Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1037.246.19ON36636616920.0
TPHA0J003206.19ON34233211711e-161
YOR006C (TSR3)6.19ON31328010991e-150
Skud_15.1676.19ON31233210981e-150
Smik_15.1756.19ON31231810761e-147
Suva_15.1816.19ON33631810781e-147
SAKL0E01144g6.19ON43024510841e-146
TDEL0G045006.19ON30128810631e-145
KNAG0M011506.19ON30730710611e-144
ZYRO0C07832g6.19ON28124010571e-144
CAGL0E02717g6.19ON32528110541e-143
KLLA0D01111g6.19ON31428110181e-138
NCAS0H008106.19ON32333610021e-135
NDAI0D007906.19ON40135810001e-134
ACR007W6.19ON3133279911e-134
Ecym_30236.19ON3492409681e-130
KLTH0C11264g6.19ON3463239431e-126
Kwal_56.224216.19ON3373169371e-125
TBLA0A072506.19ON3043328641e-115
KAFR0L003906.19ON3293248601e-114
Ecym_64542.38ON106679750.98
NDAI0F00850singletonON66346695.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1037.24
         (366 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {O...   656   0.0  
TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON...   455   e-161
YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}  ...   427   e-150
Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {O...   427   e-150
Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {O...   419   e-147
Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {...   419   e-147
SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON...   422   e-146
TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19...   414   e-145
KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {O...   413   e-144
ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar...   411   e-144
CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {O...   410   e-143
KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {O...   396   e-138
NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON...   390   e-135
NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {O...   389   e-134
ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic hom...   386   e-134
Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON} s...   377   e-130
KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} simila...   367   e-126
Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {...   365   e-125
TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {...   337   e-115
KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}...   335   e-114
Ecym_6454 Chr6 complement(880101..883301) [3201 bp, 1066 aa] {ON...    33   0.98 
NDAI0F00850 Chr6 (204487..206478) [1992 bp, 663 aa] {ON}               31   5.1  

>Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {ON}
           complement(54258..55358) [1101 nt, 367 aa]
          Length = 366

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/366 (88%), Positives = 325/366 (88%)

Query: 1   MAKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCD 60
           MAKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCD
Sbjct: 1   MAKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCD 60

Query: 61  PKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARL 120
           PKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARL
Sbjct: 61  PKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARL 120

Query: 121 DEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFS 180
           DEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFS
Sbjct: 121 DEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFS 180

Query: 181 WGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTNR 240
           WGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTNR
Sbjct: 181 WGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTNR 240

Query: 241 NMNGDDDEEEGNSYEALSGDDYEEENNNKSARYDNLGNIIESXXXXXXXXXXXXRVEVKY 300
           NMNGDDDEEEGNSYEALSGDDYEEENNNKSARYDNLGNIIES            RVEVKY
Sbjct: 241 NMNGDDDEEEGNSYEALSGDDYEEENNNKSARYDNLGNIIESEEDYDDYDDEEDRVEVKY 300

Query: 301 DSLGNIIENSDYEQYEEEKELRYDSLGNLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHK 360
           DSLGNIIENSDYEQYEEEKELRYDSLGNL                             HK
Sbjct: 301 DSLGNIIENSDYEQYEEEKELRYDSLGNLIESEGEISSEEEDEVGDEDEVDYEEDKIEHK 360

Query: 361 MENLKV 366
           MENLKV
Sbjct: 361 MENLKV 366

>TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON}
           Anc_6.19 YOR006C
          Length = 342

 Score =  455 bits (1171), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 232/332 (69%), Positives = 266/332 (80%), Gaps = 17/332 (5%)

Query: 1   MAKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDK---FPVKLAMWDFD 57
           MAKGKNK  E R+GKPSRGSNGH ++ NHK MEMK        + K   FPVKLAMWDFD
Sbjct: 1   MAKGKNKSSETRSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFD 60

Query: 58  HCDPKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSW 117
           HCDPKRCSGK+LERLGLIKSLRVGQKFQG+VVSPNGKGV+CP+D+E VEEFGASVVECSW
Sbjct: 61  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSW 120

Query: 118 ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLS 177
           ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR+D AAELL 
Sbjct: 121 ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLE 180

Query: 178 NFSWGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGN 237
           +FSWGLGFLE+N+ELL++YQ+CTDSESVKK EEEWL KI++E+QERK+Q+RE DIW+ GN
Sbjct: 181 HFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGN 240

Query: 238 TNRNMNGDDDEEEGNSYEALSGDDYEEENNNKSARYDNLGNIIESXXXXXXXXXXXXRVE 297
           TNR++    D+EE +S +      Y EEN  +  RYDNLGN++                E
Sbjct: 241 TNRDLQDMSDDEEFDSEQY-----YSEENTERKIRYDNLGNVL----ISEEENESEEEEE 291

Query: 298 VKYDSLGNIIENSDYEQYEEEKELRYDSLGNL 329
           V+YD+LGNIIE+      EE  EL+YDSLGNL
Sbjct: 292 VRYDALGNIIESE-----EEAAELKYDSLGNL 318

>YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}
           TSR3Protein required for correct processing of the 20S
           pre-rRNA at site D to generate mature 18S rRNA; green
           fluorescent protein (GFP)-fusion protein localizes to
           both the cytoplasm and the nucleus
          Length = 313

 Score =  427 bits (1099), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 205/280 (73%), Positives = 236/280 (84%), Gaps = 6/280 (2%)

Query: 1   MAKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCD 60
           M KGKNK HE + G+P RG+NGHSS+ NH+ MEMK    + S+  KFPVKLAMWDFDHCD
Sbjct: 1   MGKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKY---DNSEKMKFPVKLAMWDFDHCD 57

Query: 61  PKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARL 120
           PKRCSGK+LERLGLIKSLRVGQKFQG+VVSPNGKGV+CP+D EIVE+ GASVVECSWARL
Sbjct: 58  PKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARL 117

Query: 121 DEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFS 180
           +EVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWA+ELLS+FS
Sbjct: 118 EEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFS 177

Query: 181 WGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTNR 240
           WG+GFLE+N+ELL+IYQQCTD +SVK+AEEEWL K+E+E QERK++A+E DIWMMGN NR
Sbjct: 178 WGMGFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINR 237

Query: 241 NMNGDDDEEEGNSYEALSGDDYEEENNNKSARYDNLGNII 280
             NG   +   +   +   D    E NN+   YD+LGN I
Sbjct: 238 RGNGSQSDTSESEENSEQSD---LEGNNQCIEYDSLGNAI 274

>Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  427 bits (1098), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 217/332 (65%), Positives = 255/332 (76%), Gaps = 24/332 (7%)

Query: 1   MAKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCD 60
           M KGKNK HE +  +  RG+NGHS++ NHKHMEMK Y K  S+  KFPVKLAMWDFDHCD
Sbjct: 1   MGKGKNKTHEPKNERQQRGANGHSARQNHKHMEMK-YDK--SEKMKFPVKLAMWDFDHCD 57

Query: 61  PKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARL 120
           PKRCSGK+LERLGLI+SLRVGQKFQGVVVSPNG+GV+CPND EIVE+ GASVVECSWARL
Sbjct: 58  PKRCSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARL 117

Query: 121 DEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFS 180
           +EVPFNKIGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVG+MDWA+ELLS+FS
Sbjct: 118 EEVPFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFS 177

Query: 181 WGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTNR 240
           WGLGFL++N+ELL+IYQ+CTD++SVKKAE+EWL K+E E QERK+  +++DIWMMGN NR
Sbjct: 178 WGLGFLDLNKELLEIYQRCTDADSVKKAEKEWLEKLEMETQERKSHTKKTDIWMMGNINR 237

Query: 241 NMNGDDDEEEGNSYEALSGDDYEE---ENNNKSARYDNLGNIIESXXXXXXXXXXXXRVE 297
             NG        S E  SG+D E+   EN+ +   YD LGN I                 
Sbjct: 238 RGNGV------QSDELESGEDSEQSGLENSEQPIEYDALGNAIHVDSVKSRIM------- 284

Query: 298 VKYDSLGNIIENSDYEQYEEEKELRYDSLGNL 329
                L  + E+ + +  E EK + YDSLGNL
Sbjct: 285 -----LSGVSEDEESDFGENEKPVNYDSLGNL 311

>Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  419 bits (1076), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 212/318 (66%), Positives = 244/318 (76%), Gaps = 17/318 (5%)

Query: 1   MAKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCD 60
           M KGKNK HE + G+P RG+NGHSS+ NH+ MEMK      S   KFPVKLAMWDFDHCD
Sbjct: 1   MGKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKYEN---SDKVKFPVKLAMWDFDHCD 57

Query: 61  PKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARL 120
           PKRCSGK+LERLGLIKSLRVGQKFQG+VVSPNGKGV+CP+D E+VE+ GASVVECSWARL
Sbjct: 58  PKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARL 117

Query: 121 DEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFS 180
           +EVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWA+ELLS+FS
Sbjct: 118 EEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFS 177

Query: 181 WGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTNR 240
           WG+GFLE+N+ELL+IYQQCTD++SVK+AEEEWL K+E+E QERK+QA+E DIWMMGN NR
Sbjct: 178 WGMGFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINR 237

Query: 241 NMNGDDDEEEGNSYEALSGDDYEEENNNKSARYDNLGNII-----------ESXXXXXXX 289
              G    +   S    S  + E E + +   YD+LGN I                    
Sbjct: 238 RGGG---WQSDESESGGSSGESESEGDKQCVEYDSLGNAICIDSINSRKSLSEESEDEEN 294

Query: 290 XXXXXRVEVKYDSLGNII 307
                +  V YDSLGN+I
Sbjct: 295 DLEENKEPVSYDSLGNLI 312

>Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {ON}
           YOR006C (REAL)
          Length = 336

 Score =  419 bits (1078), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 212/318 (66%), Positives = 242/318 (76%), Gaps = 17/318 (5%)

Query: 1   MAKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCD 60
           M KGKNK HE + G+P RG+NGHSS+ NHK MEMK    + S+   FPVKLAMWDFDHCD
Sbjct: 25  MGKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKY---DNSEMTNFPVKLAMWDFDHCD 81

Query: 61  PKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARL 120
           PKRCSGK+LERLGLIKSLRVGQKFQG+VVSPNG GV+CP+D E+VE+ GASVVECSWARL
Sbjct: 82  PKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARL 141

Query: 121 DEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFS 180
           +EVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWA+ LLS+FS
Sbjct: 142 EEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFS 201

Query: 181 WGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTNR 240
           WGLGFL++N ELL+IYQ+CTDS SVKKAEEEWL K+E+E QERK+Q+++ DIWMMGN NR
Sbjct: 202 WGLGFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNR 261

Query: 241 NMNGDDDEEEGNSYEALSGDDYEEENNNKSARYDNLGNII-----------ESXXXXXXX 289
             NG    +   S      D  E E++ +S  YD+LGN I                    
Sbjct: 262 KDNG---AQSDESESEEDSDQSELESDKQSIEYDSLGNAICIDNVKSRKMLSEGSEDEES 318

Query: 290 XXXXXRVEVKYDSLGNII 307
                   V YDSLGNII
Sbjct: 319 EFEEDEEPVSYDSLGNII 336

>SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 430

 Score =  422 bits (1084), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 196/245 (80%), Positives = 218/245 (88%), Gaps = 1/245 (0%)

Query: 1   MAKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCD 60
           M KGKNK HE R+ +P RG+NGHSS+LNHK MEMK+ G + S  +KFPVKLAMWDFDHCD
Sbjct: 1   MGKGKNKNHEERSSRPHRGANGHSSRLNHKRMEMKR-GGDSSAGNKFPVKLAMWDFDHCD 59

Query: 61  PKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARL 120
           PKRCSGK+LERLGLIKSLRVGQKFQG+VVSPNG+GV+CPNDR IVEE GASVVECSWARL
Sbjct: 60  PKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARL 119

Query: 121 DEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFS 180
           DEVPF +IGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR D A+ELLSNFS
Sbjct: 120 DEVPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFS 179

Query: 181 WGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTNR 240
           WGLGFLE+N+ELL+IYQQCTD++SVK AEE WL KIE+E Q+RK Q++E DIWMMGN NR
Sbjct: 180 WGLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVNR 239

Query: 241 NMNGD 245
               D
Sbjct: 240 RRTCD 244

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 9/60 (15%)

Query: 273 YDNLGNIIESXXXXXXXXXXXXRVEVKYDSLGNIIENSDYEQYEE---EKELRYDSLGNL 329
           YD+LGNIIE                 +++S G+   + + E  EE   +KE +YDS GN+
Sbjct: 368 YDSLGNIIEKHSKETDFKT------TRHNSFGSTTSSEEDEYIEELHTKKEAKYDSFGNI 421

>TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19
           YOR006C
          Length = 301

 Score =  414 bits (1063), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 202/288 (70%), Positives = 237/288 (82%), Gaps = 21/288 (7%)

Query: 1   MAKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCD 60
           M+KGKNK  EA+ G   +GSNGHSS+ NHK MEMK+     ++D KFPVKLAMWDFDHCD
Sbjct: 1   MSKGKNKNREAKNGHSGKGSNGHSSRQNHKRMEMKRG----TEDTKFPVKLAMWDFDHCD 56

Query: 61  PKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARL 120
           PKRCSGK+LERLGLIKSLRVGQKFQG+VVSPNG GV+CP+D+ IVEE GASVVECSWARL
Sbjct: 57  PKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWARL 116

Query: 121 DEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFS 180
           DEVPFNKIGGKHERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGRMDWA+ELLS+FS
Sbjct: 117 DEVPFNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHFS 176

Query: 181 WGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTNR 240
           WGLGFLE+N+ELL+IYQQCTD++SVK AE  WL KI++E++ERK+QA++ DIWM GN NR
Sbjct: 177 WGLGFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNVNR 236

Query: 241 NMNGDDDEEEGNSY--------EALSGDDYEEENNNKSARYDNLGNII 280
                    +G ++         +   +  EEE+N K+ RYD LGN+I
Sbjct: 237 ---------KGTTFLDDNEEEESSEVEESDEEEDNGKTLRYDRLGNLI 275

>KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {ON}
           Anc_6.19 YOR006C
          Length = 307

 Score =  413 bits (1061), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 207/307 (67%), Positives = 241/307 (78%), Gaps = 16/307 (5%)

Query: 2   AKGKNKQHEARTGKPS-RGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCD 60
            KGKNK     T + S +GSNGHSS+LNHK ME++++  +  +  KFPVK+AMWDFDHCD
Sbjct: 4   GKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMELRQH--DGVKGTKFPVKMAMWDFDHCD 61

Query: 61  PKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARL 120
           PKRCSGK+LERLGLI SL+VGQKFQG+VVSPNG+GV+CP+DR IVEEFGASVVECSWARL
Sbjct: 62  PKRCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWARL 121

Query: 121 DEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFS 180
           DEVPFN+IGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMD A++LLSNFS
Sbjct: 122 DEVPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNFS 181

Query: 181 WGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTNR 240
           WGLGFLE+N+ELL++YQ+CTD ESVKKAEE+WL KIE+E Q+RK +AR+ DIWMMGN NR
Sbjct: 182 WGLGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNVNR 241

Query: 241 NMNGDDDEEEGNSYEALSGDDYEEENNNKSARYDNLGNIIESXXXXXXXXXXXXRVEVKY 300
           NMN                +  EEE    S RYDNLGN I                 ++Y
Sbjct: 242 NMN---------KMTLSDEESDEEETEASSIRYDNLGNAIIDESDEEEPEIS----SIRY 288

Query: 301 DSLGNII 307
           D+LGN+I
Sbjct: 289 DNLGNVI 295

>ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar to
           uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 281

 Score =  411 bits (1057), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 189/240 (78%), Positives = 210/240 (87%)

Query: 1   MAKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCD 60
           M KGKNK HE R+ +P RG+NGH+SK NHKHMEMK  G + S    FPVKL MWDFDHCD
Sbjct: 1   MGKGKNKNHEVRSTRPGRGANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCD 60

Query: 61  PKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARL 120
           PKRCSGK+LERLGLI+SLRVGQKFQGVVV+PNG GV+CPND+ IVEE GASVVECSWARL
Sbjct: 61  PKRCSGKKLERLGLIRSLRVGQKFQGVVVTPNGTGVVCPNDKSIVEEHGASVVECSWARL 120

Query: 121 DEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFS 180
           DEVPFN+IGG+HERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGRMDWA+ELLSNFS
Sbjct: 121 DEVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFS 180

Query: 181 WGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTNR 240
           +G  FLEIN ELL+IYQQCTD+ESVK AE  WL KIE+EI++RK QA+  DIWM GN NR
Sbjct: 181 YGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVNR 240

>CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006c
          Length = 325

 Score =  410 bits (1054), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 201/281 (71%), Positives = 231/281 (82%), Gaps = 3/281 (1%)

Query: 2   AKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCDP 61
            KGKNK H+      S GSNGH ++ NH+HMEMK  G   S+D  FPVKLAMWDFDHCDP
Sbjct: 4   GKGKNKSHDEGRSNKSGGSNGHHTRRNHRHMEMKYCGG--SKDSSFPVKLAMWDFDHCDP 61

Query: 62  KRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARLD 121
           KRCSGK+LERLGLIKSLRVGQKFQG+VVSPNGK V+CP+DREIVE  GASVVECSWARL+
Sbjct: 62  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARLE 121

Query: 122 EVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFSW 181
           EVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR D A ELLS+FSW
Sbjct: 122 EVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFSW 181

Query: 182 GLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTNRN 241
           GLGFLE+N++LL+ YQQCTDSES+KK EE+WL +I+QE+QERK +A+  D+WMMGNTNR 
Sbjct: 182 GLGFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTNRG 241

Query: 242 MNG-DDDEEEGNSYEALSGDDYEEENNNKSARYDNLGNIIE 281
            +G     +    YE  + ++ E+    K+ RYDNLGNIIE
Sbjct: 242 NSGLMPPSDSEEEYEEEAEEEEEDTTTRKNVRYDNLGNIIE 282

>KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 314

 Score =  396 bits (1018), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 198/281 (70%), Positives = 224/281 (79%), Gaps = 8/281 (2%)

Query: 1   MAKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCD 60
           M KGKNK+   R  +  +GSNGHSS+LNHK MEMK      S   KFPVKLAMWDFDHCD
Sbjct: 1   MGKGKNKESSTRP-RSQKGSNGHSSRLNHKRMEMKHVDSTTS---KFPVKLAMWDFDHCD 56

Query: 61  PKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARL 120
           PKRCSGK+LERLGLIKSLRVGQKFQGVVVSPNGK V+CP+D+ +VEE GASVVECSWARL
Sbjct: 57  PKRCSGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARL 116

Query: 121 DEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFS 180
           DEVPFNKIGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR D AA+LLSNFS
Sbjct: 117 DEVPFNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFS 176

Query: 181 WGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTNR 240
           WG  FLE+N+ELL IYQQCTD +SVK AEE+WL KIEQE  ERK QA+  DIWM+GN NR
Sbjct: 177 WGPAFLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVNR 236

Query: 241 -NMNGDDDEEEGNSYEALSGDDYEEENNNKSARYDNLGNII 280
            + +      E    + L+GD   +    +  +YD+LGN+I
Sbjct: 237 ASRDLPGSSGEEEEEDYLNGDSLIDV---RDIKYDSLGNVI 274

>NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON}
           Anc_6.19 YOR006C
          Length = 323

 Score =  390 bits (1002), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 197/336 (58%), Positives = 256/336 (76%), Gaps = 23/336 (6%)

Query: 1   MAKGKNKQHEA--RTGKPSRGSNGHSSKLNHKHMEMKKY-GKNISQDDKFPVKLAMWDFD 57
           M KGKNK+ +     G+  RG+NGHSS+ NHK+MEM+K+  ++ S   K PVKL MWDFD
Sbjct: 1   MGKGKNKKRDDGDSKGRQHRGANGHSSRHNHKNMEMRKHENEDTSNVKKIPVKLGMWDFD 60

Query: 58  HCDPKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSW 117
           HCDPKRCSGK+LERLGLIKSL++GQ+FQG+++SPNGK V+ P D +I++EFGA+VVECSW
Sbjct: 61  HCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPEDADIIKEFGAAVVECSW 120

Query: 118 ARLDEVPFNKI----GGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAA 173
           ARLDE+PF+K+    GGK+ERLLPYLVAANQVNYGRPW+LNCVEALAACFAI+GR DWAA
Sbjct: 121 ARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALAACFAIIGRSDWAA 180

Query: 174 ELLSNFSWGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIW 233
           +LLSNFSWG+ FL +NEEL ++Y QCTDS+S+++A+E WL KI++E +ERK QA+++DIW
Sbjct: 181 DLLSNFSWGMNFLTLNEELFELYSQCTDSDSIQEAQEAWLNKIDEEAKERKLQAQDNDIW 240

Query: 234 MMGNTNRNMNGDDDEEEGNSYEALSGDDYEEENNNKSARYDNLGNIIESXXXXXXXXXXX 293
           +MGNTNR  +   D    +  E    +D E+    KS +YDNLGN+IES           
Sbjct: 241 LMGNTNRVNDNLRDLTLSDGDEDEEEEDAEDYLTEKSVKYDNLGNVIES---------SE 291

Query: 294 XRVEVKYDSLGNIIENSDYEQYEEEKELRYDSLGNL 329
             + ++YD+LGN+IE  + E+       RYD+LGNL
Sbjct: 292 DEITLRYDNLGNVIEEEEEEK-------RYDALGNL 320

>NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {ON}
           Anc_6.19 YOR006C
          Length = 401

 Score =  389 bits (1000), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 212/358 (59%), Positives = 259/358 (72%), Gaps = 32/358 (8%)

Query: 1   MAKGKNKQHE--ARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQ------DD------- 45
           M KGKNK  +   +  +  RG+NGHSS+ NHK+MEMKK+    S       DD       
Sbjct: 45  MGKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHS 104

Query: 46  --KFPVKLAMWDFDHCDPKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDRE 103
             K PVKL MWDFDHCDPKRCSGK+LERLGLIKSL++GQ+FQG+++SPNGK V+ P+D +
Sbjct: 105 VKKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDAD 164

Query: 104 IVEEFGASVVECSWARLDEVPFNKI----GGKHERLLPYLVAANQVNYGRPWRLNCVEAL 159
           I++EFGA+VVECSWARLDE+PF+K+    GGK+ERLLPYLVAANQVNYGRPW+LNCVEAL
Sbjct: 165 IIKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEAL 224

Query: 160 AACFAIVGRMDWAAELLSNFSWGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQE 219
           AACFAI+GR DWA++LLSNFSWGL FL++NEEL ++Y +CTDS+SVK A+EEWL KIEQE
Sbjct: 225 AACFAIIGRSDWASDLLSNFSWGLNFLKLNEELFELYSKCTDSDSVKAAQEEWLDKIEQE 284

Query: 220 IQERKTQARESDIWMMGNTN------RNMNGDDDEEEGNSYEALSGDDYEEENNNKSARY 273
             ERK QA+E+DIWMMGNTN      R+MN  D++EE         D  E    NK  RY
Sbjct: 285 ATERKLQAQETDIWMMGNTNRLDANLRSMNISDEDEEEEEEYDEEEDGGEHITRNKELRY 344

Query: 274 DNLGNIIESXXXXXXXXXXXXRVEVKYDSLGN--IIENSDYEQYEEEKELRYDSLGNL 329
           DNLGN+IE               E++YD+LGN    E  + E+ EE  ELRYDSLGN+
Sbjct: 345 DNLGNVIEDTDEEYLSEEEK---EIRYDNLGNIIESEEEEEEEKEEGIELRYDSLGNI 399

>ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR006C
          Length = 313

 Score =  386 bits (991), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 196/327 (59%), Positives = 236/327 (72%), Gaps = 22/327 (6%)

Query: 1   MAKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCD 60
           MAKGKNK+ E R  KP++GS+ H+ K N +  E+K +G   +++ +FP KLAMWDFDHCD
Sbjct: 1   MAKGKNKKTEERQ-KPAKGSSKHNGKSNQRRTELK-HGH--TKETEFPAKLAMWDFDHCD 56

Query: 61  PKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARL 120
           PKRCSGK+LERLGLIKSLR+GQKFQG+VVSPNGK V+CPND+EIVE+ G SVVECSWARL
Sbjct: 57  PKRCSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARL 116

Query: 121 DEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFS 180
           DE+PF+KIGG+HERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGR D A ELLS+FS
Sbjct: 117 DEIPFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFS 176

Query: 181 WGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTNR 240
           WG GFLE+N+ELL+ YQQCTD  S+K AEE WL K+E+E ++R+ Q  E DIWMMGN NR
Sbjct: 177 WGPGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNR 236

Query: 241 ---NMNGDDDEEEGNSYEALSGDDYEEENNNKSARYDNLGNIIESXXXXXXXXXXXXRVE 297
              NM              L  DD     N+ S    ++ + + S            + +
Sbjct: 237 KAPNMRSS----------MLDSDD-----NSDSEYASDVDHDLVSDTEEGEDIAIGSKRD 281

Query: 298 VKYDSLGNIIENSDYEQYEEEKELRYD 324
           V YDSLGN+IEN   E   E K L  D
Sbjct: 282 VTYDSLGNVIENGRREFVPETKILESD 308

>Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii ACR007W
          Length = 349

 Score =  377 bits (968), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 174/240 (72%), Positives = 202/240 (84%), Gaps = 5/240 (2%)

Query: 1   MAKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCD 60
           M KG+NK ++    +  +GSNGHSS+ NH+ +E K    N  Q  KFPV LAMWDFDHCD
Sbjct: 1   MGKGRNKDYDKNHSQ--KGSNGHSSRTNHRRIETKY---NAIQGSKFPVTLAMWDFDHCD 55

Query: 61  PKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARL 120
           PKRCSGK+LERLGLIKSLRV QKFQG+VVSPNGK V+CPNDREI E++G SVVECSWARL
Sbjct: 56  PKRCSGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARL 115

Query: 121 DEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFS 180
           +E+PF KIGG+HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMD A  LLS+FS
Sbjct: 116 EEIPFEKIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFS 175

Query: 181 WGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTNR 240
           WGLGFLE+N+E+L+IYQ+CTD +S+K AEE WL +IE E  ER+ Q +E+DIWMMGN NR
Sbjct: 176 WGLGFLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNR 235

>KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} similar
           to uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 346

 Score =  367 bits (943), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 196/323 (60%), Positives = 239/323 (73%), Gaps = 23/323 (7%)

Query: 2   AKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCDP 61
            KG NKQ  A + KPS   +GH+S   H+H+E  K+G N S  + FPVKLAMWDFD CDP
Sbjct: 7   GKGSNKQRGAHSSKPS---SGHTS--THRHVE-SKHGANKSGKN-FPVKLAMWDFDQCDP 59

Query: 62  KRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARLD 121
           KRCSGK+LERLG+IKSLRVGQKFQG+VVSPNGK V+CPNDR IVEE GA+VVECSWARLD
Sbjct: 60  KRCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLD 119

Query: 122 EVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFSW 181
           EVPFNKIGG++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR+D A ELLS+FSW
Sbjct: 120 EVPFNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSW 179

Query: 182 GLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTNRN 241
           GL FLE+N+ELL++YQ+CTD++S+KKAE+ WL +IE+E QERK +    D+W+ GN N +
Sbjct: 180 GLQFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVN-H 238

Query: 242 MNGDDDEEEGNSYEALSGDDYEEENNNKSARYDNLGNIIESXXXXXXXXXXXXRVEVKYD 301
             G    +  N  EA  G  +E+  N++    ++  +  E+               VKYD
Sbjct: 239 KKGHGVTQNENKDEAEVGSTWEQGENSEYESDESAADGEEAYHG-----------PVKYD 287

Query: 302 SLGNII---ENSDYEQYEEEKEL 321
           SLGN I   E+SD E Y + +EL
Sbjct: 288 SLGNEITLSESSDPE-YSDSEEL 309

>Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {ON}
           YOR006C - Hypothetical ORF [contig 185] FULL
          Length = 337

 Score =  365 bits (937), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 185/316 (58%), Positives = 230/316 (72%), Gaps = 22/316 (6%)

Query: 12  RTGKPSRGSN----GHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCDPKRCSGK 67
           + G+ ++GSN    GHS++ +  ++E K    N  ++  FPVKLAMWDFD CDPKRCSGK
Sbjct: 3   KGGRSNKGSNKVRTGHSNRSSSGYVETKHGAHNNGRN--FPVKLAMWDFDQCDPKRCSGK 60

Query: 68  RLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARLDEVPFNK 127
           +LERLG+IKSLRVGQKFQG+VVSPNGKGV+CPND++IVEE GA+VVECSWARL+E+PFNK
Sbjct: 61  KLERLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNK 120

Query: 128 IGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFSWGLGFLE 187
           IGG++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMD A ELL++FSWGLGFLE
Sbjct: 121 IGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLE 180

Query: 188 INEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTNRNMNGDDD 247
           +N+EL+++YQ+CTD+ESVK+AE  WL KIE+E  ER+  +   D+WM GN NR     +D
Sbjct: 181 LNKELIEVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNRRSPLGND 240

Query: 248 E-----------EEGNSYEALSGDDYEEENNNKSARYDNLGNII-----ESXXXXXXXXX 291
                       + G+  +  + DDY   N  +  +YDNLGN I                
Sbjct: 241 TESSQEESENSVDTGDEEDDDNEDDYATGNRKRVVKYDNLGNEIYPSESSESSEERDDLD 300

Query: 292 XXXRVEVKYDSLGNII 307
               V+ K+DSLGNII
Sbjct: 301 EQEEVKYKFDSLGNII 316

>TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {ON}
           Anc_6.19 YOR006C
          Length = 304

 Score =  337 bits (864), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 181/332 (54%), Positives = 225/332 (67%), Gaps = 35/332 (10%)

Query: 1   MAKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCD 60
           MAKGKNK HE R+ + S  S  + SK     + +K    N      FPVKLAMWDFDHCD
Sbjct: 1   MAKGKNKGHEERSNRKSNNSRRNESK---HSLSIKSTKTN------FPVKLAMWDFDHCD 51

Query: 61  PKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARL 120
           PKRCSGK+LER GL +SLRVGQ+F G+VVSPNGK V+ P DRE +E++G +VVECSWARL
Sbjct: 52  PKRCSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETIEQYGIAVVECSWARL 111

Query: 121 DEVPFNKIGGK--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSN 178
           DEVPFNK+GGK  +E LLPYLVAAN VNYGRPWRLNCVEA AAC AIVG  ++A+++L  
Sbjct: 112 DEVPFNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAACLAIVGFKEYASKVLEG 171

Query: 179 FSWGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNT 238
           FSWG  FLE+N+ELL IY  CTDS SV+KA++EWL KIE E +ERK +   +D W++GNT
Sbjct: 172 FSWGHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELENKERKEKMNSADAWLIGNT 231

Query: 239 NR-NMNGDDDEEEGNSYEALSGDDYEEENNNKSARYDNLGNIIESXXXXXXXXXXXXRVE 297
           NR N+N  D+  E       S +D     ++   RYD LGN+I +               
Sbjct: 232 NRKNLNDFDNSSE-------STEDNISTVSSADERYDALGNLISNDSH-----------S 273

Query: 298 VKYDSLGNIIENSDYEQYEEEKELRYDSLGNL 329
           +KYDSLGN+IE+       +    +YD LGN+
Sbjct: 274 LKYDSLGNVIESEG-----DALPPKYDKLGNI 300

>KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}
           Anc_6.19 YOR006C
          Length = 329

 Score =  335 bits (860), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 179/324 (55%), Positives = 233/324 (71%), Gaps = 35/324 (10%)

Query: 14  GKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCDPKRCSGKRLERLG 73
           G     SNGH S+ N+K ME K++   +S++  FPVKLAMWDFDHCDPKRCSGK+LERL 
Sbjct: 17  GAIRTNSNGHHSRHNNKKMEFKQH---VSRETSFPVKLAMWDFDHCDPKRCSGKKLERLN 73

Query: 74  LIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARLDEVPFNKIGG-KH 132
           LI+SL++ QKFQG+ VSPNGK  + P DRE+V EFG +VVECSWAR+DE+PF+K    K 
Sbjct: 74  LIRSLKINQKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKL 133

Query: 133 ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFSWGLGFLEINEEL 192
           +RLLPYLVAANQVNYGRPW+LNCVEA+AAC AIVG MD A ELLS+FSWG+ FL++N EL
Sbjct: 134 DRLLPYLVAANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNREL 193

Query: 193 LKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQ--ARESDIWMMGNTNRNMNGDDDEEE 250
           L+IYQQCTDS+ ++ A++ W+ +IE+E+QERK    A+  DIWM GN NR          
Sbjct: 194 LEIYQQCTDSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNR---------- 243

Query: 251 GNSYEALSGDDYEEENNNKSARYDNLGNIIESXXXXXXXXXXXXRVEVKYDSLGNII--- 307
               +    D+ +E++ ++   YDNLGNIIE+              EV+YD+LGNII   
Sbjct: 244 ---IDESDEDNEDEDSEDEEVTYDNLGNIIENEPR-----------EVRYDNLGNIIEES 289

Query: 308 --ENSDYEQYEEEKELRYDSLGNL 329
             E+S  E+ +EE++++YDSLGN+
Sbjct: 290 SEESSGEEEEDEEEDVKYDSLGNV 313

>Ecym_6454 Chr6 complement(880101..883301) [3201 bp, 1066 aa] {ON}
           similar to Ashbya gossypii ABL171W
          Length = 1066

 Score = 33.5 bits (75), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 42/79 (53%), Gaps = 5/79 (6%)

Query: 146 NYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFSWGLGFLEINEELLKIY--QQCTDSE 203
           N+G P+    + +L  CF I+      +E++ NFS  L   ++ + L+     Q C D  
Sbjct: 265 NFGIPYLCGILLSLVVCF-IIDPHGGHSEIMQNFSSTLD--DVKQLLIAFVDKQHCNDLA 321

Query: 204 SVKKAEEEWLAKIEQEIQE 222
           +++KA+++ +  I+ ++ E
Sbjct: 322 TLQKAQQDVIKSIDMKLSE 340

>NDAI0F00850 Chr6 (204487..206478) [1992 bp, 663 aa] {ON} 
          Length = 663

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 26/46 (56%)

Query: 153 LNCVEALAACFAIVGRMDWAAELLSNFSWGLGFLEINEELLKIYQQ 198
           +NCV ALA CF +V R + + E+  + +  +  L++N+   K   +
Sbjct: 519 INCVLALALCFTVVSRGNSSFEVSYDNAGDVSLLKVNQPYCKFLSR 564

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.132    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,337,322
Number of extensions: 1797488
Number of successful extensions: 12313
Number of sequences better than 10.0: 197
Number of HSP's gapped: 12430
Number of HSP's successfully gapped: 215
Length of query: 366
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 255
Effective length of database: 40,753,473
Effective search space: 10392135615
Effective search space used: 10392135615
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 66 (30.0 bits)