEFVASHIILDTDNSSNNLQVKGKNSNETLDNRYKSLNNNQLLIKNNNII 120

Query: 121  PLDFNNSTQXXXXXXXXXXXLPNFNEYLSGSEKYTIIYTDYPFSNSWLPKIEIESFYISK 180
            PLDFNNSTQ           LPNFNEYLSGSEKYTIIYTDYPFSNSWLPKIEIESFYISK
Sbjct: 121  PLDFNNSTQKKKYKIIDIKILPNFNEYLSGSEKYTIIYTDYPFSNSWLPKIEIESFYISK 180

Query: 181  KESNNIKAAQITNHKSPLSQDLAQKTKSSFRHIINIHKEWNNIFDSYIIDFKNKQLNLTS 240
            KESNNIKAAQITNHKSPLSQDLAQKTKSSFRHIINIHKEWNNIFDSYIIDFKNKQLNLTS
Sbjct: 181  KESNNIKAAQITNHKSPLSQDLAQKTKSSFRHIINIHKEWNNIFDSYIIDFKNKQLNLTS 240

Query: 241  LPIYFREIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHIDRNMIDNQFLH 300
            LPIYFREIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHIDRNMIDNQFLH
Sbjct: 241  LPIYFREIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHIDRNMIDNQFLH 300

Query: 301  TEMMDFLSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSHSEKCQILI 360
            TEMMDFLSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSHSEKCQILI
Sbjct: 301  TEMMDFLSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSHSEKCQILI 360

Query: 361  DALQKLTSYDDVHYEPLMVDADTLMNLFLLVICRSKVPFLRNHLYYLQNFSTDENNVKFG 420
            DALQKLTSYDDVHYEPLMVDADTLMNLFLLVICRSKVPFLRNHLYYLQNFSTDENNVKFG
Sbjct: 361  DALQKLTSYDDVHYEPLMVDADTLMNLFLLVICRSKVPFLRNHLYYLQNFSTDENNVKFG 420

Query: 421  LLGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNKELISKISSEADHSTFQVKLYKDCF 480
            LLGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNKELISKISSEADHSTFQVKLYKDCF
Sbjct: 421  LLGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNKELISKISSEADHSTFQVKLYKDCF 480

Query: 481  KFRNEMGESILALCIKHKKNETLFEILLNFEDMFPXXXXXXXXXXXGTTLLMKALKVENE 540
            KFRNEMGESILALCIKHKKNETLFEILLNFEDMFP           GTTLLMKALKVENE
Sbjct: 481  KFRNEMGESILALCIKHKKNETLFEILLNFEDMFPLEDILDDEDIEGTTLLMKALKVENE 540

Query: 541  VGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVLKRIGLFFNWKIKDDKG 600
            VGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVLKRIGLFFNWKIKDDKG
Sbjct: 541  VGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVLKRIGLFFNWKIKDDKG 600

Query: 601  YTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHNDSKENTLLHILKCDIQ 660
            YTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHNDSKENTLLHILKCDIQ
Sbjct: 601  YTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHNDSKENTLLHILKCDIQ 660

Query: 661  VLLKYDNININAHNLKYITPLMTYVKYNRVSNIQEIIRDERLILGKYQKHTFLDCYDFVK 720
            VLLKYDNININAHNLKYITPLMTYVKYNRVSNIQEIIRDERLILGKYQKHTFLDCYDFVK
Sbjct: 661  VLLKYDNININAHNLKYITPLMTYVKYNRVSNIQEIIRDERLILGKYQKHTFLDCYDFVK 720

Query: 721  NTIIFEDLGVRSVRNSMFNLFSAYSLRVENSNWVLYFTFKDTNQDSYITKSVSLKILFNI 780
            NTIIFEDLGVRSVRNSMFNLFSAYSLRVENSNWVLYFTFKDTNQDSYITKSVSLKILFNI
Sbjct: 721  NTIIFEDLGVRSVRNSMFNLFSAYSLRVENSNWVLYFTFKDTNQDSYITKSVSLKILFNI 780

Query: 781  IKKYNKLYPLHFIPHKEVLLRLTGIVKNNPNNGIQKLKNRAFLNLISNYFGTLIETDDFD 840
            IKKYNKLYPLHFIPHKEVLLRLTGIVKNNPNNGIQKLKNRAFLNLISNYFGTLIETDDFD
Sbjct: 781  IKKYNKLYPLHFIPHKEVLLRLTGIVKNNPNNGIQKLKNRAFLNLISNYFGTLIETDDFD 840

Query: 841  TELFKNPESLTKWIKAGKRKHKKENYYKRMTLDDINMIKSFVQFNINELGKLNRTLAILK 900
            TELFKNPESLTKWIKAGKRKHKKENYYKRMTLDDINMIKSFVQFNINELGKLNRTLAILK
Sbjct: 841  TELFKNPESLTKWIKAGKRKHKKENYYKRMTLDDINMIKSFVQFNINELGKLNRTLAILK 900

Query: 901  KLCTFLALKINDVNESYKLFRNFGALLQQKDISNQMKKIDGLIKPKYFQSIFLILLDQIS 960
            KLCTFLALKINDVNESYKLFRNFGALLQQKDISNQMKKIDGLIKPKYFQSIFLILLDQIS
Sbjct: 901  KLCTFLALKINDVNESYKLFRNFGALLQQKDISNQMKKIDGLIKPKYFQSIFLILLDQIS 960

Query: 961  FLEICTIHMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDFSDFDSRNGLNENILSRYT 1020
            FLEICTIHMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDFSDFDSRNGLNENILSRYT
Sbjct: 961  FLEICTIHMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDFSDFDSRNGLNENILSRYT 1020

Query: 1021 KNKREAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEEFNKFLTFKSRFFKDVILNMII 1080
            KNKREAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEEFNKFLTFKSRFFKDVILNMII
Sbjct: 1021 KNKREAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEEFNKFLTFKSRFFKDVILNMII 1080

Query: 1081 PSAIATLKDQVLNIENIHNKQFENN 1105
            PSAIATLKDQVLNIENIHNKQFENN
Sbjct: 1081 PSAIATLKDQVLNIENIHNKQFENN 1105

>ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] {ON}
            similar to uniprot|Q04257 Saccharomyces cerevisiae
            YML003W/YML002W Hypothetical ORF
          Length = 1099

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/1121 (34%), Positives = 641/1121 (57%), Gaps = 42/1121 (3%)

Query: 4    LSYHMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLT 63
            ++YH+PVLLNPL+N+VFNC +P +S  +KLF ++K + F+L+VPP E LL++ D E G +
Sbjct: 1    MAYHIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSS 60

Query: 64   LKELCYEFEFVASHIIL---DTDNSSNNLQVKGKNSNETLDNRYKSXXXXXXXXXXXXXX 120
            + +LC  ++FVASHI+L   DT +         +   +TL+++  +              
Sbjct: 61   MNDLCQNYDFVASHILLLQQDTYSDGGFNLSASQTEYKTLNDKRVAVRSSSGEILTTEGF 120

Query: 121  PLDFNNSTQXXXXXXXXXXXLPNFNEYLSGSEKYTIIYTDYPFSNSWLPKIEIESFYISK 180
            PL      Q           + NFN+YL+GSEK+ +++ D+P   + + KI+I    +++
Sbjct: 121  PLRRRARIQNVEL-------ITNFNDYLNGSEKFALVHIDHPLIGTLIRKIDIPR-GLAQ 172

Query: 181  KESNNIKAAQITNHKSPLSQDLAQKTKSSFRHIINIHKEWNNIFDSYIIDFKNKQLNLTS 240
               N + A      K  L +DL QK+ SSF +I+ +H +W+NI + Y   +++  L    
Sbjct: 173  GNFNGVDA------KGSLVRDLTQKSWSSFENILRLHPDWSNILNGYFNRYRSTPLTEGP 226

Query: 241  LPIYFREIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHIDRNMIDNQFLH 300
                FR IV + + KM  +E+F    + LY+LIF+Y+E + ++ +W  I  +   ++ + 
Sbjct: 227  YEELFRMIVKQVHAKMVNDELFRKIPH-LYDLIFDYVELNLFDDVWIRIVNSYRKDE-ID 284

Query: 301  TEMMDFLSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSHSEKCQILI 360
            TE + FLSI++LE ELY + ++KF L +V  +E+ +  A + F  +  + +H+EK   LI
Sbjct: 285  TEPLKFLSINELETELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLI 344

Query: 361  DALQKLTSYD----DVHYEPLMVDADTLMNLFLLVICRSKVPFLRNHLYYLQNFSTDENN 416
            + LQ L++      D+   P+ +DADTL++ F+LV+CR++V  +++HL+YL+ FS DEN+
Sbjct: 345  NTLQSLSNTREQDMDIQTLPITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENS 404

Query: 417  VKFGLLGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNKELISKISSEA-DHSTFQVKL 475
            +KFG+LGY IST EA + Y    +  +K  K   +  + KEL   IS ++   +   +  
Sbjct: 405  IKFGILGYAISTLEAVVFYFDGLKGTKKLQKLQDDSNKAKELYILISDKSTGQAVLDISQ 464

Query: 476  YKDCFKFRNEMGESILALCIKHKKNETLFEILLNFEDMFPXXXXXXXXXXXGTTLLMKAL 535
            ++   +FR   GES+L+ CI + KN  L+E+L N+ED+FP           G+TLL++AL
Sbjct: 465  FRSNLEFRTPQGESVLSQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTLLIQAL 524

Query: 536  KVENEVGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVLKRIGLFFNWKI 595
            K +N   A++IV+VLQ+SC+E EL +Y NR D N+R  AHY+T+++++L+ IG + NWK 
Sbjct: 525  KCDNSEAAQMIVEVLQNSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYINWKS 584

Query: 596  KDDKGYTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHNDSKENTLLHIL 655
            +D  G+TPL TI R YDQ+ YE MI  AF  A +WY+   +   F DH D+K NTLLHI+
Sbjct: 585  QDSNGHTPLFTIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNTLLHII 644

Query: 656  KCDIQVLLKYDNININAHNLKYITPLMTYVKYNRVSNIQEIIRDERLILGKYQKHTFLDC 715
            K ++ +LL YDN++IN  N K +TPLM Y +YNR  N++ IIRD+R+IL K Q  +FL+ 
Sbjct: 645  KNNVSILLDYDNVDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLNS 704

Query: 716  YDFVKNTIIFEDLGVRSVRNSMFNLFSAYSLRVENSNWVLYFTFK--DTNQDSYITKSVS 773
            +D+ +N ++ ++L  ++++ + F L   + L+ E  +W  + T K      + Y T  + 
Sbjct: 705  FDYARNPLVLKELVSQAIKTTAFELAFVHHLKYEAPSWFFHITVKIGAGADEEYKTVKLH 764

Query: 774  LKILFNIIKKYNKLYPLHFIPHKEVLLRLTGIVKNNPNNGIQKLKNRAFLNLISNYFGTL 833
            +K L N+ +   K++   F+P ++ L  L+ + K+   + I KL+   F  ++++ F  L
Sbjct: 765  IKTLQNLFQVLLKMHFASFLPLEKALEDLSNLYKSRMPS-IAKLETLYFFYMLTDCFDVL 823

Query: 834  IETDDFDTELFKNPESLTKWIKAGKRK---HKKENYYKRMTLDDINMIKSFVQFNINELG 890
            +  D+ + +L      L  WI++  +K    KK    K +  ++I ++ SF++FN  EL 
Sbjct: 824  LRHDNLN-KLVLRESRLVSWIRSQDKKCNNSKKLQKQKNVEPEEIGIMASFLRFNRGELS 882

Query: 891  KLNRTLAILKKLCTFLALKINDVNESYKLFRNFGA---LLQQKDISNQMKKIDGLIKPKY 947
             +   L  +KKL  FL LK  D+  SY+    FG    L Q + +   ++    +    +
Sbjct: 883  AVKLKLMTMKKLLIFLKLKNTDLTHSYQFLSLFGTEYNLAQDRLLFKDLE----INCCAF 938

Query: 948  FQSIFLILLDQISFLEICTIHMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDFSDFDS 1007
             +   +  + +I+FLE CT  + D    L+  DIPEW  ++  +  + K YK+ F +  S
Sbjct: 939  GEEATMTFVREIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPNI-S 997

Query: 1008 RNGLNENILSRYTKNKREAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEEFNKFLTFK 1067
            RN     I++ + + KRE  E ++S ++ +      +V   I   HE LAEE +K++ FK
Sbjct: 998  RNDSGTGIIASFFEGKREKMESKLSSDLADCKKRMRRVGDRISSTHEILAEELSKYMEFK 1057

Query: 1068 SRFFKDVILNMIIPSAIATLKDQVLNIEN---IHNKQFENN 1105
            S FF + IL   +   I  LK +++ +       +++ ENN
Sbjct: 1058 SNFFINGILRRAVRENINILKGRLVEMRKRALYRSRKGENN 1098

>Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/1083 (34%), Positives = 610/1083 (56%), Gaps = 41/1083 (3%)

Query: 6    YHMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLTLK 65
            YH+P LLNPLINA+FNCP+P  SPL+KLF  ++ + F+L+ PP+ +LL+Y D +  L L 
Sbjct: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKLPLH 63

Query: 66   ELCYEFEFVASHIILDTDNSSNNLQVKGKNSNETLDNRYKSXXXXXXXXXXXXXXPLDFN 125
            ELCY  +F+ SHI+L T+NS  N  ++  +  ETLD +                 PL   
Sbjct: 64   ELCYNADFINSHILLTTENSYINTTLRDDHY-ETLDGKTVVVQWKNNVIHTLNGFPL--- 119

Query: 126  NSTQXXXXXXXXXXXLPNFNEYLSGSEKYTIIYTDYPFSNSWLPKIEIESFYISKKESNN 185
                           LPNFN+Y  G+E + I+Y D P    ++P   +  F       N+
Sbjct: 120  ----RRRLKILDTKILPNFNDYFKGAEYFAILYIDQPLGCEFVPNDYLHCF-------NS 168

Query: 186  IKAAQITNHKSP-LSQDLAQKTKSSFRHIINIHKEWNNIFDSYIIDFKNKQLNLTSLPIY 244
             +    T   +P L  D +Q  +SSF +I++IH  W         +++   LN       
Sbjct: 169  YEETSKTARNAPNLLMDTSQLERSSFENILHIHPAWLTQLGQLFSNYRRAALNDDPSKKM 228

Query: 245  FREIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHIDRNMIDNQFLHTEMM 304
            F E+V++A+  MK + +F +F N LY+LI +Y E + Y  IW  +  +    + ++TE  
Sbjct: 229  FEELVEQAFDGMKSDSLFKNFSN-LYDLIHDYFELNLYEDIWSRLTIHFKGYE-VNTENC 286

Query: 305  DFLSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSHSEKCQILIDALQ 364
            ++ S++QL  + Y+++F+ F L ++  +ER V  A+  F+K+  S S++EK +IL++ LQ
Sbjct: 287  EYFSVNQLLTDYYSKDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVETLQ 346

Query: 365  KLTSYDDV-HYEP--------LMVDADTLMNLFLLVICRSKVPFLRNHLYYLQNFSTDEN 415
             L+   D+  ++P        L +DADTL++LF+LV+CRS+   +R+HLYYLQNFS + +
Sbjct: 347  HLSGTTDMGSHKPDLSNGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNFSNNSS 406

Query: 416  NVKFGLLGYGISTFEATLCYLKDFQAGEKFNKQV-LNCIRNKELISKISSE-ADHSTFQV 473
            + KFG+LGY IST EA +CY ++F        +  L CI+ ++L+ K+S E   +    +
Sbjct: 407  SSKFGILGYAISTLEAVVCYFENFNKNNNNVAKANLLCIKTRDLLDKLSCENPTNEVNDL 466

Query: 474  KLYKDCFKFRNEMGESILALCIKHKKNETLFEILLNFEDMFPXXXXXXXXXXXGTTLLMK 533
              YKD   +RNE G+SIL+LCI + KN+ L ++L  +E +FP           G+TLL++
Sbjct: 467  ATYKDILAYRNEQGQSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGSTLLIE 526

Query: 534  ALKVENEVGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVLKRIGLFFNW 593
            ++KV N    K+++ ++  +C+++EL+ Y N+TD   R  AHY+T+++D+LK IG + NW
Sbjct: 527  SIKVGNLEATKILIRIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIGSYINW 586

Query: 594  KIKDDKGYTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHNDSKENTLLH 653
            K K+  G TPL +I R+YDQ  YE+M++ AF  A  WY+  N    + DH D+K N+LLH
Sbjct: 587  KQKNSSGQTPLFSIFRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLH 646

Query: 654  ILKCDIQVLLKYDNININAHNLKYITPLMTYVKYNRVSNIQEIIRDERLILGKYQKHTFL 713
            +LK D+ +LL+   +NIN  N K +TPLM YVKY R+SNI  I +D RLIL K Q  TF 
Sbjct: 647  VLKTDVSILLQLTKLNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQNSTFF 706

Query: 714  DCYDFVKNTIIFEDLGVRSVRNSMFNLFSAYSLRVENSNWVLYFTFKDTNQDSYITKSVS 773
             C+D+ K+ ++   +G R   +S+F L   +SLR  N N  +  T     ++ ++T  ++
Sbjct: 707  TCFDYAKDRLVLSKIGERGANDSIFGLIYLHSLRYHNLNATVNVTSVSKTEEPFVTAVIN 766

Query: 774  LKILFNIIKKYNKLYPLHFIPHKEVLLRLTGIVKNNPNNGIQKLKNRAFLNLISNYFGTL 833
            +K +  +++   K  P  F+P    +  ++ + +++    I K   R+ L+ ++N F  L
Sbjct: 767  MKTIQGLLRSIVKDNPFTFLPIDNYIDGISHLNRSDL-TIIGKADVRSLLHKLTNCFNVL 825

Query: 834  IETDDFDTELFKNPESLTKWIK--AGKRKHK--KENYYKRMTLDDINMIKSFVQFNINEL 889
            +        LF +  S+  W++    +R  K   ++  K M  ++INMI+SF++FN +E+
Sbjct: 826  LFLKKVPQNLFTDEASVLYWMRINTSRRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEI 885

Query: 890  GKLNRTLAILKKLCTFLALKINDVNESYKLFRNFGALLQQKDISNQMKKIDGLIKPKYFQ 949
                 +L IL+K+  FL+LK +D  ++Y      G  +     ++    I  +   K F 
Sbjct: 886  LSFKASLNILRKILIFLSLKSSDFEDAYASLLKMGTKVTNGKAADAFTTI--IKNHKMFS 943

Query: 950  SIFL-ILLDQISFLEICTIHMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDFSDF--- 1005
             + L  LL+ + FLE CTI + ++   ++ + IP W   +     L K Y++ F      
Sbjct: 944  DLSLDELLEHVQFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAVKP 1003

Query: 1006 DSRNGLNENI-LSRYTKNKREAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEEFNKFL 1064
             S  G + +I L  + + KRE +E+R+S +I  ++ +  ++ + I+ AHENLAEE + ++
Sbjct: 1004 KSTAGTSSHIPLGGFIETKREQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYM 1063

Query: 1065 TFK 1067
             F+
Sbjct: 1064 EFR 1066

>TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {ON}
            Anc_6.20 YML002W
          Length = 1093

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/1105 (33%), Positives = 610/1105 (55%), Gaps = 38/1105 (3%)

Query: 4    LSYHMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLT 63
            + YH+PVLLNPL+NAVFNCP+P  S L+KLF  +K + F+L+VPP + LL   D   G  
Sbjct: 1    MPYHLPVLLNPLVNAVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSP 60

Query: 64   LKELCYEFEFVASHIILDTDNSSNNLQVKGKNSNETLDNRYKSXXXXXXXXXXXXXXPLD 123
            L+ELCY +EFVASH++L  + ++  +     +       ++ +               L 
Sbjct: 61   LQELCYSYEFVASHVLLIDEQNAEYMTTAPPSQV-----KFDTLNGKKVIVRSQNRIILT 115

Query: 124  FNNSTQXXXXXXXXXXXLPNFNEYLSGSEKYTIIYTDYPFSNSWLPKIEIESFYISKKES 183
             +                 NFNEYL    K+ I+  D P        +  +   IS+   
Sbjct: 116  SDGFQVKKRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAE---SVRTQRVQISQTLG 172

Query: 184  NNIKAAQITNHKSPLSQDLAQKTKSSFRHIINIHKEWNNIFDSYIIDFKNKQLNLTSLPI 243
            +  +    T   S  + D +Q +KSSF +I+ IH +W   F+    ++++          
Sbjct: 173  SGKRE---TKDGSSPTLDSSQGSKSSFDNILRIHPDWALKFNELFAEYRSTPEGDDPHIE 229

Query: 244  YFREIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHIDRNMIDNQFLHTEM 303
             F +I+ +AY  M+ + +F S   DL +LI++Y+E + Y+ IW  I  +  D++ + +  
Sbjct: 230  LFHDIIRRAYSAMRSDALFASM-PDLSDLIYDYVELNLYDDIWVRITHHFKDSE-VESNG 287

Query: 304  MDFLSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSHSEKCQILIDAL 363
            + +LS+ QLE  LY   F++FNL +V+ +E  ++ A + F ++  + +H++K   LID L
Sbjct: 288  LRYLSLHQLETGLYPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTL 347

Query: 364  QKLTSYDDVHYE--PLMVDADTLMNLFLLVICRSKVPFLRNHLYYLQNFSTDENNVKFGL 421
            + L+  D    E  P+ + ADTL++LF+LVICR+++  L+  L+YLQNF+ +E ++ FG+
Sbjct: 348  RNLSRVDKSIQEVSPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGV 407

Query: 422  LGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNKELISKISSEADHSTFQVKLYKDCFK 481
            LGY IST EA +CY  + +  +K ++    C   + L+ K+SSE+  S+  +  Y+    
Sbjct: 408  LGYAISTLEAAVCYFDELKGSKKMSRLESECENARSLVDKLSSES--SSVNLIHYQKTLS 465

Query: 482  FRNEMGESILALCIKHKKNETLFEILLNFEDMFPXXXXXXXXXXXGTTLLMKALKVENEV 541
            +R E GES+L++CI + KN+ L E LL+ E  FP           G TLLM++LK  N  
Sbjct: 466  YRTEQGESLLSICIANGKNDILQE-LLSDERSFPLEDILEDQTTEGCTLLMQSLKCGNGD 524

Query: 542  GAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVLKRIGLFFNWKIKDDKGY 601
             A LIVD+++SSC+++E+  YFNR+D ++R AAHY+T++I++L++IG FF+W +KD  G+
Sbjct: 525  AASLIVDLIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWDVKDSSGH 584

Query: 602  TPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHNDSKENTLLHILKCDIQV 661
            T L TI R+YDQ  Y+ MI  +F  A +WY  R +   F  H D KENTLLHILK  I +
Sbjct: 585  TALFTIFRSYDQPNYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILKRSISI 644

Query: 662  LLKYDNININAHNLKYITPLMTYVKYNRVSNIQEIIRDERLILGKYQKHTFLDCYDFVKN 721
            LL+Y+++++NA N K +TPLM Y KYNR+ N + I+ D+R+ILGK Q    L   D+ KN
Sbjct: 645  LLEYESVDVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPLLLCSIDYAKN 704

Query: 722  TIIFEDLGVRSVRNSMFNLFSAYSLRVENSNWVLYFTFKDTNQDSYITKSVSLKILFNII 781
             +I  ++  +S  ++ F     ++L+ E+S+W++  T +   + ++ T    LK + N  
Sbjct: 705  PLILHEIAKQSAMDTAFGKCFVHTLKYESSSWLVNITVQADRKGNFETVEFHLKTVQNFF 764

Query: 782  KKYNKLYPLHFIPHKEVLLRLTGIVKNNPNNGIQKLKNRAFLNLISNYFGTLIETDDFDT 841
            +   +  P+ F+P    L +L  + K   ++ I KL+   +L  ++N F  LI + +   
Sbjct: 765  RTVLRTCPMTFLPLDSTLNQLASLGKARLSS-IGKLETVCYLRSLTNCFNVLINSQELPK 823

Query: 842  ELFKNPESLTKWIKA---GKRKHKKENYYKRMTLDDINMIKSFVQFNINELGKLNRTLAI 898
            ++  N   L  WIK      R      + K++  +++++I+ F++FN  EL  L   L +
Sbjct: 824  DILANESKLLSWIKVQYKAFRNGTTHIFSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHV 883

Query: 899  LKKLCTFLALKINDVNESYKLFRNFGALLQQKDISNQMKKIDGLIKPK------YFQSIF 952
            +KKL  FL LK +DV +S +L    G        S  M  +  L   K      Y     
Sbjct: 884  MKKLAIFLRLKSSDVEQSVELLLPLG--------SEGMGDLYPLTDHKFSCTTVYGNDSM 935

Query: 953  LILLDQISFLEICTIHMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDFSDF--DSRNG 1010
            ++L++ I  +  CTI + D+ N+L++  IPEW  ++  L N +KQY ++F     +    
Sbjct: 936  ILLVEDIDLMLKCTIRLYDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFPHLVKNGETS 995

Query: 1011 LNENILSRYTKNKREAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEEFNKFLTFKSRF 1070
             +  I+ +  + K+E  EKR+S  I E     ++  A I + HE+LAE+ +KF+ FK  +
Sbjct: 996  TDAGIIGKILEGKKEKLEKRLSFSIAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAY 1055

Query: 1071 FKDVILNMIIPSAIATLKDQVLNIE 1095
                ++   +   I  LK+++++I+
Sbjct: 1056 ICRGVIKRWVRENIKELKERLIHIQ 1080

>Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1088
            aa] {ON} ANNOTATED BY YGOB -
          Length = 1088

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/1103 (33%), Positives = 608/1103 (55%), Gaps = 46/1103 (4%)

Query: 4    LSYHMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLT 63
            + YH+P+LLNPL+N+VFNCP P  SPL+K+F  ++ + F+L+VP   ILLHY+D + G +
Sbjct: 1    MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS 60

Query: 64   LKELCYEFEFVASHIILDTDNSSNNLQVKGKNSNETLDNRYKSXXXXXXXXXXXXXXPLD 123
            L++LCY +EFVA+HII+   +S  +            D  +K+               L 
Sbjct: 61   LQDLCYTYEFVANHIIILKKDSKYS------------DQEFKTLNGKTVLIRSQNGIVLT 108

Query: 124  FNNSTQXXXXXXXXXXXLPNFNEYLSGSEKYTIIYTDYPFSNSWLPKIEIESFYISKKES 183
             +                 NFN+YL GS+ + +I+ D P  +  +   E++ F +    +
Sbjct: 109  GDGFPSKRRCKITNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVFGVRSTNT 168

Query: 184  NNIKAAQITNHKSPLSQDLAQKTKSSFRHIINIHKEWNNIFDSYIIDFKNKQLN-----L 238
            +++          PLS DL Q+  SSF  +  +H +  + F S +   + +++N     L
Sbjct: 169  SSL----------PLSTDLTQREVSSFEQLFRLHPQLGDRF-SGLFKEQRQEINANFKGL 217

Query: 239  TSLPIYFREIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHIDRNMIDNQF 298
             SL  +F +   +A++ ++ E  F + H+ L+  +  Y+E + Y+ IW  I +   D++ 
Sbjct: 218  DSLVDFFDKFNYEAFELIRHERRFEN-HSKLHQTVHNYVELNLYDDIWKQITQLYRDDEI 276

Query: 299  LHT---EMMDFLSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSHSEK 355
              T    ++ +++I Q+    Y +   KF+L  V   E+ ++ ATD FK++  S SHSEK
Sbjct: 277  EATYDYNLLKYIAISQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEK 336

Query: 356  CQILIDALQKLTSYD---DVHYEPLMVDADTLMNLFLLVICRSKVPFLRNHLYYLQNFST 412
             +I++D LQ LT Y    D   E + +DADTL+ L +LV+CRS+V  L++HL+YLQNFS 
Sbjct: 337  TKIIMDTLQTLTDYSEFPDADIEDVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSL 396

Query: 413  DENNVKFGLLGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNKELISKISSEADHSTFQ 472
            DEN +KFG++ Y +ST EA LCY +D +   K      NC RNK+    +S +A  S   
Sbjct: 397  DENTIKFGVVAYALSTLEAVLCYFEDAENSGKIRSLEFNCRRNKQFWDHLSCKA-VSFDS 455

Query: 473  VKLYKDCFKFRNEMGESILALCIKHKKNETLFEILL-NFEDMFPXXXXXXXXXXXGTTLL 531
            +K Y+D  + R   GES L++CI+ K N +  E LL NFE   P           G+TLL
Sbjct: 456  LKSYRDILRIRTAGGESCLSVCIQ-KGNFSGIECLLQNFEHELPLEDILDDQTINGSTLL 514

Query: 532  MKALKVENEVGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVLKRIGLFF 591
            M+ L+  N   A +++++L  SC+ +EL +Y NR +  +R AAHY+T  + +  +IG+FF
Sbjct: 515  MQTLETGNTRMADVLLEILCQSCTINELREYLNRRNRWKRTAAHYLTQDLQMADKIGIFF 574

Query: 592  NWKIKDDKGYTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHNDSKENTL 651
            +W+ KD  G+TPL  I R+YD   Y QM+  AF  A KWYE R +  NF  H D+K NTL
Sbjct: 575  DWEAKDISGHTPLFAIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTL 634

Query: 652  LHILKCDIQVLLKYDNININAHNLKYITPLMTYVKYNRVSNIQEIIRDERLILGKYQKHT 711
            LH++K +I++LL+ +NI++N  N K +TPLM YVKYNR+ N++ I+RD RLI+ K+QK  
Sbjct: 635  LHVMKTNIEILLEQENIDVNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSL 694

Query: 712  FLDCYDFVKNTIIFEDLGVRSVRNSMFNLFSAYSLRVENSNWVLYFTFKDTNQDS-YITK 770
            FL+C+D+VKN +I  +LG  +   + F    A++ R EN+ W L+ T K  ++++ + T 
Sbjct: 695  FLNCFDYVKNPVIQAELGFHAAEKTKFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTV 754

Query: 771  SVSLKILFNIIKKYNKLYPLHFIPHKEVLLRLTGIVKNNPNNGIQKLKNRAFLNLISNYF 830
              +++ +  +++ Y +  P+ F+P   VL  L  I K    + + KL+   FL  ++   
Sbjct: 755  KHNIRAIQGLLQVYLRRNPMSFLPIDAVLEDLHEIGKTGLVS-VGKLEVHRFLCELTLVL 813

Query: 831  GTLIETDDFDTELFKNPESLTKWIKAGKRKHKKENYYKRMTLDDINMIKSFVQFNINELG 890
              + + ++F   L+     L  WI+   R  K+ N  +R+  ++IN I+SF++FN++EL 
Sbjct: 814  KLICQKEEFKKALYLPASDLVNWIRESGR--KRTNVSRRIEPEEINSIQSFLRFNLSELS 871

Query: 891  KLNRTLAILKKLCTFLALKINDVNESYKLFRNFGALLQQKDISNQMKKIDGLIKPKYFQS 950
             +   ++IL+KL  F  LK  D+N++  +  +    L+   IS Q   I GL +      
Sbjct: 872  LIRDKISILQKLSIFSELKAQDINQARCMLFSQSVRLEDTAIS-QAFGISGLSEKDSEDL 930

Query: 951  IFLILLDQISFLEICTIHMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDFSDFDSRNG 1010
               IL   I FL+ CT  +    + L++  +  W  ++  L + + QY ++F +   +  
Sbjct: 931  SATILTSNIDFLKECTNKLVGKIDQLLQGKLTRWWKLYAELLDARNQYNKNFPN-SVKPH 989

Query: 1011 LNEN--ILSRYTKNKREAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEEFNKFLTFKS 1068
            L++N  +   Y + KR   E+++S +I         +T  +   HE LAEE + +L FK+
Sbjct: 990  LDDNKGLFGTYVEGKRSKLEEKLSAQIKSCLERLQTLTYEVKQEHEALAEELSIYLEFKT 1049

Query: 1069 RFFKDVILNMIIPSAIATLKDQV 1091
             + +  I+       I TLKD +
Sbjct: 1050 NYLRTGIIQDFTVGKINTLKDTM 1072

>Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/1082 (33%), Positives = 602/1082 (55%), Gaps = 39/1082 (3%)

Query: 6    YHMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLTLK 65
            YH+P LLNPLINA+FNCP+P  SPL+KLF  +K + F+L+ PP   LL+Y D +  L L 
Sbjct: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKLPLH 63

Query: 66   ELCYEFEFVASHIILDTDNSSNNLQVKGKNSNETLDNRYKSXXXXXXXXXXXXXXPLDFN 125
            ELCY  +F+ SHI+L T+NS  N  ++  +  ETLD +                 P+   
Sbjct: 64   ELCYNVDFINSHILLTTENSYLNTTLRDSHY-ETLDGKAVVIQWKNNIIHALNGFPI--- 119

Query: 126  NSTQXXXXXXXXXXXLPNFNEYLSGSEKYTIIYTDYPFSNSWLPKIEIESFYISKKESNN 185
                           LPNFN+Y  G+  + I++ D P +    P   ++ F   ++   N
Sbjct: 120  ----RQRLKILETKVLPNFNDYFEGAADFAILFIDQPLNCEVAPNDYLKCFDSYEEVPKN 175

Query: 186  IKAAQITNHKSPLSQDLAQKTKSSFRHIINIHKEWNNIFDSYIIDFKNKQLNLTSLPIYF 245
             ++       S L  +  ++ +SSF +I++IH            +++    N       F
Sbjct: 176  AQSV------SNLPVNSYEQERSSFDNILHIHSARLAQLGQLFSNYRRLAPNDDPSKKMF 229

Query: 246  REIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHIDRNMIDNQFLHTEMMD 305
             +IV +++  MK + +F +F N LY+LI +Y E + Y+ IW  +  +    + + TE   
Sbjct: 230  EDIVQQSFDGMKSDSLFKNFSN-LYDLIHDYFELNLYDDIWSRLVTHFKGYE-VDTEKYK 287

Query: 306  FLSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSHSEKCQILIDALQK 365
            + S++QL  + ++++F++F L ++  +ER V  A+  F+K+  + S++EK +IL++ LQ+
Sbjct: 288  YFSVNQLLADFFSKDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVETLQQ 347

Query: 366  LTSYDDV--HYE-------PLMVDADTLMNLFLLVICRSKVPFLRNHLYYLQNFSTDENN 416
            L+   ++  H +        L +DADTL++LF+LV+CRS+   L++HLYYLQNFS + ++
Sbjct: 348  LSGPTEISSHQQELPNGLNSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSS 407

Query: 417  VKFGLLGYGISTFEATLCYLKDF-QAGEKFNKQVLNCIRNKELISKISSEADHSTFQ-VK 474
             KFG+LGY IST EA +CY +DF +  E   K  ++  + +EL+ K+SSE   +  + + 
Sbjct: 408  TKFGILGYAISTLEAVVCYFEDFDKNNENLAKANVSYQKTRELLDKLSSENPTNEIENLA 467

Query: 475  LYKDCFKFRNEMGESILALCIKHKKNETLFEILLNFEDMFPXXXXXXXXXXXGTTLLMKA 534
             Y+D  ++RNE G+SIL++CI + KN  L ++L  +ED+FP           G+TLL+++
Sbjct: 468  TYEDNLQYRNEQGQSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTLLIES 527

Query: 535  LKVENEVGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVLKRIGLFFNWK 594
            +K  N   AK+++ ++  +CSE EL+ Y N+ D   R  AHY+T+++D+LK IG + +WK
Sbjct: 528  IKTGNIEAAKILIGIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSIGSYVDWK 587

Query: 595  IKDDKGYTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHNDSKENTLLHI 654
             K+  G TPL +I RTYDQ  YE+M++ AF  A  WY+  N   ++ DH DSK N+LLHI
Sbjct: 588  RKNSSGQTPLFSIFRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHI 647

Query: 655  LKCDIQVLLKYDNININAHNLKYITPLMTYVKYNRVSNIQEIIRDERLILGKYQKHTFLD 714
            LK D+ +LL+   ++IN  N K +TPLM YVKY R+SNI  I +D RLIL K Q  TF  
Sbjct: 648  LKSDVSILLQLSKLDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNSTFFT 707

Query: 715  CYDFVKNTIIFEDLGVRSVRNSMFNLFSAYSLRVENSNWVLYFTFKDTNQDSYITKSVSL 774
            C+D+ K+  +   +G R  R+S+F L   +SLR  N N     T        ++T  +++
Sbjct: 708  CFDYAKDHSVLSKIGERGARDSLFGLVYLHSLRYHNLNATTNITTASNTDKPFLTTVINM 767

Query: 775  KILFNIIKKYNKLYPLHFIPHKEVLLRLTGIVKNNPNNGIQKLKNRAFLNLISNYFGTLI 834
            K +  +++   K     F+P    +  ++ + +++    I K   R+ L+ ++N F  L+
Sbjct: 768  KTIQGLLRSILKDNQFTFLPLNSYIDEISHLNRSDL-TIIGKADVRSLLHKLTNCFNVLL 826

Query: 835  ETDDFDTELFKNPESLTKWIK--AGKRKHK--KENYYKRMTLDDINMIKSFVQFNINELG 890
                    LF +  S+  W++    KR  K   ++  K M  ++INMI+SF++FN +E+ 
Sbjct: 827  FLKKVPQNLFTDEASVLYWMRINTSKRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEIS 886

Query: 891  KLNRTLAILKKLCTFLALKINDVNESYKLFRNFGALLQQKDISNQMKKIDGLIKPKYFQS 950
                +L IL+K+  FL+LK ND  ++Y   R  G  +   + ++   +I        F  
Sbjct: 887  SFKASLNILRKILIFLSLKSNDFEDTYDSLREMGRKIINGEAADAFARI--FTNHNMFSD 944

Query: 951  IFLI-LLDQISFLEICTIHMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDFSDF---- 1005
            + L  LL+ +SFLE CTI +S     ++ + I +W   +     L+K Y++ F       
Sbjct: 945  LALAELLEHVSFLEQCTIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVKPK 1004

Query: 1006 DSRNGLNENILSRYTKNKREAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEEFNKFLT 1065
             + +  +   L  + + KRE +E+R++ +I  ++ +  ++ + I+ AHE LAEE + ++ 
Sbjct: 1005 SATDTPSHIPLGSFIETKREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNYME 1064

Query: 1066 FK 1067
            F+
Sbjct: 1065 FR 1066

>Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  600 bits (1548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/1088 (34%), Positives = 598/1088 (54%), Gaps = 53/1088 (4%)

Query: 7    HMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLTLKE 66
            H+P LLNPLINA+FNCP+P  SPL+KLF  +K   F+L+ PP+E LL+Y D +  L L E
Sbjct: 5    HLPTLLNPLINAIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKLPLHE 64

Query: 67   LCYEFEFVASHIILDTDNSSNNLQVKGKNSNETLDNRYKSXXXXXXXXXXXXXXPLDFNN 126
            LCY  EF+ SHI+L T+NS  N   +        D+ Y++                  N 
Sbjct: 65   LCYNAEFINSHILLMTENSFINTNSR--------DSHYETLDGKTVVIQWKNNVIHALNG 116

Query: 127  STQXXXXXXXXXXXLPNFNEYLSGSEKYTIIYTDYPFSNSWLPKIEIESFYISKKESNNI 186
                          LPNFN+Y  G+  + IIY + P S   +P   ++ F+  KK   ++
Sbjct: 117  FQVRRRLKILGTKILPNFNDYFEGATDFVIIYIEQPLSCESVPNDYLQCFHSYKKIPKSV 176

Query: 187  KAAQITNHKSPLSQDLAQKTKSSFRHIINIHK----EWNNIFDSYIIDFKNKQLNLTSLP 242
             +         LS D +Q+ +SSF +I++IH     +   +F +Y      + L  +  P
Sbjct: 177  YSVH------NLSLDSSQQERSSFENILHIHPTRLTQLGEMFSNY------RTLAPSDDP 224

Query: 243  I--YFREIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHIDRNMIDNQFLH 300
                F  IV +A++ MK + +F  F N LY+LI EY E + Y+ IW  +  +    + + 
Sbjct: 225  SEKIFECIVQQAFEGMKSDSLFKKFPN-LYDLIHEYFELNLYDDIWSRLTSHFKSYE-VG 282

Query: 301  TEMMDFLSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSHSEKCQILI 360
            TE   + SI+ L  + Y+++F++F L +V  +E+ V  A+  F+K+  + S++EK +IL+
Sbjct: 283  TEEYKYFSINHLLADFYSKDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILV 342

Query: 361  DALQKLTSYDDVHYEPLMV---------DADTLMNLFLLVICRSKVPFLRNHLYYLQNFS 411
            + LQ+L+   D+    L V         DADTL++LF+LVICRS+   L++HLYYLQNFS
Sbjct: 343  ETLQELSGTTDMGSHQLDVPGRLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFS 402

Query: 412  TDENNVKFGLLGYGISTFEATLCYLKDFQA-GEKFNKQVLNCIRNKELISKISSE-ADHS 469
             + ++ KFG+LGY +ST EA +CY +DF+   +   K  +   + K L++ +S E   + 
Sbjct: 403  NNSSSSKFGILGYAVSTLEAVVCYFEDFKKNSDNMAKANVLLQKTKRLVNMLSCENVTNK 462

Query: 470  TFQVKLYKDCFKFRNEMGESILALCIKHKKNETLFEILLNFEDMFPXXXXXXXXXXXGTT 529
               +  YKD   +RN  G+SIL++CI + KN  L +IL  ++ +FP           G+T
Sbjct: 463  VENLATYKDILPYRNGQGQSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGST 522

Query: 530  LLMKALKVENEVGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVLKRIGL 589
            LL++++K  N   AK+++ ++  +C+E+ELI Y NRTD   R  AHY+T++ID+LK IG 
Sbjct: 523  LLIESIKSGNLEAAKILIRIMMLNCTEEELISYINRTDKYSRTVAHYLTHEIDILKSIGN 582

Query: 590  FFNWKIKDDKGYTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHNDSKEN 649
            + +WK K+  G TPL +I R+YDQ  YE M++ AF  A  WY  +N+  +++DH D+K N
Sbjct: 583  YVDWKRKNSGGQTPLFSIFRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGN 642

Query: 650  TLLHILKCDIQVLLKYDNININAHNLKYITPLMTYVKYNRVSNIQEIIRDERLILGKYQK 709
             LLH+LK D  +LL+   ++IN  N K +TPLM YVKY R++NI+ II+D+RL+L K QK
Sbjct: 643  DLLHVLKTDASILLQLTKLDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQK 702

Query: 710  HTFLDCYDFVKNTIIFEDLGVRSVRNSMFNLFSAYSLRVENSNWVLYFTFKDTNQDSYIT 769
             TF  C+D+ K+  +   +G R  ++S+F L   +SLR  N N  +  TF    +  +  
Sbjct: 703  STFFTCFDYAKDHTVLSKVGERGAKDSLFGLIYFHSLRYHNLNAAVNITFASDTEKPFSN 762

Query: 770  KSVSLKILFNIIKKYNKLYPLHFIPHKEVLLRLTGIVKNNPNNGIQKLKNRAFLNLISNY 829
              +++K +  +++   K  P  F+P    +  ++ + +++    I K    + L+ +SN 
Sbjct: 763  TVINMKTIQGLLRSILKDNPFTFLPLNIYIDEISQLSRSDV-TIIGKADVMSLLHKLSNC 821

Query: 830  FGTLIETDDFDTELFKNPESLTKWIK--AGKRKHK---KENYYKRMTLDDINMIKSFVQF 884
            F  L+        LF +  S+  W++    KR  K   KEN YK M  ++INMI+SF++F
Sbjct: 822  FNVLLFLKKVPKSLFTDEASILYWMRINTSKRNQKQPSKEN-YKTMEPEEINMIQSFLRF 880

Query: 885  NINELGKLNRTLAILKKLCTFLALKINDVNESYKLFRNFGALLQQKDISNQMKKIDGLIK 944
            N +E+     +L+IL+K+  F++LK ND  +        G  +     ++       L  
Sbjct: 881  NFDEISSFKASLSILRKILIFISLKSNDFKDVNDNLNEMGKSIYNAKAADAFA--GNLTN 938

Query: 945  PKYFQSIFLI-LLDQISFLEICTIHMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDFS 1003
               F    L  LL+ + FLE CTI +S+    ++   IP W   +  L  L K Y++ F 
Sbjct: 939  HNMFNDYSLAKLLEHVRFLEECTIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFP 998

Query: 1004 DF---DSRNGLNENI-LSRYTKNKREAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEE 1059
                  S    + +I L  + + KRE +E+R++ +I  ++    ++ + I+ AHE LAEE
Sbjct: 999  SVVKPKSTTDTSGHIQLGGFIETKREQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEE 1058

Query: 1060 FNKFLTFK 1067
             + ++ F+
Sbjct: 1059 LSNYMEFR 1066

>TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.20
            YML002W
          Length = 1107

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/1108 (34%), Positives = 606/1108 (54%), Gaps = 36/1108 (3%)

Query: 4    LSYHMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLT 63
            ++Y MPVL NPLINAVFNCPDP  SP +KL+  ++ K+F+L+VP + ILL+Y+D    ++
Sbjct: 1    MAYFMPVLKNPLINAVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNIS 60

Query: 64   LKELCYEFEFVASHIILDTDNSSNNLQVKGKNSNETLDNRY-KSXXXXXXXXXXXXXXPL 122
             +ELCY ++FVA+HI++   NSS +   K  +SN+   + Y KS              P+
Sbjct: 61   FRELCYTYDFVAAHILILDKNSSTD---KISSSNQKNGDVYLKSLNGKEVLLRQSLCIPI 117

Query: 123  DFNNSTQXXXXXXXXXXXLPNFNEYLSGSEKYTIIYTDYPFSNS-WLPKIEIESFYISKK 181
                S +           L NFN+YL GS  + I++ DYP   S W    E++ F    +
Sbjct: 118  KGYFSKRKSQMRDATL--LTNFNDYLHGSGHFGIMHIDYPLGVSDWTLIDELKGF----E 171

Query: 182  ESNNIKAAQITNHKSPLSQDLAQ--KTKSSFRHIINIHKEWNNIFDSYIIDFKNKQLNLT 239
            ES  +        K  L Q   +    +  F  +    K+W    + Y+  ++  +    
Sbjct: 172  ESRELPFHSQDKDKPGLLQRTEENKADRVKFIQLFQERKDWTIELEKYLKKYQAMEPLQN 231

Query: 240  SLPIYFREIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHIDRNMIDNQFL 299
                 F +IV+  Y  +K E+ F  F N LY++ +EY+ES  Y  IW+ +  +  D + L
Sbjct: 232  IGSELFHDIVNMIYNTLKEEQRFQRFTN-LYDIAYEYIESLLYQDIWNKLQEHYRD-KIL 289

Query: 300  HTEMMDFLSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSHSEKCQIL 359
               ++  LS+D L+   YN+ F+ F L++++ +E C+  A   FK I  + S+S+K  ++
Sbjct: 290  DFRLVSQLSLDMLDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKVDVI 349

Query: 360  IDALQKLT---SYDDVHYEPL----MVDADTLMNLFLLVICRSKVPFLRNHLYYLQNFST 412
               L  +T   S D +    L    ++DADTL++LF L++CR+ V  +  H+ YLQ+F  
Sbjct: 350  FKTLNIITGKNSDDTIRDNTLPKLPLIDADTLVSLFALLLCRAGVEDVFLHVQYLQSFYK 409

Query: 413  DENNVKFGLLGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNKELISKISSEADHSTFQ 472
            DEN VKFG LGY +ST EATL Y  +    ++   Q+      ++ + KI S+ D     
Sbjct: 410  DENTVKFGALGYTLSTIEATLSYFYELSNSDESRIQLQKLSLLEDFLIKIRSQHD-DLIP 468

Query: 473  VKLYKDCFKFRNEMGESILALCIKHKKNETLFEILLNFEDMFPXXXXXXXXXXXGTTLLM 532
            +  +KD F++R + GESIL+L I +KKNE L E LLNFED+FP           G+TLL+
Sbjct: 469  INQFKDYFRYRTQYGESILSLLIANKKNEALCEALLNFEDIFPLDDLLYDTDVSGSTLLI 528

Query: 533  KALKVENEVGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVLKRIGLFFN 592
            K LK  N   A++++++ Q+SC+  EL+ Y+N+TD  +R  AHYIT++I++L++IG + N
Sbjct: 529  KCLKERNLEAAEILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEILEKIGKYIN 588

Query: 593  WKIKDDKGYTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHNDSKENTLL 652
            W +KD KG T L TI R+YDQ  Y   I+ A  +A  WY+N +      DH D   ++LL
Sbjct: 589  WTLKDLKGRTALFTIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDHTDLFGDSLL 648

Query: 653  HILKCDIQVLLKYDNININAHNLKYITPLMTYVKYNRVSNIQEIIRDERLILGKYQKHTF 712
            HILK  + +LLK+++++IN  NLK +TPLMTYVKYNR+ NI+ I+ D RLI+ K QK  +
Sbjct: 649  HILKSQVSLLLKFEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLIIKKLQKDKY 708

Query: 713  LDCYDFVKNTIIFEDLGVRSVRNSMF-NLFSAYSLRVENSNWVLYFTFKDTNQDSYITKS 771
            L+C D+ KN  +F  L  +  ++ +F N + +Y+ R E S+W L  + +  + + Y T  
Sbjct: 709  LNCLDYGKNFTVFNLLAAKLSKDVIFENAYISYA-RYEKSHWYLCISVQKDDLE-YTTNI 766

Query: 772  VSLKILFNIIKKYNKLYPLHFIPHKEVLLRLTGIVKNNPNNGIQKLKNRAFLNLISNYFG 831
            + LK  +N+I    K+Y   FIP+ ++L  L  I++ +    I++LK + +LN +S+   
Sbjct: 767  IKLKKYYNLINAMQKIYKSDFIPYSDMLDCLKKIIEGHNILPIRRLKIKNYLNFLSHGLS 826

Query: 832  TLIETDDFDTELFKNPESLTKWIKAGKRKHKKE----NYYKRMTLDDINMIKSFVQFNIN 887
             L+  +  D     +   + KWI +  ++ +K     + +K ++ +DIN IK+F  F+  
Sbjct: 827  ALLYFEKIDPLTLLDENLIIKWISSKLQQQEKSIDDHSSFKPLSAEDINNIKAFCDFSFQ 886

Query: 888  ELGKLNRTLAILKKLCTFLALKINDVNESYKLFRNFGALLQQKDISNQMKKIDGLIKPKY 947
            E+GK N  +    KL  F  +K  D+N SY +    G+     +IS  +  +   I P  
Sbjct: 887  EIGKTNNVIQSFLKLSIFGEIKNTDLNTSYDILERLGSYFSNNEISRTLGDLQS-ISPHV 945

Query: 948  FQSIFLILLDQ-ISFLEICTIHMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDFSDFD 1006
              S+    L Q I F++ CT+ ++      IK+ +  W   +  L   +K+Y   F   +
Sbjct: 946  HSSMVYYELSQDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKEYSIKFLQSN 1005

Query: 1007 SRNG-LNENI-LSRYTKNK--REAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEEFNK 1062
               G L+EN  + RY  N   R+  E+R+   ++E      K+   I   HE LAEEF+ 
Sbjct: 1006 EETGNLSENTSVFRYAWNVTYRKEEERRLKFAMLELERDLKKLGTEIRVKHEELAEEFSD 1065

Query: 1063 FLTFKSRFFKDVILNMIIPSAIATLKDQ 1090
            ++  KS+F  ++++   +   +A LK+Q
Sbjct: 1066 YVRMKSKFNSNLLVRKFVSLNLAHLKEQ 1093

>Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF}
           ANNOTATED BY YGOB -
          Length = 849

 Score =  536 bits (1380), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 309/870 (35%), Positives = 493/870 (56%), Gaps = 40/870 (4%)

Query: 4   LSYHMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLT 63
           + YH+P+LLNPL+N+VFNCP P  SPL+K+F  ++ + F+L+VP   ILLHY+D + G +
Sbjct: 1   MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS 60

Query: 64  LKELCYEFEFVASHIILDTDNSSNNLQVKGKNSNETLDNRYKSXXXXXXXXXXXXXXPLD 123
           L++LCY +EFVA+HII+        L+   K S    D  +K+               L 
Sbjct: 61  LQDLCYTYEFVANHIII--------LKKDSKYS----DQEFKTLNGKTVLIRSQNGIVLT 108

Query: 124 FNNSTQXXXXXXXXXXXLPNFNEYLSGSEKYTIIYTDYPFSNSWLPKIEIESFYISKKES 183
            +                 NFN+YL GS+ + +I+ D P  +  +   E++ F +    +
Sbjct: 109 GDGFPSKRRCKITNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVFGVRSTNT 168

Query: 184 NNIKAAQITNHKSPLSQDLAQKTKSSFRHIINIHKEWNNIFDSYIIDFKNKQLN-----L 238
           +++          PLS DL Q+  SSF  +  +H +  + F S +   + +++N     L
Sbjct: 169 SSL----------PLSTDLTQREVSSFEQLFRLHPQLGDRF-SGLFKEQRQEINANFKGL 217

Query: 239 TSLPIYFREIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHIDRNMIDNQF 298
            SL  +F +   +A++ ++ E  F + H+ L+  +  Y+E + Y+ IW  I +   D++ 
Sbjct: 218 DSLVDFFDKFNYEAFELIRHERRFEN-HSKLHQTVHNYVELNLYDDIWKQITQLYRDDEI 276

Query: 299 LHT---EMMDFLSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSHSEK 355
             T    ++ +++I Q+    Y +   KF+L  V   E+ ++ ATD FK++  S SHSEK
Sbjct: 277 EATYDYNLLKYIAISQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEK 336

Query: 356 CQILIDALQKLTSYD---DVHYEPLMVDADTLMNLFLLVICRSKVPFLRNHLYYLQNFST 412
            +I++D LQ LT Y    D   E + +DADTL+ L +LV+CRS+V  L++HL+YLQNFS 
Sbjct: 337 TKIIMDTLQTLTDYSEFPDADIEDVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSL 396

Query: 413 DENNVKFGLLGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNKELISKISSEADHSTFQ 472
           DEN +KFG++ Y +ST EA LCY +D +   K      NC RNK+    +S +A  S   
Sbjct: 397 DENTIKFGVVAYALSTLEAVLCYFEDAENSGKIRSLEFNCRRNKQFWDHLSCKA-VSFDS 455

Query: 473 VKLYKDCFKFRNEMGESILALCIKHKKNETLFEILL-NFEDMFPXXXXXXXXXXXGTTLL 531
           +K Y+D  + R   GES L++CI+ K N +  E LL NFE   P           G+TLL
Sbjct: 456 LKSYRDILRIRTAGGESCLSVCIQ-KGNFSGIECLLQNFEHELPLEDILDDQTINGSTLL 514

Query: 532 MKALKVENEVGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVLKRIGLFF 591
           M+ L+  N   A +++++L  SC+ +EL +Y NR +  +R AAHY+T  + +  +IG+FF
Sbjct: 515 MQTLETGNTRMADVLLEILCQSCTINELREYLNRRNRWKRTAAHYLTQDLQMADKIGIFF 574

Query: 592 NWKIKDDKGYTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHNDSKENTL 651
           +W+ KD  G+TPL  I R+YD   Y QM+  AF  A KWYE R +  NF  H D+K NTL
Sbjct: 575 DWEAKDISGHTPLFAIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTL 634

Query: 652 LHILKCDIQVLLKYDNININAHNLKYITPLMTYVKYNRVSNIQEIIRDERLILGKYQKHT 711
           LH++K +I++LL+ +NI++N  N K +TPLM YVKYNR+ N++ I+RD RLI+ K+QK  
Sbjct: 635 LHVMKTNIEILLEQENIDVNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSL 694

Query: 712 FLDCYDFVKNTIIFEDLGVRSVRNSMFNLFSAYSLRVENSNWVLYFTFKDTNQDS-YITK 770
           FL+C+D+VKN +I  +LG  +   + F    A++ R EN+ W L+ T K  ++++ + T 
Sbjct: 695 FLNCFDYVKNPVIQAELGFHAAEKTKFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTV 754

Query: 771 SVSLKILFNIIKKYNKLYPLHFIPHKEVLLRLTGIVKNNPNNGIQKLKNRAFLNLISNYF 830
             +++ +  +++ Y +  P+ F+P   VL  L  I K    + + KL+   FL  ++   
Sbjct: 755 KHNIRAIQGLLQVYLRRNPMSFLPIDAVLEDLHEIGKTGLVS-VGKLEVHRFLCELTLVL 813

Query: 831 GTLIETDDFDTELFKNPESLTKWIKAGKRK 860
             + + ++F   L+     L  WI+   RK
Sbjct: 814 KLICQKEEFKKALYLPASDLVNWIRESGRK 843

>Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to
            Ashbya gossypii ACR006C
          Length = 1079

 Score =  498 bits (1283), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 332/1097 (30%), Positives = 565/1097 (51%), Gaps = 73/1097 (6%)

Query: 4    LSYHMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLT 63
            + YH+PVLLNPL+NAVFNCP P  SPL+KLF  +K + F+L+VP  ++LL Y+D + GL 
Sbjct: 1    MPYHLPVLLNPLVNAVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLP 60

Query: 64   LKELCYEFEFVASHIILDTDNSSNNLQ-VKGKNSNETLDNRYKSXXXXXXXXXXXXXXPL 122
            L ELCY ++FVASHI++    S    Q  +  N N  +                      
Sbjct: 61   LSELCYNYDFVASHILIQLQESKVTEQEYRTLNGNSVIIRSQAGIVM------------- 107

Query: 123  DFNNSTQXXXXXXXXXXXLPNFNEYLSGSEKYTIIYTDYPFSNSWLPKIEIESFYISKKE 182
               +  +           L NFN+YLS    + +++ D P   + +   E++ F     E
Sbjct: 108  ---SKPELRKCRVKSYEVLRNFNDYLSNVIYFPLLHIDRPLVGALVRNDELQVF--GSYE 162

Query: 183  SNNIKAAQITNHKSPLSQDLAQKTKSSFRHIINIHKEWNNIFDSYIID----FKNKQLNL 238
             +N   ++  N  S        +    F   I ++ +     D Y        +N+   L
Sbjct: 163  MHNPSKSKTINTIS--------ENHIPFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQL 214

Query: 239  TSLPIYFREIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIW---DHIDRNMID 295
              L   F+++V   Y  +K ++ F ++  +L N+  EY+E + Y  IW     ++ +   
Sbjct: 215  DKLIKIFKDLVIDVYGVIKEDKNFRNYM-ELLNVTQEYVELNMYEDIWLKLVQLNGSKEP 273

Query: 296  NQFLHTEMMDFLSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSHSEK 355
            ++        ++S++ +   LY +    F+L  V +VE+ V  ATD F K+  + SH+EK
Sbjct: 274  DRVSGYSSTKYISLNNVATILYPEGTNSFDLRVVTEVEKRVVKATDCFAKLSLTNSHNEK 333

Query: 356  CQILIDALQKLTSYDDVHYEPLMVDADTLMNLFLLVICRSKVPFLRNHLYYLQNFSTDEN 415
             +I++   Q LT+  +       +DADTL+ L L+V+CRS+V  L++HL YL+ F+   +
Sbjct: 334  AKIVVSTFQILTTKMEYTSIDPTIDADTLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPD 393

Query: 416  NVKFGLLGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNKELISKISSEADHSTFQVKL 475
            +VKFGL GY +ST EA L Y +     EK  K +     N+     I S    S   +  
Sbjct: 394  DVKFGLTGYSLSTIEAVLAYFEAGDGTEKLKKLISLSEANRVFWDLIRSGVAVS---LSS 450

Query: 476  YKDCFKFRNEMGESILALCIKHKKNETLFEILLNFEDMFPXXXXXXXXXXXGTTLLMKAL 535
            YK+    R+   ES L++CI   + + + EILLN+++               +TLL++AL
Sbjct: 451  YKNSLISRSSNCESSLSICIHAGRLDLIKEILLNYQEQIKLEDLLFDVNQANSTLLIQAL 510

Query: 536  KVENEVGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVLKRIGLFFNWKI 595
            +  ++  A+L++DV+ S+C+ +E  +Y NR+++  R  AHY+     ++++IGL+ +W+ 
Sbjct: 511  ETGHDEIAELLIDVMISNCTNNEFYEYVNRSNSAGRTVAHYLPQAFSIIEKIGLYLDWRK 570

Query: 596  KDDKGYTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHNDSKENTLLHIL 655
            KD   +TPL  ICR YDQ  Y +M+  +F    ++   R +  +F DH D   N+LLHI+
Sbjct: 571  KDVNMHTPLFIICRAYDQLHYSEMLSRSFEYVFEYCRRRGEDFSFTDHEDPMGNSLLHIM 630

Query: 656  KCDIQVLLKYDNININAHNLKYITPLMTYVKYNRVSNIQEIIRDERLILGKYQKHTFLDC 715
            K  IQ +L   NIN+N  N+K +TPLM Y KYNR+ NI++I+ D+RLI+ K Q    L  
Sbjct: 631  KGGIQSILSQPNINVNKSNIKGMTPLMLYAKYNRIENIRDILEDKRLIVSKIQNPQTLKA 690

Query: 716  YDFVKNTIIFEDLGVRSVRNSMFNLFSAYSLRVENSNWVLYFTFKDTNQDSYITKSVSLK 775
             D+VKN +I   +G    +NS++ L SA  ++ E++ W L+ T K ++ +SY T   S+K
Sbjct: 691  IDYVKNPMILNLIGTHIAKNSLYGLLSADGIKFEDNCWYLWITVKFSD-NSYSTLRQSVK 749

Query: 776  ILFNIIKKYNKLYPLHFIPHKEVLLRLTGIVKNNPNNGIQK---LKNRAFLNLISNYFGT 832
             +  +++ YNK +P++F+P   +L     I+KN    GI     L+N  FL L++     
Sbjct: 750  NIQGLLQFYNKKHPMNFLPIDHIL----SILKNIGKPGILPVINLENSIFLGLLTQLLSV 805

Query: 833  LIETDDFDTELFKNPESLTKWIKAGKRKHKKENYYKRMTLDDINMIKSFVQFNINELGKL 892
            + + +++   L  N   L+ W++    K  + N  +R+  ++++ I+SF++FN++E  ++
Sbjct: 806  IGQRNEYMAVLRYNESDLSTWLRTNNFK-PRANKDERIEPEEVSSIQSFLKFNLSEFSEI 864

Query: 893  NRTLAILKKLCTFLALKINDVNESYKLFRNFGALLQQKDISNQMKKIDGLIKPKYFQSIF 952
                 IL+KL  F +LK  D+               Q+ I  QM+ +   + P   +  F
Sbjct: 865  KEKFTILRKLVVFQSLKAQDIE------------CAQRIIYQQMEIVSNSVGPS-VEKTF 911

Query: 953  L-----ILLDQ----ISFLEICTIHMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDF- 1002
            +       LD     I F+ +C   +S     ++ + +  W  ++  LS+L+++Y+R+F 
Sbjct: 912  IGSNENYSLDSFQQAIEFIAMCLETLSSKIQYVLDSKVTLWWRLYGELSSLRREYQRNFP 971

Query: 1003 SDFDSRNGLNE---NILSRYTKNKREAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEE 1059
            SDF S +   E        Y + KR+  E ++   +    T    ++  +   HENLAEE
Sbjct: 972  SDFKSSDVSGEESKGFFESYIEGKRQKTEDKLQARLRVCITKLQTLSGELKKDHENLAEE 1031

Query: 1060 FNKFLTFKSRFFKDVIL 1076
             + F+TFK+  ++  ++
Sbjct: 1032 ISFFVTFKNFAYESFVM 1048

>CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa] {ON}
            some similarities with uniprot|Q04257 Saccharomyces
            cerevisiae YML002w and some similarities with
            uniprot|Q04257 Saccharomyces cerevisiae YML003w
          Length = 1130

 Score =  496 bits (1276), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 350/1090 (32%), Positives = 585/1090 (53%), Gaps = 51/1090 (4%)

Query: 18   AVFNCPDPINSPLRKLFERIKYKN-FMLIVPPNEILLHYRDPEKGLTLKELCYEFEFVAS 76
            A+ NC +P +SPL+KL+ ++  K+ ++++VPP E+LL+Y D E    L +LCY   F ++
Sbjct: 19   AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCYTPNFASA 78

Query: 77   HIIL----DTDNSSNNLQVKGKNSNETLDNRY-KSXXXXXXXXXXXXXXPLDFN--NSTQ 129
            HI+L    DT+ ++ +  V  KN  +  D  + K+                +FN      
Sbjct: 79   HILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFNKLGDQI 138

Query: 130  XXXXXXXXXXXLPNFNEYLSGSE-KYTIIYTDYPFSNSWLP---KIEIESFYI-SKKESN 184
                       +P FN Y+  ++   TI+Y D  F N  L    + +I+     S +   
Sbjct: 139  KNRAKILDIESIPIFNNYMKTTDNTITIMYIDDVFLNGTLECNLRSDIDLLRSPSMRSIP 198

Query: 185  NIKAAQITNHKSPLSQDLAQKTKSSFRHIINIHKEWNNIFDSYIIDFKNKQLNLTSLPI- 243
              K   + N KS   ++   K+K++F  I+ ++K W++ F+ +   F+    N   LPI 
Sbjct: 199  TAKRPSLINKKSTDYEN--SKSKATFDSILRVNKHWSSKFEQHFQKFR-LLANQDDLPID 255

Query: 244  YFREIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHIDRNMIDNQFLHTEM 303
             F  I+++ +++M  + +F +   DL N+I+EY+E + ++ IW  I R    N+ +  ++
Sbjct: 256  VFHNIIEEMHEEMVSDNLFKNIV-DLRNIIYEYVELNLFDDIWKMILRM---NKEVEIDL 311

Query: 304  MDF--LSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSHSEKCQILID 361
              F  +SI Q++ E  +  + KF L NVI  ER +K+A+   +KI  + ++  K  ILI 
Sbjct: 312  NPFGNISIYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESASNYKSKANILIL 371

Query: 362  ALQKLTSY----------DD--VHYEPLMVDADTLMNLFLLVICRSKVPFLRNHLYYLQN 409
             L+ LT            DD  + + PL +DAD LMNLF+LV CR+++  L+ HL YLQN
Sbjct: 372  TLRTLTGNKENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIKNLKCHLSYLQN 431

Query: 410  FSTDENNVKFGLLGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNKELISKISS----E 465
            F  ++++ KFG+LGY +ST EA +CY +  +  E + K +  C  N+ L+  +SS    E
Sbjct: 432  FYNNDSDTKFGILGYALSTLEAVVCYFEQLKEKENYRKLIDFCNSNERLVKVLSSTKKYE 491

Query: 466  ADHSTFQVKLYKDCFKFRNEMGESILALCIKHKKNETLFEILLNFEDMFPXXXXXXXXXX 525
             + + + ++ Y+   ++R+ +G+S+LALCI H +N+ L+ IL  +E +FP          
Sbjct: 492  TNAALYFLRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLFPIEDLLADESI 551

Query: 526  XGTTLLMKALKVENEVGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVLK 585
             G+TLL++A+K +N+  A L++++L+ +C+E ELI Y NR D N+R A H++TN+++VLK
Sbjct: 552  DGSTLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFLTNELEVLK 611

Query: 586  RIGLFFNWKIKDDKGYTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHND 645
             +G + NW  KD+ G TPL TI R+YDQ+ Y++M+  +   A  WY    +  N+ DH D
Sbjct: 612  LMGKYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLNGKNFNYLDHVD 671

Query: 646  SKENTLLHILKCDIQVLLKYDNININAHNLKYITPLMTYVKYNRVSNIQEIIRDERLILG 705
             K NTLLHILKC++ +LL   +IN+NA N    TPLMT ++Y R  NI++++ D RL + 
Sbjct: 672  KKGNTLLHILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIRDLLCDPRLRVD 731

Query: 706  KYQKHTFLDCYDFVKNTIIFEDLGVRSVRNSMFNLFSAYSLRVENSNWVLYFTFKDTNQD 765
              QK+  L  +DF K+  I   LG   + NS +    A++L+  NS W L  T K   +D
Sbjct: 732  ITQKNNALTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTLKYTNSRWNLSLTVK--LKD 789

Query: 766  SYITKSVSLKILFNIIKKYNKLYPLHFIPHKEVLLRLTGIVKNNPNNGIQKLKNRAFLNL 825
            +  T + +LK L  I++   K     F+P +E++  L    +   +  + ++K    L  
Sbjct: 790  APKTTNFTLKTLRGILRVVIKNNMTVFLPVQELVEDLISFNRIRFSE-LMRIKVLEMLPF 848

Query: 826  ISNYFGTLIETDDFDTELFKNPESLTKWIKAGKRKHKKENYYKRMTLDDINMIKSFVQFN 885
            IS     L+     D  +F+  E+  KW+K      KK N    +T +DI+MI++F++FN
Sbjct: 849  ISFCLSALVHIKVLDLNVFQTEENAIKWVKMNGSVDKKTNQTSDITPEDISMIQNFLKFN 908

Query: 886  INELGKLNRTLAILKKLCTFLALKINDVNESYKLFRNFGALLQQKDISNQMK---KIDGL 942
            I E+ +    L I +KL  F  LK  D+  S + +    + L  K   + +K   +   L
Sbjct: 909  ITEIERTKNKLEIAEKLSLFSRLKSKDLLNSNENYVTIVSQLSSKRFRSTLKYSAEDTKL 968

Query: 943  IKPKYFQSIFLILLDQISFLEICTIHMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDF 1002
            +  +  ++    LL +I++L+IC   + ++   +    I  W  ++  L N  K Y R F
Sbjct: 969  LSVRAEKA----LLSKITYLKICAQKLHNHILSITTTMISNWWHIYGELLNAHKHYTRAF 1024

Query: 1003 SDFDSRNGLNENI-LSRYTKN-KREAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEEF 1060
             +  +    N ++ L R   N KR   E+R+SE+I + T   + V   I   HE  AEE 
Sbjct: 1025 PELANVTTENRDLALHRMISNPKRIKLEERLSEKIKDITEQLNSVGHDIKQMHELAAEEV 1084

Query: 1061 NKFLTFKSRF 1070
            ++F+  K++F
Sbjct: 1085 SRFIDLKTKF 1094

>ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YML002W and
            YML003W; YML002W and YML003W represent one ORF in this
            genome
          Length = 1071

 Score =  489 bits (1258), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 320/1117 (28%), Positives = 556/1117 (49%), Gaps = 76/1117 (6%)

Query: 4    LSYHMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLT 63
            + YH+PVLLNPL+NAVFNCP P  SPL+KLF   K K F+L+VP  E+LL Y+D    + 
Sbjct: 1    MPYHLPVLLNPLVNAVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVP 60

Query: 64   LKELCYEFEFVASHIILDTDNSS-NNLQVKGKNSNETLDNRYKSXXXXXXXXXXXXXXPL 122
            L ELCY +EFVASH ++    +    L+ +  N    +                      
Sbjct: 61   LTELCYNYEFVASHTLVQLQEARVTELEFQTINGKSVVIRPQSGIITAQPSAKKCRIQRC 120

Query: 123  DFNNSTQXXXXXXXXXXXLPNFNEYLSGSEKYTIIYTDYPFSNSWLPKIEIESFYISKKE 182
            +                 L +FN+YL G   + ++Y D P          +  F   ++ 
Sbjct: 121  EL----------------LRSFNDYLLGRTAFALLYIDRPLVGEIELITPLRVFGPQEQP 164

Query: 183  SNNIKAAQITNHKSPLSQDLAQKTKSSFRHIINIHKEWNNIFDSYIIDFKNK----QLNL 238
                +  Q  +   PL Q             + +H +  N  D    D K +     L+L
Sbjct: 165  LQYQRITQTADAPLPLEQ------------FLRLHPQLGNQLDEVFKDAKERMRYIALSL 212

Query: 239  TSLPIYFREIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHI----DRNMI 294
              L   F E+V+K Y  +K ++ F ++ N L  ++  Y+E + Y  +W  +     +N  
Sbjct: 213  KELVRLFHELVEKVYCLIKLDKNFRNYLN-LLEMVQGYVELNMYEDVWRKLVQLNGKNEP 271

Query: 295  DNQFLHTEMMDFLSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSHSE 354
            D +     +   +S++QL   +Y +   KFNL  V ++E+ V  AT+ F K+  + SH E
Sbjct: 272  D-RVPGYYITRSISLNQLSTSIYPEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHE 330

Query: 355  KCQILIDALQKLTSYDDVHYEPLMVDADTLMNLFLLVICRSKVPFLRNHLYYLQNFSTDE 414
            K +ILI   QKLT+         M+DADTL+ L ++V+CR++V  L++HL YL+ F+ + 
Sbjct: 331  KARILISTFQKLTTKTSQATLDPMIDADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQNS 390

Query: 415  NNVKFGLLGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNKELISKISSEADHSTFQVK 474
            ++VKFGLLGY +ST EA + Y     +  K  + +  C RNK   + I          +K
Sbjct: 391  DDVKFGLLGYSLSTLEAVVGYFDIGGSSIKLERLITQCQRNKIFWNLIEQGI---PINLK 447

Query: 475  LYKDCFKFRNEMGESILALCIKHKKNETLFEILLNFEDMFPXXXXXXXXXXXGTTLLMKA 534
             +++    R    ES+L+LCI++ + +  ++I+ N++  F              +LL++A
Sbjct: 448  EHEEVLISRTPSCESVLSLCIQYGRQDVFYDIIANYQSHFTLEDILQDVNQSNCSLLIQA 507

Query: 535  LKVENEVGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVLKRIGLFFNWK 594
            L+  N+   + ++D+L ++C+  E+  Y N+ D   R   HY+    +++ R+G F +WK
Sbjct: 508  LQAGNKDITEAVIDLLIANCTNTEMYAYINKCDIAGRTVGHYLPQNYEIVDRLGKFVDWK 567

Query: 595  IKDDKGYTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHNDSKENTLLHI 654
             KD   +TPL T+CR YD   Y +++   F     +Y  R ++ +F DH D   NTLLHI
Sbjct: 568  RKDLNMHTPLFTVCRAYDHPSYLELLSKCFQHCFDFYSTRGKRFSFADHEDPLGNTLLHI 627

Query: 655  LKCDIQVLLKYDNININAHNLKYITPLMTYVKYNRVSNIQEIIRDERLILGKYQKHTFLD 714
            +K  IQ+ L     N+N  N + +TPLM Y KYNR+ NI+EI+ D+RLIL K Q    L 
Sbjct: 628  IKDGIQLALSTPGANVNKCNTRGMTPLMVYAKYNRIENIREILNDKRLILSKLQDPQSLK 687

Query: 715  CYDFVKNTIIFEDLGVRSVRNSMFNLFSAYSLRVENSNWVLYFTFKDTNQDSYITKSVSL 774
              D+VKN II   +G    +NS++   S ++++ E + W L+ T    + +SY T S +L
Sbjct: 688  AIDYVKNPIILNLIGTAMAKNSLYGCLSVHNIKYEENAWYLWIT-SSLSPESYKTSSYAL 746

Query: 775  KILFNIIKKYNKLYPLHFIP---HKEVLLRL--TGIVKNNPNNGIQKLKNRAFLNLISNY 829
            K + ++++ YNK +P+ F+P   H E L  L  +GI+       +  L+N   L  ++  
Sbjct: 747  KDIQSLLQIYNKKHPMSFLPIDHHLETLKTLGKSGII------SVINLENSMLLEALTFS 800

Query: 830  FGTLIETDDFDTELFKNPESLTKWIKAGKRKHKKENYYKRMTLDDINMIKSFVQFNINEL 889
               + + +D+          L+ W++A   K +K N   ++  ++I+ I++F++F++ E 
Sbjct: 801  LSIIQQREDYKNVFSYTESELSTWLRASMVK-QKPNKRDKIEPEEIHSIQNFLKFSLTEF 859

Query: 890  GKLNRTLAILKKLCTFLALKINDVNESYKLFRNFGALLQQKDISNQMKKI-------DGL 942
              L     +LKKL  F   K +D+  S ++  + G ++     S +++         DG 
Sbjct: 860  NYLREKFTVLKKLIIFEHYKSHDIECSQRILYSQGEIIASVVPSKRLRTSPFDNEFNDG- 918

Query: 943  IKPKYFQSIFLILLDQISFLEICTIHMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDF 1002
            I P  F+         + F+ +C   ++    +++ + +  W +++  ++NL+K+Y+R+F
Sbjct: 919  IDP--FE-------QAVDFMCMCLDSLTSKIVEVLDSKVSTWWTLYGEITNLQKEYQRNF 969

Query: 1003 SDFDSRNGL----NENILSRYTKNKREAAEKRISEEIIENTTLFDKVTAHIWYAHENLAE 1058
             +    N      ++     Y ++KR+  E ++   +   +     + A + + HE LAE
Sbjct: 970  PEKGKPNSASSEDSKGFFVSYMEDKRQKLESKLQSRLSVCSENLQHLDAELKHCHELLAE 1029

Query: 1059 EFNKFLTFKSRFFKDVILNMIIPSAIATLKDQVLNIE 1095
            E + F++ K+  + + ++   +   I   K+ +L IE
Sbjct: 1030 EISFFISSKNFAYMNFMVKAYVNRRIKQHKNMLLAIE 1066

>Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML002W -
            Hypothetical ORF [contig 185] FULL
          Length = 1089

 Score =  476 bits (1225), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 321/1088 (29%), Positives = 544/1088 (50%), Gaps = 50/1088 (4%)

Query: 4    LSYHMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLT 63
            + Y++PVLLNPLINAVFNCP P+NS L+K+F  I+   F+LI PP E+LL Y D E GL 
Sbjct: 1    MPYYLPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLP 60

Query: 64   LKELCYEFEFVASHIILDTDNSSNNLQVKGKNSNETLDNRYKSXXXXXXXXXXXXXXPLD 123
            L++LCY   FV+ HI+L          + G+   +  +  YK+                 
Sbjct: 61   LQDLCYATGFVSDHIVL----------LDGREGLQ--EEEYKTLSGKTILLRSQQGIIFT 108

Query: 124  FNNSTQXXXXXXXXXXXLPNFNEYLSGSEKYTIIYTDYPFSNSWLPKIEIESFYISKKE- 182
                             L NFNEYL G   + II+ D+P +     + E + F ++K + 
Sbjct: 109  AAAFDTRRRCRIQRAELLTNFNEYLKGDTTFPIIHVDFPLTGRLARRDEWQCFRVTKNQE 168

Query: 183  -SNNIKAAQITNHKSPLSQDLAQKTKSSFRHIINIHKEW----NNIFDSYIIDFKNKQLN 237
             +N  K +   +H              S   ++ I+ E+    N+I  +  I   +    
Sbjct: 169  HTNGPKNSGKLSHGD---------NNISLEQLLRINPEYGESLNDIVKAQRISLNSSVTG 219

Query: 238  LTSLPIYFREIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHIDRNMIDNQ 297
             T L  +F +   KA   ++    F    N L   + EY+E + Y+  W  +  ++ D++
Sbjct: 220  TTHLASHFVQTCKKALDVVRAYPAFQVLPN-LPICVHEYIELNLYDDYWAQLTNSLRDSE 278

Query: 298  FLHTE---MMDFLSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSHSE 354
               +    ++  +S+ Q+   LY  N +KF+L  + + E+ VK A + F+KI  +  HS 
Sbjct: 279  IESSSDYSLLKHISVSQVPSFLYPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSA 338

Query: 355  KCQILIDALQKLTSYDDVHYEPLMVDADTLMNLFLLVICRSKVPFLRNHLYYLQNFSTDE 414
            K +++I+ LQ L+    V    + +DADTL++LF++V+C ++V  LR+HL+YLQ F+ D 
Sbjct: 339  KAKVIIETLQTLSRSLLVDDRAVTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDT 398

Query: 415  NNVKFGLLGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNKELISKISSEA-DHSTFQV 473
            N V FG+L YG+ST EA LCY   F++ EK       C  N      IS  + D +    
Sbjct: 399  NLVTFGILAYGMSTLEAVLCY---FESPEKVASLEKYCRANLSHWKSISEGSIDLNADTT 455

Query: 474  KLYKDCFKFRNEMGESILALCIKHKKNETLFEILLNF-EDMFPXXXXXXXXXXXGTTLLM 532
                D  K R   G+S LA+C++H++ E  FE++ N  E  FP           G+ LL+
Sbjct: 456  VPLDDLLKIRTSDGQSCLAVCLQHRRTEE-FELIKNTREAWFPLEDLLHDETTDGSNLLI 514

Query: 533  KALKVENEVGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVLKRIGLFFN 592
              L+   +  A ++++ L S+C++DELI + N T+  QR   HY+ +   ++  +G   N
Sbjct: 515  HMLESGCDRLAVMLINTLISNCTKDELIAFLNHTNKYQRSCGHYLMHAPQLIDLVGDILN 574

Query: 593  WKIKDDKGYTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHNDSKENTLL 652
            W+ +D  G+TPL  I R YD+  Y  M+  A+  A    + RN +    +H D K NTLL
Sbjct: 575  WEQRDCNGHTPLFAIVRAYDRPDYFDMVSAAYRAAVGQSKVRNSRFRVSNHTDDKGNTLL 634

Query: 653  HILKCDIQVLLKYDNININAHNLKYITPLMTYVKYNRVSNIQEIIRDERLILGKYQKHTF 712
            H++K D+ +LL    I++NA N K +TPLM YV+YNR+ N++ I++D+RLI+GK+Q   +
Sbjct: 635  HVIKSDVSILLADPFIDVNATNAKGLTPLMVYVRYNRIGNVRTILQDQRLIIGKHQSGAY 694

Query: 713  LDCYDFVKNTIIFEDLGVRSVRNSMFNLFSAYSLRVENSNWVLYFTFKDTNQDSYITKSV 772
            L C+D+VKN  + ++LG  +         + +S++ E   WVL+ T   T  +  +   V
Sbjct: 695  LSCFDYVKNPAVLKELGKYASYLPFEFSINVHSVKREGDEWVLWITV--TGGEKQVPVKV 752

Query: 773  ---SLKILFNIIKKYNKLYPLHFIPHKEVLLRLTGIVKNNPNNGIQKLKNRAFLNLISNY 829
               SL+ +   +  ++  +P+ F+P  E+L  L  + ++     + K+  + FL   S  
Sbjct: 753  FKRSLRFIQAFLTLFSDAHPMTFVPVDELLRELRALSQSRILI-LNKMDTKRFLKRCSVT 811

Query: 830  FGTLIETDDFDTELFKNPESLTKWIKAGKRKHKKENYYKRMTLDDINMIKSFVQFNINEL 889
              +++  +    + F +        +            K M  +++  I+S ++FN++E+
Sbjct: 812  L-SMVSQERLFADAFTDSNLNLSSSRGLGSSESFTQNMKMMEPEEVRSIQSILKFNLSEI 870

Query: 890  GKLNRTLAILKKLCTFLALKINDVNESYKLFRNFGALLQQKDISNQMKKIDGLIKPKYFQ 949
              L   + ++KKL  F  LK  D++E+   F      + Q  I +       +  P  F 
Sbjct: 871  SALKTAMLLMKKLAVFEGLKGKDLSEACMTFGAKCKYVTQGKIQS-FDHFLNVQAPNLFD 929

Query: 950  SIFLILLDQISFLEICTIHMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDFSDFDSRN 1009
              F  + + I+  E+C+  +  +   ++ +DIP+W   +  L +L+++YK+ F D + R 
Sbjct: 930  --FEGIANNIALCELCSSLLCKHIGQVLNDDIPKWWHTYGELLSLRREYKKSFPDAN-RP 986

Query: 1010 GLNEN--ILSRYTKNKREAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEEFNKFLTFK 1067
             ++EN  +   Y + KR   E+  +  I   +    +++  I   +E LA E N F+ FK
Sbjct: 987  HVSENSGLFGSYIETKRTKLEQSYAARINHTSVRLSEISTKINQDNERLAVELNNFINFK 1046

Query: 1068 SRFFKDVI 1075
            + F K  I
Sbjct: 1047 NEFLKSAI 1054

>KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] {ON}
            similar to uniprot|Q04263 Saccharomyces cerevisiae
            YML002W Hypothetical ORF
          Length = 1097

 Score =  471 bits (1212), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 314/1112 (28%), Positives = 568/1112 (51%), Gaps = 57/1112 (5%)

Query: 4    LSYHMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLT 63
            + Y++PVLLNPLINAVFNCP P NSPLRK+F RI+ + F L+ P  EILL Y D E G +
Sbjct: 1    MPYYLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSS 60

Query: 64   LKELCYEFEFVASHIILDTDNSSNNLQ----VKGKNSNETLDNRYKSXXXXXXXXXXXXX 119
            L++LCY   FV+ HI+L      ++ +    + GK    TL N+ K+             
Sbjct: 61   LQDLCYSASFVSDHILLLGGGGCSHEEEYKTLSGKTI--TLRNQQKALFTGEGFDARRRC 118

Query: 120  XPLDFNNSTQXXXXXXXXXXXLPNFNEYLSGSEKYTIIYTDYPFSNSWLPKIEIESFYIS 179
              L+                 L NFNEY  GS  Y II+ D+P +     + E   F   
Sbjct: 119  QVLE--------------TELLSNFNEYFQGSSTYPIIHVDFPLTGRLARRDEWPGFKAY 164

Query: 180  KKESNNIKAAQITNHKSPLSQDLAQKT--KSSFRHIINIHKEWNNIFDSYI----IDFKN 233
            +  S +  +A         +  LA  T  K+S   ++  H  + +   + I        +
Sbjct: 165  RFASTDTTSA---------NSSLAASTEPKASLEQMLRAHPSYGDKLSAIIRTQRAALSS 215

Query: 234  KQLNLTSLPIYFREIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHIDRNM 293
               N  +L  +F +  +KA   ++ ++ F +F N L   I EY+E + Y+  W  +  ++
Sbjct: 216  STYNADNLAAHFMQTCEKALAAIQEDQSFRAFPN-LRLQIHEYVEMNLYDDFWAQLTNSL 274

Query: 294  IDNQFLHTEMMDFL---SIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSK 350
             D++  +      L   SI Q+   LY  + QKF++  V +VE+ +++A +  +++  + 
Sbjct: 275  KDSEIENQSDFSILRNISISQVPSFLYPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTN 334

Query: 351  SHSEKCQILIDALQKLTSYDDVHYEPLMVDADTLMNLFLLVICRSKVPFLRNHLYYLQNF 410
            SHS K +++++ LQ ++   +++ + + VDADTL++L ++V+C+++V  L++HL+YLQ F
Sbjct: 335  SHSSKAKVIVETLQTVSRSLEINDKVISVDADTLVSLLVVVVCQAEVKDLKSHLFYLQEF 394

Query: 411  STDENNVKFGLLGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNKELISKIS-SEADHS 469
            + D N++ FG+L YG+ST EA L Y   F++ EK      +C  N      ++  +    
Sbjct: 395  AKDSNSITFGILAYGMSTLEAVLSY---FESREKLKLLEKHCSSNASYWEALADGKLPLG 451

Query: 470  TFQVKLYKDCFKFRNEMGESILALCIKHKKNETLFEILLNFEDMFPXXXXXXXXXXXGTT 529
            +      KD  + R   G S L++C+++++      +   FE  FP           G+ 
Sbjct: 452  SLNPSEVKDILRTRTPAGLSCLSICLQNRQPNLFLHLATKFEHCFPLEDLLNDETVEGSN 511

Query: 530  LLMKALKVENEVGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVLKRIGL 589
            LL++ L       +   +++L  SC++ EL  + N  +  QR + HY+ + +D++ ++G 
Sbjct: 512  LLIQMLDNGCSSLSGNFIEMLFRSCTKTELESFLNHVNRYQRSSGHYLMHALDLIVKVGK 571

Query: 590  FFNWKIKDDKGYTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHNDSKEN 649
            F NW+ +D  G+TPL  I RTYD   Y+ M+  A+  A+ W   + ++     H D+K N
Sbjct: 572  FINWEQRDCNGHTPLFAIIRTYDHTDYDAMVLEAYKSARLWCTLKGKQFRLSKHQDNKGN 631

Query: 650  TLLHILKCDIQVLLKYDNININAHNLKYITPLMTYVKYNRVSNIQEIIRDERLILGKYQK 709
            TLLH++K ++ V+L    +N+N+ N K +TP+M Y +YNR+ NI+ I+RD+RLI+ K Q 
Sbjct: 632  TLLHVIKSNVSVVLDDPLVNVNSFNKKGLTPIMVYARYNRLDNIKSILRDKRLIIQKCQN 691

Query: 710  HTFLDCYDFVKNTIIFEDLGVRSVRNSMFNLFSAYSLRVENSNWVLYFTFKDT--NQDSY 767
             ++L C+D++KN ++  +LG  +          A++++ E   WVL+ T   +  N  + 
Sbjct: 692  GSYLTCFDYIKNPVVLGELGKHAFFLPQSYQIRAHNIKFEGDEWVLWMTLVGSVPNAPAK 751

Query: 768  ITKSVSLKILFNIIKKYNKLYPLHFIPHKEVLLRLTGIVKNNPNNGIQKLKNRAFLNLIS 827
            + +  SLK + + +  ++K   + FIP + +   L+ + K    + I +L+ + FL   S
Sbjct: 752  VIQR-SLKFIQSFLISFSKTNSMTFIPAESLAEELSLLAKMKIIS-INRLETKHFLRRAS 809

Query: 828  NYFGTLIETDDFDTELFKNPESLTKWIKAGKRKHKKE--NYYKRMTLDDINMIKSFVQFN 885
                 +   ++F+  +F NP      + A +   ++E  + Y  +  +++  I+  ++FN
Sbjct: 810  VVLSLICRQEEFE-HIFNNPSG--SLVNAAEHVQEQEANSTYGMIEPEEVASIQKIMKFN 866

Query: 886  INELGKLNRTLAILKKLCTFLALKINDVNESYKLFRNFGALLQQKDISNQMKKIDGLIKP 945
              E+  +     +LKKL  F  LK  D+  S+ +F++ G    +  I  +   + G +K 
Sbjct: 867  RTEILAIKSGALMLKKLAIFGILKGKDLERSHTMFQSHGNNFTK--IIGRSTNVFGSLKH 924

Query: 946  KYFQSIFLILLDQISFLEICTIHMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDFSDF 1005
               Q  F  L +  + LE+ +  +    + ++ +DIP W   +  L +L+ +Y ++F D 
Sbjct: 925  SLPQCEFGYLANNTALLELSSRLLVQKIDKILNHDIPHWWKTYGELVSLRHEYNKNFPD- 983

Query: 1006 DSRNGLNENI--LSRYTKNKREAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEEFNKF 1063
            D R  + EN   +S Y + KR   E+ +   I  ++    + +  +  ++E+LA E N F
Sbjct: 984  DVRPRVAENTGFISSYIETKRVRLEQGLVGRINRSSKNLLRFSLMLRRSNESLAVELNNF 1043

Query: 1064 LTFKSRFFKDVILNMIIPSAIATLKDQVLNIE 1095
            + FK+ F+    +       I  L++Q++ +E
Sbjct: 1044 INFKAEFWVSATIKEHAAMNIKWLQEQLVCLE 1075

>YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative
            protein of unknown function; expression induced by heat
            and by calcium shortage
          Length = 737

 Score =  433 bits (1113), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 252/728 (34%), Positives = 410/728 (56%), Gaps = 18/728 (2%)

Query: 377  LMVDADTLMNLFLLVICRSKVPFLRNHLYYLQNFSTDENNVKFGLLGYGISTFEATLCYL 436
            + +DADTL++LF+LV+CRS+   L++HLYYLQNFS + ++ KFG+LGY +ST EA +CY 
Sbjct: 15   MTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGILGYAVSTLEAVVCYF 74

Query: 437  KDFQ--AGEKFNKQVLNCIRNKELISKISSEADHSTFQ-VKLYKDCFKFRNEMGESILAL 493
            +DF    G       L C + K L+ K+S E   +  + +  YKD   +RNE G+SIL++
Sbjct: 75   EDFNKNTGNVAKANTL-CEKTKNLLDKLSCENPTNEVEDLATYKDILTYRNEQGQSILSI 133

Query: 494  CIKHKKNETLFEILLNFEDMFPXXXXXXXXXXXGTTLLMKALKVENEVGAKLIVDVLQSS 553
            CI + KN  L +IL  +E+ FP           G+TLL++++K  N   AK+++ ++  +
Sbjct: 134  CITNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNLEAAKVLIKIMLFN 193

Query: 554  CSEDELIKYFNRTDNNQRIAAHYITNQIDVLKRIGLFFNWKIKDDKGYTPLTTICRTYDQ 613
            C+E+EL+ Y N+TD   R  AHY+T+++D+LK IG + +WK K+  G TPL +I R+YDQ
Sbjct: 194  CTEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSGQTPLFSIFRSYDQ 253

Query: 614  ECYEQMIETAFFEAQKWYENRNQKLNFKDHNDSKENTLLHILKCDIQVLLKYDNININAH 673
              YE+M++TAF  A  WY   N   ++ DH D+K N+LLH+LK +I +LL+   ++IN  
Sbjct: 254  PNYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIPILLQLTKLDINEE 313

Query: 674  NLKYITPLMTYVKYNRVSNIQEIIRDERLILGKYQKHTFLDCYDFVKNTIIFEDLGVRSV 733
            N K +TPLM YVKY R+SNI  I +D RLIL K Q  TF  C+D+ K+  +   +G R V
Sbjct: 314  NYKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAKDHSVLSKIGERGV 373

Query: 734  RNSMFNLFSAYSLRVENSNWVLYFTFKDTNQDSYITKSVSLKILFNIIKKYNKLYPLHFI 793
            ++S+F L   +SLR  N N     T     +  + T  +++K +  +++   K  P  F+
Sbjct: 374  KDSLFGLIYFHSLRYHNLNATTNITSVSNAEKPFATTVINMKTIQGLLRSILKDNPFTFL 433

Query: 794  PHKEVLLRLTGIVKNNPNNGIQKLKNRAFLNLISNYFGTLIETDDFDTELFKNPESLTKW 853
            P    +  ++ + +++    I K    + L+ ++N F  L+        LF +  S+  W
Sbjct: 434  PLNTYIDEISHLNRSDL-TIIGKTDVTSLLHQLTNCFNVLLFLKKIPENLFTDEASILYW 492

Query: 854  IK--AGKRKHK---KENYYKRMTLDDINMIKSFVQFNINELGKLNRTLAILKKLCTFLAL 908
            ++    KR  K   KEN  K M  ++INMI+SF++FN +E+     +L IL+K+  F+ L
Sbjct: 493  MRINTSKRNQKPSGKEN-PKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKVLIFINL 551

Query: 909  KINDVNESYKLFRNFGALLQQKDISNQMKKIDGLIKPKYFQSIFL-ILLDQISFLEICTI 967
            K +D  ++YK     G  L   + S+  K I  +     F  + L  LL+ + FLE CTI
Sbjct: 552  KSDDFEDAYKGLNEMGRKLINSEASSAFKGI--ITNHNMFSELSLAALLENVRFLEQCTI 609

Query: 968  HMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDFSDF----DSRNGLNENILSRYTKNK 1023
             +S     ++   IP W   +     L K Y++ F +      + +  +   L  + + K
Sbjct: 610  QLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVKPKSASDTSSRAPLGGFIETK 669

Query: 1024 REAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEEFNKFLTFKSRFFKDVILNMIIPSA 1083
            RE +E+R++ +I  ++ +  ++ + I+ AHE LAEE + ++ F+        L     + 
Sbjct: 670  REQSEQRLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFRKACLDQRSLVAFATTN 729

Query: 1084 IATLKDQV 1091
            I+ L++ V
Sbjct: 730  ISVLQECV 737

>NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6.20
            YML002W
          Length = 1146

 Score =  433 bits (1113), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 335/1132 (29%), Positives = 584/1132 (51%), Gaps = 83/1132 (7%)

Query: 6    YHMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLTLK 65
            YH+P LLNPL+N++FNCP+P NSPL+KL+  +K K+F+L+VPP E LL+Y D +  + L+
Sbjct: 4    YHLPTLLNPLLNSIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKIQLE 63

Query: 66   ELCYE-FEFVASHIILDTDNSSNNLQVKGKNSNETLDN--RYKSXXXXXXXXXXXXXXPL 122
            +LCY   +F+ +HI+L   +S ++      +    L +  ++ +               +
Sbjct: 64   DLCYHNVDFIGAHILLPPKDSISSSSSTIDDGYTRLASIEQFDTLNGDNILVKWRNNFLV 123

Query: 123  DFNNSTQXXXXXXXXXXXLPNFNEYLSGSEKYTIIYTDYPFSNSWLP-KIEIESFYISKK 181
              + S             LPNFN+YL GS  + +++ D P     +    E+E F     
Sbjct: 124  LLSGSPNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFDTLTL 183

Query: 182  ESNNIKAAQITNHKSPLSQDLAQKTKSSFRHIINIHKEWNNIFDSYIIDFKNKQLNLTSL 241
              N+  ++       PL QD++Q  +S F +IIN +  WN  F  ++ ++K+        
Sbjct: 184  HDNDGDSSP---DARPLIQDMSQHERSQFENIINTNDTWNKRFKDWMNEYKDSTTAEEPN 240

Query: 242  PIYFREIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHIDR-NMIDNQFLH 300
               F++IV  AY ++K  +IF  F + L  LI EYLE + Y+ +W  I     +D++   
Sbjct: 241  ETLFKQIVAVAYNELKSNKIFKGFGH-LRRLIHEYLEINLYDHLWLQITTLCALDDETKG 299

Query: 301  TEMMDFLSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSHSEKCQILI 360
            T + + +SI++++ + Y    + F L  + K+E+ +  +T+   K+    S +EK + LI
Sbjct: 300  TRIKN-ISIEEIDDKFY----EMFPLDFITKLEKNMVRSTNSINKLNGKNSFNEKSENLI 354

Query: 361  DALQKLTSYDDVHYEPL-------------MVDADTLMNLFLLVICRSKVPF--LRNHLY 405
              LQ LT+ D+    P+             ++DADTL+NL +L+ICRS++    L+ +++
Sbjct: 355  ATLQILTNMDN----PIGELNQENEKGANNLIDADTLINLLILIICRSEINIVDLKRNIF 410

Query: 406  YLQNFSTDENNVKFGLLGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNKELISKISSE 465
            YL+ F+ DEN + FG+L Y ISTFE  +   ++    +K            E+I K+   
Sbjct: 411  YLKKFNYDENLINFGILSYTISTFEIVIYSFENIVEYDKLKSY-------SEIIEKLIKV 463

Query: 466  ADHSTFQVKL-YKDCFKFRNEMGESILALCIKHKKNETLFEILLNFEDMFPXXXXXXXXX 524
             D       + ++    FR++ GESIL  CI + + E   ++L+++E++F          
Sbjct: 464  DDLKKVPKTIKWEQFLTFRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNILDDAN 523

Query: 525  XXGTTLLMKALKVENEVGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVL 584
              GTTLLM+AL   N   + +++++L  +CS  ++++Y N+ D   R   HY+ N++++L
Sbjct: 524  VEGTTLLMQALIYRNFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYLINELEIL 583

Query: 585  KRIGLFFNWKIKDDKGYTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHN 644
            K IG + NWK +D  G TPL TI R YDQ  Y+++I T F     WY     K    DH 
Sbjct: 584  KIIGKYVNWKQRDLVGRTPLFTIFRGYDQPNYDEVISTVFDITLNWYAENGLKFQMSDHY 643

Query: 645  DSKENTLLHILKCDIQVLLKYD-----NININAHNLKYITPLMTYVKYNRVSNIQEIIRD 699
            D K+N++LHIL+ +I +L  Y       I+IN  N K  TPLM YVKY+R+SN++ I+ D
Sbjct: 644  DLKDNSILHILRSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLILGD 703

Query: 700  ERLILGKYQKHTFLDCYDFVKNTIIFEDLGVRSVR-NSMFNLFSAYSLRVE---NSNWVL 755
            +RL+  +YQ+  +  C+D+  ++ I  +LG  +++ N++F     +SL+V    N+ + L
Sbjct: 704  DRLLFNRYQRELYTTCFDYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSSTNATFSL 763

Query: 756  YFTFKDTNQDSYITKSVSLKILFNIIKKYNKLYPLHFIPHKEVLLRLTGIVKNNPN---- 811
             F   D   ++  T ++ +K + +++K   K   +  +P   ++  L  +     N    
Sbjct: 764  TFPLPDKENETG-TVNIKVKAIISLLKVIRKKSQISLLPLDRIIKVLVKLTSKENNKIIV 822

Query: 812  NGIQKLKNRAFLNLISNYFGTLIETD---DFDTELFKNPESLTKWI--KAGKRKH---KK 863
              I+ L+N++ L  +++   TL+  D   D+   L  +   L  W+  +  K KH   K 
Sbjct: 823  RKIEMLRNQSLLRRLTDCLDTLLFFDIGIDY-LSLITDETKLLGWVTNENTKLKHNVNKT 881

Query: 864  ENYYKRMTLDDINMIKSFVQFNINELGKLNRTLAILKKLCTFLALKINDVNESYKLFRNF 923
                K +  +DIN+I+SF++FN+ EL  +   +  L+KL  F+ LK  DV ES   F + 
Sbjct: 882  HGEKKSLKPEDINIIQSFLKFNVKELYNVLLNVKTLEKLLNFIHLKSIDVKESRLAFVHL 941

Query: 924  GALLQQKDISNQM-KKIDGLIKPKYFQSIF---LILLDQISFLEICTIHMSDNFNDLIKN 979
               ++   I+    + ++ +I+ +  ++ +    ++ D++ FL+ CT+ ++ N  D+++ 
Sbjct: 942  VKSIKNDQIAQATNRSLEPIIEMQSLENQYYNNTLIRDELDFLKACTLILTGNIEDILRT 1001

Query: 980  DIPEWHSVHFILSNLKKQYKRDFSDFDSRNGL---------------NENILSRYTKNKR 1024
             IP W  ++  L  L K Y + F      N L               N  +     +N+R
Sbjct: 1002 QIPNWWKLYGELLELNKHYNKLFPPNHYNNTLATDNQHSAEVSNDVNNGGVFGGLIENQR 1061

Query: 1025 EAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEEFNKFLTFKSRFFKDVIL 1076
              A K++  +I +     + +   I+  HE LAEE NK++ FK  FFK  I+
Sbjct: 1062 NKAVKKLKTDIDQLKYSLEILGNEIFRKHEMLAEELNKYMEFKGVFFKKAII 1113

>KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some
            similarities with uniprot|Q04257 Saccharomyces cerevisiae
            YML002W and some similarities with uniprot|Q04257
            Saccharomyces cerevisiae YML003W Hypothetical ORF
          Length = 1067

 Score =  429 bits (1102), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 320/1098 (29%), Positives = 541/1098 (49%), Gaps = 66/1098 (6%)

Query: 4    LSYHMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLT 63
            + YH+PVLLNPL+NA+FNCP P  S L+++F R+  + F ++VP  E LL ++D E GL 
Sbjct: 1    MPYHLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLE 60

Query: 64   LKELCYEFEFVASHIILDTDNSSNNLQVKGKNSNE--TLDNRYKSXXXXXXXXXXXXXXP 121
            L ELCY ++FVASHI++  D + +    +   + +  TL+ R  S               
Sbjct: 61   LAELCYHYDFVASHIVVIKDPTKDVPDQRSIYNTDFTTLNGRKLSIRYRNSTI------- 113

Query: 122  LDFNNSTQXXXXXXXXXXXLPNFNEYLSGSEKYTIIYTDYPFSNSWLPKIEIESFYISKK 181
            +  +  T+           LP FN+YL GS    I++   P     +P  E++ F    K
Sbjct: 114  VTGDGFTERRKITIKEINLLPTFNDYLKGSNYTPILHISMPLCGDLVPLDELQVF---SK 170

Query: 182  ESNNIKAAQITNHKSPLSQDLAQKTKSSFRHIINIHKEWNNIFDSYIIDFK------NKQ 235
             + N  + Q    ++PL  D  QK    F   I   +  +++ +   + F        K 
Sbjct: 171  VAGNKYSKQ---EQAPLPFDEEQKKVLYFEQRI---QSISDVAERVALTFHLTKARIKKA 224

Query: 236  LNLTSLPIYFREIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHIDRNMID 295
            +++  +   +    D   Q +  ++  L+   DL  +I++Y+E   +  I   +   + D
Sbjct: 225  ISVIGIRTEWLNTRDSIRQIISLDK-RLNHLEDLDAMIYDYVELKLFTDIQQQLSEIVED 283

Query: 296  NQFLHT---EMMDFLSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSH 352
             +  H    + +  +S++Q+    Y ++ + F+L +V+++E+ V DA +  K I    +H
Sbjct: 284  QELEHRFDFKALRSISLNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTH 343

Query: 353  SEKCQILIDALQKLTSYDDVHYEPLMVDADTLMNLFLLVICRSKVPFLRNHLYYLQNFST 412
            S K ++L   ++ L+         +  DADTL++LF+L+ICRS+V  L   L YL NF  
Sbjct: 344  SGKLEVLSTTMRLLSR----EINGISTDADTLLSLFVLLICRSQVTGLVRTLTYLTNFEI 399

Query: 413  DENNVKFGLLGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNKELISKISSEADHSTFQ 472
             E ++KFGL GY +STFEA L +       +  +     C  NK++ + I     HS  +
Sbjct: 400  SETSIKFGLQGYVLSTFEAALSFFHQ----DTVDSLTKKCASNKKIWASIQK---HSKVE 452

Query: 473  VKLYKDCFKFRNEMGESILALCIKHKKNETLFEILLNFEDMFPXXXXXXXXXXXGTTLLM 532
             +L     + R + GES+L++CI+   NE L  +L NFE  FP            +TLL+
Sbjct: 453  AELLSSNLRIRTDSGESLLSICIQSHNNEVLTTLLANFESEFPLEDILDDRDFALSTLLI 512

Query: 533  KALKVENEVGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVLKRIGLFFN 592
            +AL+V+N   A ++ +++  SC+E E+  Y N  + + RI AHYI   I +L+ +G +FN
Sbjct: 513  QALQVQNSQAAAILSEIILKSCTESEVRSYLNSPNLHNRITAHYIMQDISLLESVGRYFN 572

Query: 593  WKIKDDKGYTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHNDSKENTLL 652
            W+ KD  G+TPL  + R+YD   Y++++     +  KWY N N+  NFK H D K NTLL
Sbjct: 573  WEHKDINGHTPLFAVFRSYDAVNYDEIVTKVLDQVVKWYANNNKPFNFKIHEDPKGNTLL 632

Query: 653  HILKCDIQVLLKYDNININAHNLKYITPLMTYVKYNRVSNIQEIIRDERLILGKYQKHTF 712
            H++K  I+ LLK  ++N+N  + K +TPLM Y +YNR++NI+ I++DERL+    Q+   
Sbjct: 633  HVMKSGIESLLKLPDVNVNKPDSKGLTPLMIYSRYNRITNIETIMKDERLLCDLVQQPLV 692

Query: 713  LDCYDFVKNTIIFEDLGVRSVRNSMFNL--FSAYSLRVENSNWVLYFTFKDTNQDSYITK 770
            +   DF KN  +      +++ ++ FN      +SLR E   W +   F +      I K
Sbjct: 693  MTSLDFTKNPKV-----TKTILDATFNREPVVIHSLRFEERKWKIGI-FSEG-----IFK 741

Query: 771  SVSLKILFNIIKKYNKLYPLHFIPHKEVL--LRLTGIVKNNPNNGIQKLKNRAFLNLISN 828
              SL ++   ++    +YP  F P + +   LRL GI        +Q       L+++ +
Sbjct: 742  KYSLDLIQYYLRYLKIMYPCSFHPVQLLTNELRLLGIYGVPGVLRLQSYHTFKKLDMLFS 801

Query: 829  YFGTLIETDDFDTELFKNPESLTKWIKAGKRKHKKENYYKRMTLDDINMIKSFVQFNINE 888
            Y  T          L K+ E L   +        +   + ++  ++IN I++F+++N+ E
Sbjct: 802  YVNT-----RGKLWLGKDEEELKVLLDVPTPYLSESERFIKLEPEEINGIQTFLKYNLAE 856

Query: 889  LGKLNRTLAILKKLCTFLALKINDVNESYKLFRNFGALLQQKDISNQMKKIDGLIKPKYF 948
              KL   L ILKKL     +K  DV      F + G  + QK ++   +  +       +
Sbjct: 857  FQKLRNCLIILKKLAIVQQIKHRDVITMRNSFLSLGNQMSQKGVAKSFENTNCAWS---Y 913

Query: 949  QSIFLILLDQISFLEICTIHMSDNFNDLIKNDIPEWHSVHFI-LSNLKKQYKRDFS-DFD 1006
               +      + +LE   + + +NF  L+      W   HF  L  LKK++K++F  D  
Sbjct: 914  DLSYYEFTRNLEYLEHSVVTLLNNFESLLAKTTLWWK--HFGELMELKKEWKKNFPNDKA 971

Query: 1007 SRNGLNENILSRYTKNKREAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEEFNKFLTF 1066
              +  N N +  Y + KR     ++S ++  ++    K+   I   HE++A   N F+ F
Sbjct: 972  PPSSANRNFIDTYIEGKRSKFRNKLSNQLKMSSLNLKKIGGEIKTTHESIAVGINLFIEF 1031

Query: 1067 KSRFFKDVILNMIIPSAI 1084
            K +F+ D I+  I+   I
Sbjct: 1032 KEQFYHDHIVKSIVDQRI 1049

>KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6.20
            YML002W
          Length = 1131

 Score =  412 bits (1060), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 328/1147 (28%), Positives = 549/1147 (47%), Gaps = 96/1147 (8%)

Query: 8    MPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLTLKEL 67
            MP LLNPL++AVFNC D   SPLRK++  +    F+L+VPP   L +Y D      L EL
Sbjct: 1    MPELLNPLVDAVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHEL 60

Query: 68   CYEFEFVASHII----------LDTDNSSNNLQVKGKNSNETLDNRYKSXXXXXXXXXXX 117
            C+  EFV+SHI+          +DTD S    +++     +      K            
Sbjct: 61   CHSPEFVSSHILTRYSGKDNKPIDTDLS----RLRAVREAKFCTFNGKIINGLFSKQSLY 116

Query: 118  XXXPLDFNNSTQXXXXXXXXXXXLPNFNEYLSGSEKYTIIYTDYPF--SNSWLPKIEIES 175
                  F ++ +           L +F  YL GS  + +IY D P   +N  L   +++ 
Sbjct: 117  TTDGFSFRSTRRILKYET-----LDHFQNYLQGSSTFILIYIDQPLIDTNRLLKCEDLDC 171

Query: 176  F-------YISKKESNNIKAAQITNHKSPLSQDLAQKTKSSFRHIINIHKEWNNIFDSYI 228
            F         S +   N+ +A++   ++PL   +             IH ++N  F +  
Sbjct: 172  FPNLTINTTPSTRSLANLSSAEVPPQRNPLLNSM-------------IHAQYNWKFRAVF 218

Query: 229  IDFKNKQLNLTSLPI-YFREIVDKAYQKMKFEEIFLSFHN--DLYNLIFEYLESSFYNSI 285
             +++ +     S+ I  FR+ +DK Y  +       SFH    +  LI EY+E + Y+ +
Sbjct: 219  QNYRKEITQSESMLIPGFRKTIDKIYDGLDN-----SFHTIPTIRQLIQEYVEQNVYDDV 273

Query: 286  WDH-IDRNMIDN----QFLHTEMMDFLSIDQLELELYNQNFQKFNLVNVIKVERCVKDAT 340
            W   I+RN  +     Q   +++  F+S+DQL+ + Y   F KF L +++++E+ +  AT
Sbjct: 274  WQVLINRNNAEGEKEKQSESSDIFRFISLDQLDTDFYKAKFSKFYLKDIVQLEKNISKAT 333

Query: 341  DQFKKIIDSKSHSEKCQILIDALQKLT-SYDDVHYEPLMVDADTLMNLFLLVICRSKVPF 399
              F+ +  + ++ EKC++L++ LQ L+     V    + + ADTL++LF+L+I R+K+  
Sbjct: 334  KSFENLSVTHTYVEKCRVLVETLQILSKPVKRVGGYQVPITADTLVSLFILLIKRTKMKN 393

Query: 400  LRNHLYYLQNFSTDENNVKFGLLGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNKE-- 457
            +R HLYYLQNF  DEN++KFGLLGY IST EA +CYL+  +     +K+ L+CI   +  
Sbjct: 394  IRCHLYYLQNFHQDENSIKFGLLGYAISTLEAVICYLETIET----DKERLDCIEKNDAN 449

Query: 458  ------LISKISSEADHSTFQVKLYKDCFKFRNEMGESILALCIKHKKNETLFEILL-NF 510
                  L+++ S    +    +  Y   F++RN  G S L+LCI + KN+  FE+L  N+
Sbjct: 450  LEEFLTLLTR-SKCVSNEGLDLSKYSHNFRYRNGDGNSTLSLCIINFKNDIFFELLSENY 508

Query: 511  EDMFPXXXXXXXXXXXGTTLLMKALKVENEVGAKLIVDVLQSSCSEDELIKYFNRTDNNQ 570
            E  F            GTTLLM++L+  N    + + D++  + +E+EL  Y  + D  +
Sbjct: 509  ESYFAFEDLLEDQTTEGTTLLMQSLQHSNHEITEYLTDIMLKNSTEEELYYYCGKRDKYK 568

Query: 571  RIAAHYITNQIDVLKRIGLFFNWKIKDDKGYTPLTTICRTYDQECYEQMIETAFFEAQKW 630
            R   HYI  Q  +L++IG +  W  KD  G TPL  I R+YDQ  Y+ M+ET+F  A +W
Sbjct: 569  RNIGHYICGQQTLLQKIGKYIKWDSKDCTGQTPLCVIFRSYDQAFYDVMVETSFAIAVEW 628

Query: 631  YEN-RNQKLNFKDHNDSKENTLLHILKCDIQVLLKYDNININAHNLKYITPLMTYVKYNR 689
            Y   +N K  F+DH DSK NTLLHI+KC+I  LL+  +++IN  N + ++PL     Y+R
Sbjct: 629  YSTVKNSKFCFRDHTDSKGNTLLHIIKCNISFLLQSPDVDINKVNSQGLSPLTNNAMYDR 688

Query: 690  VSNIQEIIRDERLILGKYQKHTFLDCYDFVKNTIIFEDLGVRSVRNSMFNLFSAYSLRVE 749
              N++ +++D RLI   +    FL  Y   K+  I     + +       + S +  R+ 
Sbjct: 689  GENVEALLKDPRLIFSSFD---FLKQYPNTKSAPILSHYCLDNEAPFRNIIASHFDFRIS 745

Query: 750  NS-NWVLYFTFKDTNQDSYITKSVSLKILFNIIKKYNKLYPLHFIPHKEVLLRLTGIVKN 808
            N  + VL    K+  Q+   +++  LK L  + +   K +P  F P +E+L  L+ + K 
Sbjct: 746  NKRSVVLTSRSKEDAQELIGSEAFELKNLKALFRLLLKQHPFTFFPLEELLDELSVVEKT 805

Query: 809  NPNNGIQKLK-NRAFLNLISNYFGTLIETDDFDTELFKNPESLTKWIKAGK-----RKHK 862
              +  + K       L  ++    +++E +   T   ++   L + I   K      K K
Sbjct: 806  ASSRSLMKSSFCSKVLKKLTYCLDSMVEMELLPTAALQSVALLERHIAKEKVTVDEEKLK 865

Query: 863  KENYYKRMTLDDINMIKSFVQFNINELGKLNRTLAILKKLCTFLALKINDVNESYKLFRN 922
            + +  K+M  + I  I +F+++ +  L KL  T+  L+K      LK  D++ES  +   
Sbjct: 866  RRSKDKKMQPESIGTITTFLKYILESLLKLKGTIIELRKFSILSKLKSKDISESKNIVCT 925

Query: 923  FGALLQQKDISNQMKKIDGLIKPKYFQSIFLILLDQISFLEICTIHMSDNFNDLIKNDIP 982
             GA +  K I   M +   +      +  F +L+ QI F E C   + ++ + L+   IP
Sbjct: 926  LGAEVSSKKIGRAMVRYSTIDNKFLGEQSFDLLVFQIHFFESCLSSIINSIDHLLHLKIP 985

Query: 983  EWHSVHFILSNLKKQ----YKRDFSDFDSRNGLNE------------NILSRYTKNKREA 1026
            EW   +  L  L K+      R+     + N  N              +L  + + KR  
Sbjct: 986  EWWKCYGQLLELSKEDPSVLARESDHKQTPNASNNVGTSTTDHTSGMGVLGTFIEGKRIK 1045

Query: 1027 AEKRISEEIIENTTLFDKVTAHIWYAHENLAEEFNKFLTFKSRFFKDVILNMIIPSAIAT 1086
             ++R    I +       +   I   +  +  E+  F+ F+S+F    +L   +   I  
Sbjct: 1046 NQERTRAAISDLQRRLKLLDNEIDTNNTLVVIEYCIFINFQSKFIHSAMLEKWVKLNINL 1105

Query: 1087 LKDQVLN 1093
            LK  +L+
Sbjct: 1106 LKKSLLD 1112

>NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6.20
            YML002W
          Length = 1193

 Score =  400 bits (1028), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 352/1196 (29%), Positives = 583/1196 (48%), Gaps = 131/1196 (10%)

Query: 6    YHMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLTLK 65
            YH+P LLNPL+NAVFNCPDP +SP +KLF  +K + F+L+VPP   LL+Y D    L+L 
Sbjct: 4    YHLPTLLNPLLNAVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKLSLN 63

Query: 66   ELCYE-FEFVASHIILDTDNSSNNLQVKGKNSNETLDNRYKSXXXXXXXXXXXXXXPLDF 124
            ELCY   +F+ SHI+  ++   +N      N +E  DN   +                  
Sbjct: 64   ELCYHNSDFLGSHILTWSNAIDSNKDSTTTNDDEEFDNLNGNKFIIKWKHNIIFTR---- 119

Query: 125  NNSTQXXXXXXXXXXXLPNFNEYLSGSEKYTIIYTDYPFSNSWLPKIEIESFYISKKESN 184
             N +            L NFN+Y  GS+++ +I+ D P + S L  I  +S       + 
Sbjct: 120  GNFSNDQRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSL--IANDSLKCLLPNTR 177

Query: 185  NIKAAQITNHKSPLSQDLAQKTKSSFRHIINIHKEWNNIFDSYIIDFKNKQLNLTSLPIY 244
            ++K+ +    ++PL QDL+Q++KSSF + +N ++ WN  F     ++K +   L      
Sbjct: 178  DLKSQE---KETPLVQDLSQQSKSSFENDLNKNEAWNLKFGILSNNYKIESSELEPNHKL 234

Query: 245  FREIVDKAYQKM----KFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHIDRNMI------ 294
            FRE+V++A+ ++     F++      + L+ L  +Y+E   Y+ IW  I + M+      
Sbjct: 235  FRELVNEAFIEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMMNSVKNY 294

Query: 295  --DNQFLHTEMMDFLSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSH 352
              D +  H  ++   SI +++   Y+     F L  V  +E+ +K +     K+  +KS+
Sbjct: 295  ADDQKAQH--LIKHFSIVEIDPNFYDI----FPLKFVPMLEKNLKHSVTCINKLKSTKSY 348

Query: 353  SEKCQILIDALQKLTSYD-------DVHYEPLMVDADTLMNLFLLVICRSKVPF--LRNH 403
            +EK  ILI++LQ +T  +       D +    ++DAD L+NL  LVI +S +    L+ +
Sbjct: 349  TEKSTILIESLQIITDSNTGGEESKDKNKSGYLIDADNLLNLLTLVILQSNITLHDLKAN 408

Query: 404  LYYLQNFSTDENNVKFGLLGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNKELISKIS 463
            LYYL+ FSTDE++  FG+L Y I+TF      L++    ++  ++        +LI ++ 
Sbjct: 409  LYYLKYFSTDESSSSFGILNYTIATFHMVSHVLENVIDWDRLKEK-------SDLIEELI 461

Query: 464  SEADHSTFQVKLYKD---CFKFRNEMGESILALCIKHKKNETLFEILLNFEDMFPXXXXX 520
               D ST       D      +RN  GES+LAL I +K+N+   + L+ +ED+       
Sbjct: 462  MTDDLSTLSSTFENDKKTLLMYRNSNGESLLALSIINKQNKKFTQYLIEYEDILNMDIIS 521

Query: 521  XXXXXXGTTLLMKALKVENEVGAKLIVDVLQSSC-SEDELIKYFNRTDNNQRIAAHYITN 579
                   +TLL++A++  N   A ++V +L  +C ++ ELI Y N+ D + R   HY+  
Sbjct: 522  NDQSMDSSTLLLQAIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNRNIGHYLVI 581

Query: 580  QIDVLKRIGLFFNWKIKDDKGYTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLN 639
             + +LK IG F NWK KD  G TPL TI R+YDQ  Y++++   F  A KWY   N K  
Sbjct: 582  NLTILKIIGQFINWKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAANNLKFQ 641

Query: 640  FKDHNDSKENTLLHILKCDIQVLLKYDN-----ININAHNLKYITPLMTYVKYNRVSNIQ 694
              DH+DS  N+LLHIL+ +I +LL Y       IN+N  N K  TPLM Y KY R  NI+
Sbjct: 642  MNDHDDSNGNSLLHILQNNISILLDYAKDQNIPINLNKMNCKGFTPLMMYFKYKRYDNIR 701

Query: 695  EIIRDERLILGKYQKHTFLDCYDFVKNTIIFEDLGVRSVRNS-MFNLFSAYSLRVENSN- 752
             II++E+LI  K+Q   F+DC+D+  ++ I  D+G   + N  +F      SL+ + S  
Sbjct: 702  MIIKEEKLIFNKFQSPNFIDCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLKKQMSTV 761

Query: 753  -------WVLYFTFKDTNQDSYITKSVSLKILFNIIKKYNKLYPLHFIPHKEVLLRLTGI 805
                   ++ Y    D    S +TK++    L   +K   + Y + F+P   +L      
Sbjct: 762  PSLPRGLYINYTILIDEADKSTLTKTMKFTSLVKFLKIMKRKYAISFLPLDTLLNESQSF 821

Query: 806  V----KNN------PNNGIQKLKNRAFLNLISNYFGTLIETDD--FDTELFKNPESLTKW 853
            +    KNN      P   I+KL+ R FL  ++     L+  DD    T L  +   L +W
Sbjct: 822  LDKKSKNNNNLRTIPLRYIEKLRIRRFLKRLNTCLDVLLHFDDSTIATPLLLSETELLEW 881

Query: 854  IKAGKRKHKKENYYKRM----------------TLDDINMIKSFVQFNINELGKLNRTLA 897
            I   + K ++ +                       ++IN+I++F++FN+NEL  ++  L 
Sbjct: 882  ISIEESKLRRSSTTPSAKSKLENAMGEKKKKELKPENINIIQNFLKFNLNELNTISMNLK 941

Query: 898  ILKKLCTFLALKINDVNESYKLFRNFGALLQQKDISNQMKKIDGLIKPKYFQSIFLILLD 957
            +L KL  F+ LK  D++++   F      L  K++ + ++K   +I    +     +LL+
Sbjct: 942  VLSKLVIFMNLKTLDIHDAQIRFNGLVKGLNNKEVPSIIEKSFNVIDSSRYDDDKGVLLE 1001

Query: 958  Q----ISFLEICTIHMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDFSDF-------- 1005
                 ISF   CT+ +  +  ++IK  IP W  ++  L  L K Y ++F +         
Sbjct: 1002 SLHEDISFFNECTLKLIHDVENIIKIKIPNWWKLYGELLELNKYYHKNFPNCVVHARRTD 1061

Query: 1006 -----------------------------DSRNGLNENILSRYTKNKREAAEKRISEEII 1036
                                         + +N  N  + +   +N++   E++ S  I 
Sbjct: 1062 LLSGNNANTNTNTNTNTNTNSPQRLHHHSEHQNNSNNGVFANLIENQKNKLERKTSHHID 1121

Query: 1037 ENTTLFDKVTAHIWYAHENLAEEFNKFLTFKSRFFKDVILNMIIPSAIATLKDQVL 1092
            E  +L + + + +   HE+LAEE N+++ FK+RFF   I+   +   I  L++ VL
Sbjct: 1122 ETISLLESLGSGLLNKHEHLAEELNRYMEFKNRFFGRNIMKNFVGEDIKLLEEHVL 1177

>TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_6.20
            YML002W
          Length = 1204

 Score =  341 bits (874), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 344/1209 (28%), Positives = 557/1209 (46%), Gaps = 145/1209 (11%)

Query: 11   LLNPLINAVFNC--PDPINSPLRKLFERIKYKNFMLIVPPNEILLHY--------RDPEK 60
            +LNPLI  +F+    D +N PL+KLFE++K   F+L+ PP +ILL+Y        R+P  
Sbjct: 5    ILNPLIEVLFHSEGTDTLNGPLKKLFEKLKLLKFVLLAPPTDILLNYLDSSNITPRNPYN 64

Query: 61   GLT---LKELCY-EFEFVASHIIL-DTDNSSNNLQVKGKNSNETLDNRYKSXXXXXXXXX 115
            G     L++LC   ++F+ASHI+L D+    N+  V    + +T+  +  +         
Sbjct: 65   GSNAKPLEDLCMNSYDFIASHILLYDSKVIKNDQCVMESINGKTITIKRVTGNGALNNGE 124

Query: 116  XXXXXPLDFNNSTQXXXXXXXXXXXLPNFNEYLSGSEKYTIIYTDYPF-----SNSWLPK 170
                 P   N +T              NFN YL G E Y I Y DYP       N +L  
Sbjct: 125  MLVITPSK-NYNTPKKMLKIIKMDLWHNFNSYLQGMENYPIWYIDYPLYPNIIKNEFLTA 183

Query: 171  -----IEIESFYISKKESNNIK-AAQITNHK----SPLSQDLAQKTKSSFRHIINIHKE- 219
                 IE E +    +  N+++   +  NHK    S L  D++Q  +  F  +I   +  
Sbjct: 184  FDRKLIETEQYSDIAQPVNDLENTTKDQNHKIRNISKLEPDISQSDRGGFTKLIKDDRVI 243

Query: 220  WNNIFDSYIIDFKNKQL----------NLTSLPI-YFREIVDKAYQKMKFEEI--FLSFH 266
            W  + +SY    K+ +           N T + I   R+I    ++++K E+   FLS H
Sbjct: 244  WQPLINSYRATTKHIEQAEGLPQAIDENQTDVNIEMVRDINCDLFEQLKDEKRYNFLS-H 302

Query: 267  NDLYNLIFEYLESSFYNSIWDHIDRNMIDNQFLHTEMMDFLSIDQLELELYN-QNFQKFN 325
            ++L  LI+E++E   ++ IW  I     ++ F  +++ + +S+++L L  Y+  NF+ F 
Sbjct: 303  DNLMELIYEFIEIKLHDDIWGRISFKFTESDFDFSKLSN-ISVNKLLLNFYSTNNFKNFK 361

Query: 326  LVNVIKVERCVKDATDQFKKIIDSKSHSEKCQILIDALQKLTSYDDVHYEPLMVDADTLM 385
            L +++ +E+ +  A   F+K I+  +  EK   LI  LQ LT          + DADTL+
Sbjct: 362  LHDIVMMEKKISRAVTYFQKFINGITFQEKSTALIKTLQILTINK-------LTDADTLI 414

Query: 386  NLFLLVICRSKVPFLRNHLYYLQNFSTDENNVKFGLLGYGISTFEATLCYLKDFQAGEKF 445
             L  +VICR KV  L++HL+YLQNF+ D N +KFG+LGY IST EA   Y        K 
Sbjct: 415  GLLSIVICRLKVRNLKSHLFYLQNFAADPNTIKFGILGYSISTLEAITYYFDHISHSHKA 474

Query: 446  NKQVLNCIRNKELISKISSEADHSTFQVKLYKDCFKFRNEMGESILALCIKHKKNETLFE 505
            +  +  C +   L   I +          L  D   +R++ GES+L+LCI + K +   E
Sbjct: 475  D-LIAFCDKLHNLYDTILNNIK------SLDNDILSYRSQNGESLLSLCIINNKMDIFLE 527

Query: 506  ILLNFEDMFPXXXXXXXXXXXGTTLLMKALKVENEVGAKLIVDVLQSSCSEDELIKYFNR 565
            +L  +E  FP           G++LLM+A K  N V ++++V +L++SC+E+EL  + N+
Sbjct: 528  LLTTYEHSFPIEDILDDSDLNGSSLLMQACKYNNYVASEILVTILKNSCNEEELRIFLNK 587

Query: 566  TDNNQRIAAHY--ITNQIDVLKRIGLFFNWKIKDDKGYTPLTTICRTYDQECYEQMIETA 623
            TD   R  AHY  + N I +L   G   +W++KD K  TPL TI + +     E  I+  
Sbjct: 588  TDKFNRSVAHYFNMKNSILILTEFGNLIDWELKDIKKLTPLLTIFKVHKVNYNESFIKIL 647

Query: 624  FFEAQKWYENRNQKLNFKDHNDSKENTLLHILKCDIQVLLK----YDNININAHNLKYIT 679
            F     WY+  N+  N K H D   N LLH++K  I  L++     + ININA+N K ++
Sbjct: 648  FRVVLTWYKIHNKPFNLKAHVDQNGNNLLHVMKDYINCLIENPELCETININANNNKGLS 707

Query: 680  PLMTYVKYNRVSNIQEIIRDERLILGKYQKHTFLDCYDFVKNTIIFEDLGVRSVRNSMFN 739
            P M Y K NR  NI+ I+++  LI  + Q   FL     + N+ +   L    +R   F 
Sbjct: 708  PFMVYFKTNRYDNIRIILKNPTLITSEGQL-PFLITSTNLYNSKVNHLLATHFLRTLDFA 766

Query: 740  LFSAYSLRVENSN---------WVLYFT-------FKDTNQDSYITKSVSLKILFNIIKK 783
                +SLR  + +         W++  +       F  ++     TK++ LK + +++  
Sbjct: 767  YICLHSLRFNDPSSSTSGTSLAWLVDISILEKESEFPTSHPSICRTKTLKLKTIKSLLHH 826

Query: 784  YNKLYPLHFIPHKEVLLRLTGIVKNNPNNGIQKLKNRAF---------------LNLISN 828
            + + Y    +P K  L     ++K+  NN I    NR F               L LISN
Sbjct: 827  FIRKYKYSSLPLKSALEFCNDLIKS--NNSISWTSNRHFLPLSLLIDKLEIQYNLKLISN 884

Query: 829  YFGTLIETDDFDTELFKNPESLTKWIKAGKRKHKKENYYKRMT----------------L 872
                L  T DFD  L  +   L  ++K   +K K+ N   + +                 
Sbjct: 885  CLNFLFITTDFDFTLLFDELKLQAFLKINNKKLKESNSSNKFSHKNNSDQTTELSKAYQP 944

Query: 873  DDINMIKSFVQFNINELGKLNRTLAILKKLCTFLALKINDVNESYKLFRNFGALLQQKDI 932
            +DIN I++F++FN+ EL     T+  +K +   +  KI D+N S   F+     +   ++
Sbjct: 945  EDINAIQTFIKFNLGELENFKNTITTIKDVSILIKYKIMDLNSSQFFFQKNTLKIGINNL 1004

Query: 933  SNQMKKIDG---LIKPKYFQSIFL-------------ILLDQISFLEICTIHMSDNFNDL 976
            S  +K       LI   Y    F               LL+ + F E     +  +F DL
Sbjct: 1005 SEILKYYSTQKPLITNAYTSRKFYDYNSYDYKVEFLNKLLENLIFFEKLVCKLYYDFEDL 1064

Query: 977  IKNDIPEWHSVHFILSNLKKQYKRDF--------SDFDSRNGLNENILSRYTKNKREAAE 1028
                I  W   +  L + + QY + +        ++F+S N + +    R   +     E
Sbjct: 1065 SNGTIKTWWYHYGRLLDYEAQYNKHYPNRKIDINNNFESFNTMFD---KRVNFDSITHFE 1121

Query: 1029 KRISEEIIENTTLFDKVTAHIWYAHENLAEEFNKFLTFKSRFFKDVILNMIIPSAIATLK 1088
            + I   I   +TL  +    I + HENLA E N F+ FK++F ++ I+       I  LK
Sbjct: 1122 RNIILNIKNTSTLLRRFNNKIKFLHENLAIELNNFMNFKNKFIREYIIKFSTIEVIKILK 1181

Query: 1089 DQVLNIENI 1097
            D ++ +++I
Sbjct: 1182 DNIIYMDSI 1190

>KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20
            YML002W
          Length = 942

 Score =  226 bits (576), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 238/814 (29%), Positives = 384/814 (47%), Gaps = 85/814 (10%)

Query: 278  ESSFYNSIWDHIDRNMIDNQFLHTEMMDFLSIDQLEL-ELYNQNFQKFNLVNVIKVERCV 336
            E+  Y+SIW+ +     + Q +      ++S  +L + + Y+  F KF+L +V+ +E  V
Sbjct: 179  EARLYSSIWNKLVHQTSEPQNIDKFYGCYISFHELNINDYYSLPFNKFSLRDVVFIENVV 238

Query: 337  KDATDQFKKIIDSKSHSEKCQILIDALQKLTSYDDVHYEPLMVDADTLMNLFLLVICRSK 396
              A  +F K+ +S S  EK  IL+     LTS        L +DAD L+N  L++I R K
Sbjct: 239  DLACKEFVKLRESLSFDEKIDILLSTFNILTS----KLPQLEIDADNLLNFMLIIINRVK 294

Query: 397  VPFLRNHLYYLQNFSTDENNVKFGLLGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNK 456
            +  L  H +YLQNF+  +N   FG+L Y IST  A L Y+ +    +KF K+  + I++ 
Sbjct: 295  LNNLNEHFHYLQNFNFKQNK-DFGILNYAISTLGAVLYYIDN--NLDKF-KRYTDAIQD- 349

Query: 457  ELISKISSEADHSTFQVKLYKDCFKFRNEMGESILALCIKHKKNETLFEILLNFEDM--F 514
               SKIS E               K+RNE GES L  CI  K N+TL E+L + E +  F
Sbjct: 350  ---SKISEEK-------------LKYRNENGESYLCHCIITKDNDTLRELLFSSEYIKNF 393

Query: 515  PXXXXXXXXXXXGTTLLMKALKVENEVGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAA 574
            P           G+TLLM A+K  N   A ++++++ ++ + DE+  Y N  D N R   
Sbjct: 394  PMEDILDDQTIDGSTLLMVAVKCLNTTAASILINIIINNGTPDEIRTYVNSVDENNRNVG 453

Query: 575  HYITNQIDVLKRIGLFFNWKIKDDK-GYTPLTTICRTYDQ--ECYEQMIETAFFEAQKWY 631
            H+ITNQ  +L +IG + NW  KD + G TPL  I R+YDQ  + Y++M   +F  A    
Sbjct: 454  HFITNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIFRSYDQSIKSYKKMSRRSFRFAMD-- 511

Query: 632  ENRNQKLNFKDHNDSKENTLLHILKCDIQVLLKYDNININAHNLKYITPLMTYVKYNRVS 691
               +     K H D+  NTLLHILK +IQ++L + ++ IN+ N   +TPLM + KY R+ 
Sbjct: 512  ---SGDFQLKKHIDNSNNTLLHILKTNIQMILPHASLFINSPNSLGMTPLMVFCKYRRLY 568

Query: 692  NIQEII----RDERLILGKYQKH-TFLDCYDFVKNTIIFEDLGVRSVRN-SMFNLFSAYS 745
            NIQ ++    +D   I    Q H  + +C+    +  I   LG  +++N S+F     +S
Sbjct: 569  NIQILLSSKFKDRVSIFETQQVHNAWSNCFSLTNDDQILNLLGKFAIKNYSIFGNCFTHS 628

Query: 746  LR--------VENSNWVLYFTFKDTNQDSYITKSV-SLKILFNIIKKYNKLYPLHFIPHK 796
            L+           + + +  T K   +   I  ++ ++K L N++   N  +   F+P  
Sbjct: 629  LKQFLHKSKHGNKNQYSVKITLKFEKKYKTIRFNIKTIKALINMVLTSNS-HVSSFLPLY 687

Query: 797  EVLLRLTGIVKNNPNNGIQKLKNRAFLNLISNYFGTLIETDDFDTELFKNPESLTKWIKA 856
            +V   L GI      + I       F+N ++    T++  +    E F     L  +++ 
Sbjct: 688  KVFNELNGIA-----SMISTKSKILFINNLNVILDTILFLELVPREGFILEARLKDYLRN 742

Query: 857  GKRKHKKENYYKRMTLDDINMIKSFVQFNINELGKLNRTLAILKKLCTFLALKINDVNES 916
             ++        K++ ++DINMI +F++FN+NEL      +  + +    + LK+ D   S
Sbjct: 743  QRKIKTVATKSKKLQIEDINMISNFLKFNLNELNAFKNGVKKILRQMNSINLKLFDQRIS 802

Query: 917  YKLFRNFGALLQQKDISNQMKKIDGLIKPKYFQSIFLILLDQISFLEICTIHMSDNFNDL 976
            Y        LL   D+   +      +      S F IL + I      T+H    F + 
Sbjct: 803  YM------DLLHCPDVVVHLNNPLWNLNYNILISNFQILENSID----NTLHFLKVFQN- 851

Query: 977  IKNDIPEWHSVHFILSNLKKQYKRDFSDFDSRNGLNENILSRYTKNKREAAEKRISEEII 1036
                I +W  ++  L NL K       D           L R   N++E    ++S EI 
Sbjct: 852  --EKIRKWWKLNNELINLTKLASNSDDD-----------LLRSFFNRKE----KLSIEID 894

Query: 1037 ENTTLFDKVTAHIWYAHENLAEEFNKFLTFKSRF 1070
            +     +++   I+ +HE LA E N F+ FK  F
Sbjct: 895  DKIRSINELNCDIFVSHELLAVEINNFMKFKPLF 928

>YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative
           protein of unknown function
          Length = 290

 Score =  145 bits (365), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 99/291 (34%), Positives = 149/291 (51%), Gaps = 29/291 (9%)

Query: 6   YHMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLTLK 65
           YH+P LLNPL+NA+FNCP+P  SPL+KLF  +K + F+L+ PP+E LL+Y D +  L L 
Sbjct: 4   YHLPTLLNPLVNAIFNCPEPERSPLKKLFANLKTRRFILLAPPSEYLLNYHDVKSKLPLH 63

Query: 66  ELCYEFEFVASHIILDTDNSSNNLQVKGKNSNETLDNRYKSXXXXXXXXXXXXXXPLDFN 125
           +LCY  EF+ S+I+L T+NS  N   +  +  ETLD +                     N
Sbjct: 64  DLCYNAEFINSYILLMTENSYINTNSRDSHY-ETLDGKTVVIQWKNNVIHA-------LN 115

Query: 126 NSTQXXXXXXXXXXXLPNFNEYLSGSEKYTIIYTDYPFSNSWLPKIEIESFYISKKESNN 185
                          LPNFN+Y  G+  + I++ D P +  ++P   ++ F+  +K   N
Sbjct: 116 GFHIRRRLKILETKILPNFNDYFEGAADFIILFIDQPLNCEFVPNDYLQCFHNYEKIPKN 175

Query: 186 IKAAQITNHKSP-LSQDLAQKTKSSFRHIINIHK----EWNNIFDSYIIDFKNKQLNLTS 240
                   H  P LS D  Q+ +SSF +I++IH     +   +F SY      + L    
Sbjct: 176 A-------HAMPNLSIDSFQQERSSFENILHIHPARLTQLGQLFSSY------RTLAPGD 222

Query: 241 LP--IYFREIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHI 289
            P    F  IV +A+  MK + +F +F N LY+LI +Y E + Y+ IW  +
Sbjct: 223 DPSRSIFESIVQQAFDGMKSDSLFKNFSN-LYDLIHDYFELNLYDDIWSRL 272

>NCAS0A01710 Chr1 (332239..332946) [708 bp, 235 aa] {ON} Anc_4.101
           YGL020C
          Length = 235

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 3/47 (6%)

Query: 763 NQDSYITKSV---SLKILFNIIKKYNKLYPLHFIPHKEVLLRLTGIV 806
           NQ + + KSV   SL + F I+K +   +P++++PH EV  ++ G V
Sbjct: 101 NQTTKLLKSVKLVSLTVPFLILKLWKGKFPVYYLPHAEVFPKIIGGV 147

>NDAI0K00170 Chr11 complement(26066..27586) [1521 bp, 506 aa] {ON}
           Anc_8.876 YML097C
          Length = 506

 Score = 33.5 bits (75), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 7/69 (10%)

Query: 373 HYEPLMVD-----ADTLMNLFLLVICRSKVPFLRNHLYYLQNFSTDENNVKFGLLGYGIS 427
           HYEP   D     AD+ + L +  I +SKV FL +++ Y++ F  +E     G   Y +S
Sbjct: 270 HYEPGSDDGDAKGADSFIPLLIYTILKSKVQFLVSNVKYIERFRLEE--FLRGEESYYLS 327

Query: 428 TFEATLCYL 436
           + +A + ++
Sbjct: 328 SIQAAIDFI 336

>NCAS0A07510 Chr1 complement(1493599..1493976) [378 bp, 125 aa] {ON}
            Anc_7.23 YAL046C
          Length = 125

 Score = 31.2 bits (69), Expect = 6.1,   Method: Composition-based stats.
 Identities = 24/91 (26%), Positives = 40/91 (43%), Gaps = 19/91 (20%)

Query: 925  ALLQQKDISNQM---KKIDGLIKPKYFQ---------SIFLILLDQISFLEICTIHMSDN 972
            +LLQQ     ++   KK+   + PK  +         S+F I +    F  + T+     
Sbjct: 41   SLLQQLQTPEEIMITKKLQDALSPKLVKVQDISGGCGSMFSINVTSDKFNTLTTVKQHKM 100

Query: 973  FNDLIKNDIPEWHSVHFILSNLKKQYKRDFS 1003
             N++++ DIP WH        L+ Q K+D S
Sbjct: 101  INEILREDIPRWHG-------LQLQTKKDTS 124

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.138    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 128,266,325
Number of extensions: 6341275
Number of successful extensions: 22402
Number of sequences better than 10.0: 114
Number of HSP's gapped: 22996
Number of HSP's successfully gapped: 121
Length of query: 1105
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 985
Effective length of database: 39,721,479
Effective search space: 39125656815
Effective search space used: 39125656815
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)