Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1037.236.28ON37837819340.0
NCAS0D021406.28ON37638012571e-173
ZYRO0C07546g6.28ON37737912401e-170
TPHA0J003906.28ON38037912141e-166
YOL003C (PFA4)6.28ON37837912021e-165
TDEL0G044106.28ON38137911961e-164
Suva_15.1726.28ON39837911961e-163
CAGL0E02497g6.28ON37637911891e-163
Skud_15.1596.28ON37938011721e-160
NDAI0C026506.28ON38939111681e-159
Ecym_30326.28ON37737911541e-157
Smik_15.1676.28ON37837911481e-156
SAKL0E01518g6.28ON37937911071e-150
KLTH0C10978g6.28ON37737810791e-146
Kwal_56.224596.28ON38338110441e-140
ACL003C6.28ON37537810351e-139
KNAG0F029306.28ON38638610241e-137
KLLA0C06204g6.28ON37737910101e-135
KAFR0A051306.28ON3964019261e-122
TBLA0B004806.28ON3774115172e-61
NCAS0E013003.12ON3272132264e-20
KAFR0A085903.12ON3311312186e-19
NDAI0G013403.12ON3351472142e-18
CAGL0D02508g3.12ON3321412132e-18
Kwal_55.221263.12ON3601302081e-17
TPHA0P015603.12ON3311432072e-17
Kpol_1014.293.12ON3261512053e-17
KNAG0K025703.12ON3281302001e-16
KLTH0F19580g3.12ON3421332001e-16
SAKL0C13596g3.12ON333711956e-16
TBLA0H001503.12ON3451431948e-16
Smik_14.63.12ON3341281921e-15
Suva_14.153.12ON3301281894e-15
TDEL0A003103.12ON329611894e-15
ZYRO0C03410g3.12ON3272161884e-15
KLLA0E02069g3.12ON325641885e-15
Skud_14.153.12ON3361981861e-14
YNL326C (PFA3)3.12ON3361281851e-14
ZYRO0C04092g8.389ON366781842e-14
KNAG0A027108.389ON354891832e-14
NCAS0C029208.389ON374601824e-14
Skud_12.3218.389ON356601806e-14
Ecym_20143.12ON3391231798e-14
TPHA0C023608.389ON4041211809e-14
KLTH0G13112g8.286ON3492581772e-13
NCAS0B035908.286ON329751762e-13
ADL197C3.12ON390731772e-13
TDEL0F051308.389ON359741753e-13
TBLA0D040408.286ON3291401744e-13
Smik_12.3068.389ON359601744e-13
SAKL0H13860g8.389ON352831735e-13
KLTH0F08668g8.389ON358571728e-13
YLR246W (ERF2)8.389ON359601711e-12
Skud_4.3878.286ON3361071691e-12
TBLA0H009208.389ON360771692e-12
Suva_10.3428.389ON356601683e-12
SAKL0H16434g8.286ON555921693e-12
KAFR0B053708.286ON329721663e-12
Ecym_41788.389ON368601664e-12
AGL125C8.389ON367611665e-12
KAFR0H019808.389ON361601665e-12
TDEL0F041308.286ON3281531655e-12
NDAI0G022508.389ON389771665e-12
TPHA0C010708.286ON333711646e-12
NDAI0J010008.286ON3391151611e-11
KLLA0D18370g8.389ON355881612e-11
CAGL0G08217g8.389ON326601583e-11
CAGL0B01991g8.286ON3301051583e-11
ZYRO0D06600g8.286ON330571583e-11
Kwal_23.33028.389ON353491567e-11
Suva_2.2898.286ON335651558e-11
YDR126W (SWF1)8.286ON336571504e-10
Kpol_1033.168.286ON3211401504e-10
Kwal_56.236978.286ON3381151504e-10
KLLA0F19690g8.286ON324571487e-10
Ecym_42828.286ON3401551479e-10
Smik_4.3728.286ON335571461e-09
TBLA0E028305.579ON3861231417e-09
Kpol_1004.575.579ON3621711408e-09
KNAG0H031108.286ON3311071399e-09
AGR065W8.286ON326441372e-08
Kwal_47.183665.579ON356941344e-08
KAFR0I011105.579ON3701311292e-07
ZYRO0D13860g5.579ON3651511264e-07
KLTH0G04972g5.579ON3671301265e-07
NCAS0F013905.579ON374851212e-06
KNAG0C028305.579ON354741193e-06
Ecym_41145.579ON3721201193e-06
TDEL0A044405.579ON365841167e-06
Smik_4.7375.579ON3781241159e-06
SAKL0G06160g5.579ON364661151e-05
TBLA0J008305.626ON7391041142e-05
NDAI0H018905.579ON406661132e-05
CAGL0K06347g5.579ON3521081113e-05
YDR459C (PFA5)5.579ON3741071113e-05
Skud_4.7345.579ON380491104e-05
KLLA0D06149g5.579ON3491171061e-04
NCAS0C052805.626ON757671062e-04
Kpol_526.325.626ON7771741043e-04
Suva_2.6345.579ON388491024e-04
Suva_2.4325.626ON763511035e-04
NDAI0H008505.626ON78654990.001
KNAG0B031405.626ON68286980.002
Skud_4.5275.626ON76451960.003
ABR203W5.579ON35985940.004
TPHA0C003705.626ON75952940.004
Smik_4.5155.626ON76451940.005
YDR264C (AKR1)5.626ON76451940.005
ZYRO0C11132g5.626ON75954940.006
KNAG0C062305.626ON752103920.008
KLTH0E02420g5.626ON73455900.015
CAGL0M08712g5.626ON76389890.018
Suva_8.875.626ON73053890.019
YOR034C (AKR2)5.626ON74965890.022
TDEL0A049205.626ON75057880.026
KAFR0H005705.626ON75754870.035
Smik_15.2135.626ON744118870.037
SAKL0G07326g5.626ON73765860.046
AER388C5.626ON72450820.13
Skud_15.1995.626ON74171800.23
Ecym_13305.626ON73954741.2
AFR738Cna 1ON81260731.6
KLLA0E16721g5.626ON75256695.5
CAGL0D03322g5.197ON54562686.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1037.23
         (378 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {O...   749   0.0  
NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {O...   488   e-173
ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {...   482   e-170
TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28...   472   e-166
YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON} ...   467   e-165
TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {O...   465   e-164
Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {...   465   e-163
CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {...   462   e-163
Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {...   456   e-160
NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28     454   e-159
Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to ...   449   e-157
Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {...   446   e-156
SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} simila...   431   e-150
KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {...   420   e-146
Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003...   406   e-140
ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON} S...   403   e-139
KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {O...   399   e-137
KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {...   393   e-135
KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa] ...   361   e-122
TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28 ...   203   2e-61
NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON...    92   4e-20
KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3....    89   6e-19
NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12      87   2e-18
CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar...    87   2e-18
Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL3...    85   1e-17
TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.1...    84   2e-17
Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON} (48992.....    84   3e-17
KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.1...    82   1e-16
KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} simi...    82   1e-16
SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} simi...    80   6e-16
TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}...    79   8e-16
Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON} ...    79   1e-15
Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON} ...    77   4e-15
TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON} ...    77   4e-15
ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar...    77   4e-15
KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {O...    77   5e-15
Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}...    76   1e-14
YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}  P...    76   1e-14
ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {...    75   2e-14
KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.3...    75   2e-14
NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389     75   4e-14
Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246...    74   6e-14
Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON} s...    74   8e-14
TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.3...    74   9e-14
KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]...    73   2e-13
NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON}      72   2e-13
ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON} S...    73   2e-13
TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {O...    72   3e-13
TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {...    72   4e-13
Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246...    72   4e-13
SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} simi...    71   5e-13
KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} simila...    71   8e-13
YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subun...    70   1e-12
Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W ...    70   1e-12
TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.3...    70   2e-12
Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246...    69   3e-12
SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]...    70   3e-12
KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {...    69   3e-12
Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar t...    69   4e-12
AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON} S...    69   5e-12
KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.3...    69   5e-12
TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.28...    68   5e-12
NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389     69   5e-12
TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {O...    68   6e-12
NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8....    67   1e-11
KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]...    67   2e-11
CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {O...    65   3e-11
CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar...    65   3e-11
ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {O...    65   3e-11
Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W...    65   7e-11
Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W ...    64   8e-11
YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}  SWF1Palmit...    62   4e-10
Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON} (35544.....    62   4e-10
Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {...    62   4e-10
KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} simil...    62   7e-10
Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}...    61   9e-10
Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W ...    61   1e-09
TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.5...    59   7e-09
Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa] ...    59   8e-09
KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON...    58   9e-09
AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic hom...    57   2e-08
Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459...    56   4e-08
KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.5...    54   2e-07
ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]...    53   4e-07
KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {...    53   5e-07
NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {O...    51   2e-06
KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {O...    50   3e-06
Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}...    50   3e-06
TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {O...    49   7e-06
Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {...    49   9e-06
SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {...    49   1e-05
TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {...    49   2e-05
NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {O...    48   2e-05
CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa] ...    47   3e-05
YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}...    47   3e-05
Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {...    47   4e-05
KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} simila...    45   1e-04
NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa] ...    45   2e-04
Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}...    45   3e-04
Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {...    44   4e-04
Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON...    44   5e-04
NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.6...    43   0.001
KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.6...    42   0.002
Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON...    42   0.003
ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic ho...    41   0.004
TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626...    41   0.004
Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON...    41   0.005
YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}  ...    41   0.005
ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {...    41   0.006
KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa] ...    40   0.008
KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {...    39   0.015
CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} simil...    39   0.018
Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}...    39   0.019
YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON} ...    39   0.022
TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {O...    39   0.026
KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.6...    38   0.035
Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {...    38   0.037
SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {...    38   0.046
AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}...    36   0.13 
Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {...    35   0.23 
Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar t...    33   1.2  
AFR738C Chr6 complement(1793162..1795600) [2439 bp, 812 aa] {ON}...    33   1.6  
KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} simi...    31   5.5  
CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {...    31   6.9  

>Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {ON}
           complement(51397..52533) [1137 nt, 379 aa]
          Length = 378

 Score =  749 bits (1934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/378 (96%), Positives = 364/378 (96%)

Query: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60
           MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT
Sbjct: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60

Query: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120
           NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF
Sbjct: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120

Query: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180
           PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT
Sbjct: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180

Query: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK 240
           ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK
Sbjct: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK 240

Query: 241 AEKIVSKRIRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYSLFE 300
           AEKIVSKRIRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYSLFE
Sbjct: 241 AEKIVSKRIRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYSLFE 300

Query: 301 EDSILEDQILSLPWPPDGGKHGFXXXXXXXXXXXXXXKDGEHVIRKRSPVSKLLESRTQW 360
           EDSILEDQILSLPWPPDGGKHGF              KDGEHVIRKRSPVSKLLESRTQW
Sbjct: 301 EDSILEDQILSLPWPPDGGKHGFNIENSSTNSIETSTKDGEHVIRKRSPVSKLLESRTQW 360

Query: 361 YNDWGENLEDFGVDIDVE 378
           YNDWGENLEDFGVDIDVE
Sbjct: 361 YNDWGENLEDFGVDIDVE 378

>NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {ON}
           Anc_6.28
          Length = 376

 Score =  488 bits (1257), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 225/380 (59%), Positives = 288/380 (75%), Gaps = 6/380 (1%)

Query: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60
           MPVKLKYPWMG+ IPC L SFI Y+AH F+L NF+S   Q+WF+ S+TM+WISY LAI+T
Sbjct: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60

Query: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120
           NPG+P  ++ P   +W ++CKKC  +KPER HHCKTC QCVLMMDHHCPWTMNCVG+KNF
Sbjct: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120

Query: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180
           PHFLRFLFWV+VTT +LLY L+ R ++LW  ++LPSYLF K+EI FL I  PMDGFVL+T
Sbjct: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180

Query: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK 240
           ++LLFIRC  NQ++ G+TQIE+WE ERLE+L+Y ++L PQL+ NLWE +P  KTP+N+  
Sbjct: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVL 240

Query: 241 AEKIV--SKRIRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYSL 298
           A+K+    +++RF+ +V+FPYDL + +N  TVLGSPV WLW +G P  DGM FKKNE +L
Sbjct: 241 AKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELAL 300

Query: 299 FEEDSILEDQILSLPWPPDGGKHGFXXXXXXXXXXXXXXKDGEHVIRKRSPVSKLLESRT 358
           +EE + +ED +LSLPWPPDGG++                ++GE VIR+R+        R 
Sbjct: 301 YEEGAAIEDLLLSLPWPPDGGRN---FIQQKGTNVESITENGEQVIRQRN-FENDNSYRK 356

Query: 359 QWYNDWGENLEDFGVDIDVE 378
            W NDWGENLEDFGVD+DVE
Sbjct: 357 TWNNDWGENLEDFGVDVDVE 376

>ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  482 bits (1240), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 237/379 (62%), Positives = 279/379 (73%), Gaps = 3/379 (0%)

Query: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60
           MPV+LK+P++GIAIPCFLISFI Y AHYFIL NFLS  KQIWFE S+TMIW SYYLAIYT
Sbjct: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60

Query: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120
            PG+P  N+ P  N WK+YCKKC  YKPER HHCKTC QCVL MDHHCPWT NCVGY NF
Sbjct: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120

Query: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180
           PHF+RFLFWVI TT YLLY L  R  F+  + N P+YL+NKSE+IFLTI  PMDGF+LLT
Sbjct: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180

Query: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK 240
           IS+LFIRC  NQ+  GRTQIETWE ERLE L+Y +RL P L++N WE +PEL+T + E +
Sbjct: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240

Query: 241 AEKIVS-KRIRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYSLF 299
           A ++ + +RI  D LV+FPYD+   +N    LGSP+ WLW +G+P GDGM F KN+ S F
Sbjct: 241 ASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISEF 300

Query: 300 EEDSILEDQILSLPWPPDGGKHGFXXXXXXXXXXXXXXKDGEHVIRKRSPVSKLLESRTQ 359
           EE + L D +L+LPWPPDGGK                 +DGE VIRKR    +   SRTQ
Sbjct: 301 EETN-LTDMLLALPWPPDGGKDK-VISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRTQ 358

Query: 360 WYNDWGENLEDFGVDIDVE 378
           W N WGENLEDFGVD+D E
Sbjct: 359 WQNTWGENLEDFGVDVDAE 377

>TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28
           YOL003C
          Length = 380

 Score =  472 bits (1214), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 219/379 (57%), Positives = 292/379 (77%), Gaps = 1/379 (0%)

Query: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60
           MPVK K+PWMGIAIPC LISFI Y +HY+IL   LS+ KQ +FE S+TMIW+SYY+AI  
Sbjct: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60

Query: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120
           NPGKPG N+ P  ++W+N+CKKCN YKPER+HHCKTC QCVLMMDHHCPWTMNC+G+ NF
Sbjct: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120

Query: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180
           PHF+RFL W++ TT +LL++ I RI+++W +RNLPSYLF +SE+I L + TP++ F+LLT
Sbjct: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPLNLFILLT 180

Query: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK 240
           I+LLF RC  NQ+++G+TQIE WE +RLE+ FYL++L PQLI NLWE +PELK+  ++ +
Sbjct: 181 ITLLFCRCLFNQIINGKTQIEDWEMDRLENRFYLKKLLPQLILNLWELYPELKSAKHDEE 240

Query: 241 AEKIVSKR-IRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYSLF 299
           AE+++ K+ IR+D +V+FPYDLG+  NIT ++G P+ WLW +G PSG+GM F+KNE +LF
Sbjct: 241 AERLIEKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIALF 300

Query: 300 EEDSILEDQILSLPWPPDGGKHGFXXXXXXXXXXXXXXKDGEHVIRKRSPVSKLLESRTQ 359
           + DS L    L+LPWPPD G+H                 DGE V+R R+     + SR +
Sbjct: 301 DPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSNVEFITTDGEQVVRNRTHAKNPILSREE 360

Query: 360 WYNDWGENLEDFGVDIDVE 378
           W+N+WGENLEDFGVD+++E
Sbjct: 361 WFNEWGENLEDFGVDVEME 379

>YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON}
           PFA4Palmitoyltransferase with autoacylation activity,
           required for palmitoylation of amino acid permeases
           containing a C-terminal Phe-Trp-Cys site; required for
           modification of Chs3p; member of the DHHC family of
           putative palmitoyltransferases
          Length = 378

 Score =  467 bits (1202), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 224/379 (59%), Positives = 277/379 (73%), Gaps = 2/379 (0%)

Query: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60
           MPVKL++PW+GIAIP FLISFI Y AHYFIL NFLS+ KQI FE  ++MIW+SYYLAI T
Sbjct: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60

Query: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120
           NPG+P  NY PP + W+N+CKKC +YKPER+HHCKTC QCVLMMDHHCPWTMNCVG+ N+
Sbjct: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120

Query: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180
           PHFLRFLFW+IVTT+ L      RI F+W+ R+LP Y F KSE+IFLTI++P++ FVLLT
Sbjct: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180

Query: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK 240
           I++LF+RC  NQ+L+GR+QIE+W+ +RLESLF   RL  +LI N W  +PE ++  N+  
Sbjct: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240

Query: 241 AEK-IVSKRIRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYSLF 299
           AE+ +  KR RFD LV+FPYD  L  N    LG    WLW YG P+GDG  F KN  S +
Sbjct: 241 AEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKY 300

Query: 300 EEDSILEDQILSLPWPPDGGKHGFXXXXXXXXXXXXXXKDGEHVIRKRSPVSKLLESRTQ 359
           E +S LED ILSLPWPPDGGK                 + GE +IR R P +    SR +
Sbjct: 301 EANSSLEDHILSLPWPPDGGKTN-TVFNHGSSTIEMRNESGEQLIRTRLPQNGRHASREK 359

Query: 360 WYNDWGENLEDFGVDIDVE 378
           WYNDWGE+L+DFGVD+D+E
Sbjct: 360 WYNDWGESLDDFGVDVDME 378

>TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {ON}
           Anc_6.28 YOL003C
          Length = 381

 Score =  465 bits (1196), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 217/379 (57%), Positives = 273/379 (72%), Gaps = 2/379 (0%)

Query: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60
           MPVKLK+PW+GIAIPC L+SFI Y  H+FIL NFLS  KQ+WF+ ++ +IW+SYY AIYT
Sbjct: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60

Query: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120
           NPG+P  N+  P  +WKNYCKKC  YKPER HHCKTC QCVLMMDHHCPWTMNCVG+ NF
Sbjct: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120

Query: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180
           PHFLRFL WVIV T +LLY L+SRI+ LW+ RNLP Y+F++SE++FLTI TP+D FVLLT
Sbjct: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVLLT 180

Query: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK 240
           I++L  RC  NQ+ +G +QIETWE ERL++LF  +RL P LI   W+  P  +   NE+ 
Sbjct: 181 ITILLCRCLANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINEST 240

Query: 241 AEKI-VSKRIRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYSLF 299
           A ++ ++K +R + +V+FPYDL   +N   +LG+P+ WLW +G P GDGM F KNE S +
Sbjct: 241 AAELSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNEISEY 300

Query: 300 EEDSILEDQILSLPWPPDGGKHGFXXXXXXXXXXXXXXKDGEHVIRKRSPVSKLLESRTQ 359
              +  ED +LSLPWPPDGG+                 K GE +IR+R   +  L  R Q
Sbjct: 301 SSRASYEDLLLSLPWPPDGGRTR-AGPGSLSSSIESITKQGEQLIRRRPNDTSDLIGRRQ 359

Query: 360 WYNDWGENLEDFGVDIDVE 378
           W NDWGENLEDFGVD+D E
Sbjct: 360 WQNDWGENLEDFGVDVDTE 378

>Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {ON}
           YOL003C (REAL)
          Length = 398

 Score =  465 bits (1196), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 220/379 (58%), Positives = 278/379 (73%), Gaps = 2/379 (0%)

Query: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60
           M VKLK+PW+GIAIP FLISFI Y AHYFIL NFLS+ KQI FE S++MIW+SYYLAIYT
Sbjct: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80

Query: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120
           NPGKP   Y P  N W NYCKKC  YKPER+HHCK C QCVLMMDHHCPWTMNCVG+KN+
Sbjct: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNY 140

Query: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180
           PHFLRF+FWVI TT +L    + R+ F+W+ R+LP YLF KSE++FLTI TP++ FVLLT
Sbjct: 141 PHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPLNFFVLLT 200

Query: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK 240
           I +LF+RC  NQ+++GR+QIE+W+ +RLESLF  +RL  +LI N W  +PE ++P  E  
Sbjct: 201 IVILFLRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARSPQLERD 260

Query: 241 AEKIVSK-RIRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYSLF 299
           AEK++++ +IRF+ +V+FPY++ L  N T  LG    WLW  G P+GDG  F+KN+ S +
Sbjct: 261 AEKLLTQHKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKNDISKY 320

Query: 300 EEDSILEDQILSLPWPPDGGKHGFXXXXXXXXXXXXXXKDGEHVIRKRSPVSKLLESRTQ 359
           E +S LED +LSLPWPPDGGK                 + GE V+R R        +R +
Sbjct: 321 EVNSSLEDIMLSLPWPPDGGKIK-TASNHSNLAIETCNEGGEQVVRSRIAQHGRSATREK 379

Query: 360 WYNDWGENLEDFGVDIDVE 378
           WYNDWGE+L+DFGVD+D+E
Sbjct: 380 WYNDWGESLDDFGVDVDME 398

>CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003c
          Length = 376

 Score =  462 bits (1189), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 223/379 (58%), Positives = 278/379 (73%), Gaps = 4/379 (1%)

Query: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60
           MPVKLK+PW+GIAIP FLI+ I Y AHYFILLNFLS+ KQ+W++   TMIW+SYYLAIYT
Sbjct: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60

Query: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120
            PGKP +N+ P  N+WK YCKKC  YKPER+HHCKTC QCVLMMDHHCPWTMNCVGY NF
Sbjct: 61  PPGKPPTNFKPSKNEWKVYCKKCKCYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120

Query: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180
           PHF+RFLFWVIV TT L  FL +RI  +W  R+ PSYL+ KSE+IFLTI TP++ F+LLT
Sbjct: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180

Query: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK 240
           IS+L IRC  NQ+ +GR+QIE+WE +RLE+L  + +L P LI N+W   P L+    E++
Sbjct: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ 240

Query: 241 AEKIVS-KRIRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYSLF 299
           AE +++ KR+  D LV+FPYDLG   N   +LG+P  WL+ +  P  DG+ F+KNE S+ 
Sbjct: 241 AEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESMI 300

Query: 300 EEDSILEDQILSLPWPPDGGKHGFXXXXXXXXXXXXXXKDGEHVIRKRSPVSKLLESRTQ 359
           E+ + L D IL LPWPPD  KH                ++GE VIR R+P  KL  SR++
Sbjct: 301 EDPNSLNDIILCLPWPPDSTKH-LNSTSEHTSNVQIISEEGEQVIRIRTPEKKL--SRSE 357

Query: 360 WYNDWGENLEDFGVDIDVE 378
           W NDWGE+LEDFGVD+DVE
Sbjct: 358 WLNDWGESLEDFGVDVDVE 376

>Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {ON}
           YOL003C (REAL)
          Length = 379

 Score =  456 bits (1172), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 218/380 (57%), Positives = 275/380 (72%), Gaps = 3/380 (0%)

Query: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60
           M VKLK+PW+GIAIP FLISFI Y AHYFIL NFLSI KQ+ FE+S++MIW+SYYLAIYT
Sbjct: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60

Query: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120
           N G+P  NY P    W N+CKKC +YKPER+HHCK C QCVLMMDHHCPWTMNCVG++N+
Sbjct: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120

Query: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180
           PHFLRFLFWVIVTT+ L    + RI F+W+ R+LP YLF KSE+IFLTI +P+D FVLLT
Sbjct: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180

Query: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK 240
           I++LF+RC  NQ+++GR+QIE+W+ +RLESL    +L P+LI N W  +PE ++  +E  
Sbjct: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD 240

Query: 241 AEKIVSK--RIRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYSL 298
           A+K++++  R RFD LVSFPY+     N    LG    WLW YG P+GDG  F KN+ S 
Sbjct: 241 ADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDISQ 300

Query: 299 FEEDSILEDQILSLPWPPDGGKHGFXXXXXXXXXXXXXXKDGEHVIRKRSPVSKLLESRT 358
           +E +S LED ILSLPWPPDG K                 + GE ++R R+        R 
Sbjct: 301 YEVNSPLEDIILSLPWPPDGNKTK-AVSNHNNSTIETYNEGGEQIVRSRNAQHGSDAIRE 359

Query: 359 QWYNDWGENLEDFGVDIDVE 378
           +WYNDWGE+L+DFGVD+D+E
Sbjct: 360 KWYNDWGESLDDFGVDVDME 379

>NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28
          Length = 389

 Score =  454 bits (1168), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 218/391 (55%), Positives = 283/391 (72%), Gaps = 17/391 (4%)

Query: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60
           M +KLKYPW+G+AIP F+ISFI Y +HYFIL NFLSI KQIWF+ S++MIW+SY LAI+T
Sbjct: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60

Query: 61  NPGKPGSNYIP----PSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVG 116
           NPGKP  N  P       +W  +CKKCN YKPER+HHCKTC QCVLMMDHHCPWTMNCVG
Sbjct: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120

Query: 117 YKNFPHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGF 176
           YKNFPHF+RFL W+I+TT +LL  L+ R + +W  R+LPSY+F+++EIIFLTI  PMD F
Sbjct: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180

Query: 177 VLLTISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPD 236
           +LLTISLLFIRC  NQ++ G TQIE WE ERLE+LFY ++L P +I+ LWE +P  +T  
Sbjct: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240

Query: 237 NEAKAEKIVSKR--IRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKN 294
            +  A+ ++S+R  +RF+ +V+FPYD+ +  N+ TV+GS   W+W +G P  +G+ F+KN
Sbjct: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300

Query: 295 EYSLFEEDSILEDQILSLPWPPDGGKHGFXXXXXXXXXXXXXXKDGEHVIRKR------- 347
           E SL+E  S +ED +LSLPWPPD G++                 DGE V+R R       
Sbjct: 301 EISLYEPGSSVEDLLLSLPWPPDKGRNFISNKDTSVESLVY---DGEQVVRNRASNDTNI 357

Query: 348 SPVSKLLESRTQWYNDWGENLEDFGVDIDVE 378
           S ++K + SR +W NDWGE+L DFGVDI+ E
Sbjct: 358 STINKDI-SREEWNNDWGESLVDFGVDIEAE 387

>Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to
           Ashbya gossypii ACL003C
          Length = 377

 Score =  449 bits (1154), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 216/379 (56%), Positives = 275/379 (72%), Gaps = 4/379 (1%)

Query: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60
           MPVKLK+PW+GIAIPCFLI+FI Y+A  F+L  FLS+ +QIWF+ S+TMIW+SYY AIYT
Sbjct: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60

Query: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120
           NPG P   + P  ++WKNYCKKC  +KPERTHHCKTC QCVL+MDHHCP+TMNCVGY NF
Sbjct: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120

Query: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180
           PHF+RFLFW+I TTTYL      R  F+W  R+  + L  K EIIFLTI TP + FVLLT
Sbjct: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180

Query: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK 240
           IS+LF RC  NQ+L+G TQIE WE +R+ES+FY RRL PQL+SNL E +P      ++ +
Sbjct: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPN-SLDGHKGE 239

Query: 241 AEKIVSKR-IRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYSLF 299
            ++I++ R I F+ LV+FPYD     N+   +G  +TWL  +G+P+G+GM+F+KNE S +
Sbjct: 240 IDRILNNRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSAY 299

Query: 300 EEDSILEDQILSLPWPPDGGKHGFXXXXXXXXXXXXXXKDGEHVIRKRSPVSKLLESRTQ 359
           E  S L D++LSLPWPPDG +                 ++GEH+IRKRSP  +L  SRT+
Sbjct: 300 EHGSTLTDKLLSLPWPPDGERA--PNSSNSRLKVESSTRNGEHIIRKRSPEPRLNLSRTE 357

Query: 360 WYNDWGENLEDFGVDIDVE 378
           WYNDWGENL  FGVD+D +
Sbjct: 358 WYNDWGENLAHFGVDVDAD 376

>Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {ON}
           YOL003C (REAL)
          Length = 378

 Score =  446 bits (1148), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 217/379 (57%), Positives = 270/379 (71%), Gaps = 2/379 (0%)

Query: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60
           M VKL++PW+GIAIP  LISFI Y AHYFIL NFL I KQI FE S++MIW SYYLAIYT
Sbjct: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60

Query: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120
           NPG+P  NY P    W N+CKKC  YKPER+HHCKTC QCVLMMDHHCPWTMNCVG+ N+
Sbjct: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120

Query: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180
           PHFLRFLFW+I+TT+ L    + RI F+W+ RN P YLF KSE+ FLTI +P++ FVLLT
Sbjct: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPLNFFVLLT 180

Query: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK 240
           I++LF+RC  NQ+++GR+QIE+W+ +RLESLF  RRL  +LI N W  +PE KT  +E  
Sbjct: 181 ITVLFLRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQHERD 240

Query: 241 AEKIV-SKRIRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYSLF 299
           AE ++  +R  F+ LV+FPY+  L  N    LG    WLW YG P+G+G  F KN+ S +
Sbjct: 241 AEGLLKQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISNY 300

Query: 300 EEDSILEDQILSLPWPPDGGKHGFXXXXXXXXXXXXXXKDGEHVIRKRSPVSKLLESRTQ 359
           E DS LED ILSLPWPPDGG+                 + GE V+R R   +    SR +
Sbjct: 301 EVDSPLEDIILSLPWPPDGGETT-TVSNPKTSTIETCNEGGEQVVRSRVAQNGRSASREK 359

Query: 360 WYNDWGENLEDFGVDIDVE 378
           W+NDWGE+L+DFGVD+D+E
Sbjct: 360 WFNDWGESLDDFGVDVDME 378

>SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} similar
           to uniprot|Q12006 Saccharomyces cerevisiae YOL003C
           DHHC-CRD protein
          Length = 379

 Score =  431 bits (1107), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 209/379 (55%), Positives = 269/379 (70%), Gaps = 1/379 (0%)

Query: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60
           M VKLK+PW+GIAIP FLISFI Y AHYFIL NFL   KQ+WFE S+ MIWISYYLAIYT
Sbjct: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60

Query: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120
           NPGKP   + P   +W+N+C KCN YKPER HHCK C QCVL MDHHCPWTMNCVG++NF
Sbjct: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120

Query: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180
            HF+RFLFWVI TT++LL +L+ RI+FLW  R++P+Y  ++SE+IFLTI TPMD FVLLT
Sbjct: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180

Query: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK 240
           ISLL +RC  NQ+L G TQIE+WE +R+E++F+  +L P+++ NL E  P   +  ++  
Sbjct: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQDDDI 240

Query: 241 AEKIVSKRIRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYSLFE 300
            + +   R+  D +V+FPYDL    N    LG   +W+  +G   G+GM+F+KNE S++E
Sbjct: 241 RKLLSQNRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSVYE 300

Query: 301 EDSILEDQILSLPWPPDGGKHGF-XXXXXXXXXXXXXXKDGEHVIRKRSPVSKLLESRTQ 359
            +  +ED++LSLPWPPDGG+H                 +DGE V+RKR    +    R +
Sbjct: 301 PEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPRKK 360

Query: 360 WYNDWGENLEDFGVDIDVE 378
           WYNDWGENL DFGVD+D E
Sbjct: 361 WYNDWGENLADFGVDLDEE 379

>KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  420 bits (1079), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 193/378 (51%), Positives = 262/378 (69%), Gaps = 2/378 (0%)

Query: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60
           MPV+LK+PW+GIA+P FLI++I Y++HYFIL NF S  +Q+WFE S+T+IW+SY  AI+ 
Sbjct: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60

Query: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120
           NPG+P  N+ PP +QWKNYCKKC+ YKPERTHHCKTC+QCVL MDHHCPWTMNCVG+ NF
Sbjct: 61  NPGRPPPNFEPPIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120

Query: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180
           PHF+RFL WV++TT+YL   L  R    W SRN   ++ + SE+ FL +  P++ F+LLT
Sbjct: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRKFV-HTSELCFLFVNAPLNAFILLT 179

Query: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK 240
           +SLL  RC  NQ L+G TQIE+WE +R+E+LF+  RL PQLI NL E  PE  T D  A 
Sbjct: 180 VSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPE-DTFDEGAA 238

Query: 241 AEKIVSKRIRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYSLFE 300
            + + SK++  + +++FPYD+ ++ N+ + +G   +W    G P  +G  F  N+ S ++
Sbjct: 239 QKLLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSDYD 298

Query: 301 EDSILEDQILSLPWPPDGGKHGFXXXXXXXXXXXXXXKDGEHVIRKRSPVSKLLESRTQW 360
             + +ED++LSLPWPPDGG+                   GE  +R RS  S++   RT+W
Sbjct: 299 IKASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDSRISVPRTEW 358

Query: 361 YNDWGENLEDFGVDIDVE 378
           +NDWGENL DFGVD+D E
Sbjct: 359 HNDWGENLSDFGVDVDAE 376

>Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003C -
           Hypothetical ORF [contig 185] FULL
          Length = 383

 Score =  406 bits (1044), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 198/381 (51%), Positives = 267/381 (70%), Gaps = 8/381 (2%)

Query: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60
           MPVKLK+PW+GIAIP  LI+FI Y +HYFIL NFLS+G+Q+WF+I ++MIWISY LAI+T
Sbjct: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60

Query: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120
           NPGKP + + P  +QWKN C+KC  YKPERTHHCKTC QCVL+MDHHCPWTMNCVG+ NF
Sbjct: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120

Query: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180
           PHF+RFL WVI+TT+YL + L  RI   W+ R+   Y+  K E++F+ I TP++ FV LT
Sbjct: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYV-QKIELVFIFINTPLNAFVWLT 179

Query: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPE--LKTPDNE 238
           I LL +RC+ NQ L G TQIE WE ER+E+ F   RL PQL+ NL E + +  L +P+  
Sbjct: 180 IILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGDDILNSPN-- 237

Query: 239 AKAEKIVSKR-IRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYS 297
             A+K+++ R ++ + +V+FPYDL ++ N    +G+ +T +  +  P G+G+ F KN+ S
Sbjct: 238 --AKKLINARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLS 295

Query: 298 LFEEDSILEDQILSLPWPPDGGKHGFXXXXXXXXXXXXXXKDGEHVIRKRSPVSKLLESR 357
            ++    +ED++LSLPWPPDGG+                   GE V+RKR    ++   R
Sbjct: 296 SYDTCHTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQR 355

Query: 358 TQWYNDWGENLEDFGVDIDVE 378
           T+WYNDWGENL DFGVD++ E
Sbjct: 356 TEWYNDWGENLSDFGVDVESE 376

>ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL003C
          Length = 375

 Score =  403 bits (1035), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 188/378 (49%), Positives = 258/378 (68%), Gaps = 3/378 (0%)

Query: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60
           M V +K+PW+G+AIPCFLISF  Y AH+F+L NFLS  + +WF++S++MIWISY+ AIY 
Sbjct: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60

Query: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120
           NPG+P   + P   +W+NYC KC  YKPERTHHCK C QCVL+MDHHCPWTMNC+G +  
Sbjct: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120

Query: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180
                   W+I TT  LL++ + RI F W +R   + L +K E+IFLTI TP+D F+LLT
Sbjct: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180

Query: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK 240
           ISLLF+RC  NQ+++GRTQIE WE +R+E+LFY +RL PQL++NL E +P       +  
Sbjct: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQEKEV 240

Query: 241 AEKIVSKRIRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYSLFE 300
            E + S    FD +++FPYD+    N+   +GSP+ WL  +G P  DGM+F+KNE S ++
Sbjct: 241 EEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISDYD 300

Query: 301 EDSILEDQILSLPWPPDGGKHGFXXXXXXXXXXXXXXKDGEHVIRKRSPVSKLLESRTQW 360
           E + ++D++L+LPWPPD  +HG               + GE V+R+R  V   +  R +W
Sbjct: 301 EATSIQDKLLALPWPPDDTRHGI--AFPSVSHVEKDTQGGEQVVRRRH-VPIAVPPRNEW 357

Query: 361 YNDWGENLEDFGVDIDVE 378
           YNDWGE+LE FGVD++VE
Sbjct: 358 YNDWGESLEHFGVDVEVE 375

>KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {ON}
           Anc_6.28 YOL003C
          Length = 386

 Score =  399 bits (1024), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 197/386 (51%), Positives = 259/386 (67%), Gaps = 16/386 (4%)

Query: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60
           MPV+LK PW GIAIPC LI FI Y AH+FIL N LS  +QI F+  +TMIWISYY+AIYT
Sbjct: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60

Query: 61  NPGKP--GSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYK 118
           NPGKP  GS           YC KCN +KPER+HHCKTCQQCVLMMDHHCPWTMNC+G+ 
Sbjct: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120

Query: 119 NFPHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLP----SYLFNKSEIIFLTITTPMD 174
           NFP F+RFL WVI+TT+ L ++L+ RI  +W++RN+P           E++ L + TPMD
Sbjct: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180

Query: 175 GFVLLTISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKT 234
            FVL TI+ LF+RC  NQ++ G TQIE+WE ERL+++FY ++L P +I  +WE  P  +T
Sbjct: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQT 240

Query: 235 PDNEAKAEKIVSKR----IRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGML 290
           P++E +AEK++       ++F  +V+FPYD+ L+ NI   LGSP+  LW +    G+G+ 
Sbjct: 241 PEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGVT 300

Query: 291 FKKNEYSLFEEDSILEDQILSLPWPPDGGKH-GFXXXXXXXXXXXXXXKDGEHVIRKR-S 348
           F+KN+ S +E++  + D +L L WPPDGG+                  +DGE +IRKR S
Sbjct: 301 FQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKRNS 360

Query: 349 PVSKLLESRTQWYNDWGENLEDFGVD 374
           P+    ESRT W N WGE LE FGVD
Sbjct: 361 PI----ESRTTWENQWGETLEGFGVD 382

>KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC- CRD protein
          Length = 377

 Score =  393 bits (1010), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 193/379 (50%), Positives = 246/379 (64%), Gaps = 3/379 (0%)

Query: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60
           M +KLK  W+G+AIP FL++ I Y +HYFIL NFLS  +QI+++   TMIW+SYYLAIYT
Sbjct: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60

Query: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120
           NPG P  ++ P + +W NYCKKC  YKPER HHCKTC QCVL MDHHCPWT+NCVG+ NF
Sbjct: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120

Query: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180
           PHF+RFLFWVI +T YLL+ LI RI  LW  R+   +  + SEIIF+ I TPMD FVLLT
Sbjct: 121 PHFMRFLFWVIFSTAYLLFLLIGRIYLLWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT 180

Query: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK 240
           +S L  RC  NQ L G TQIE+WE +R++SL Y  RL  Q+I  L E  PE+  P  + +
Sbjct: 181 VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEI-LPAKQHE 239

Query: 241 AEKIVSKR-IRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYSLF 299
             K++SKR +  +   +FPYD+    NI   +G    WLW + +P   G  F KNE   +
Sbjct: 240 INKLLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNELFFY 299

Query: 300 EEDSILEDQILSLPWPPDGGKHGFXXXXXXXXXXXXXXKDGEHVIRKRSPVSKLLESRTQ 359
           + +S +ED ++SLPWPPDG  H                  GE VIR +S   +    R  
Sbjct: 300 DPNSSIEDMLMSLPWPPDGLTH-HSRALGSGSSIETIVSGGEQVIRDKSVDLRDRLGRNS 358

Query: 360 WYNDWGENLEDFGVDIDVE 378
           WYNDWGE+L DFGVD ++E
Sbjct: 359 WYNDWGEDLSDFGVDTELE 377

>KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa]
           {ON} Anc_6.28 YOL003C
          Length = 396

 Score =  361 bits (926), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 202/401 (50%), Positives = 260/401 (64%), Gaps = 28/401 (6%)

Query: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60
           M ++LK+PW+GIAIP FLISFI Y+AHYFILL+ LS   Q+WF+ S++MIW+SYYLAI  
Sbjct: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60

Query: 61  NPGKPGSNYIPPSNQ----WKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVG 116
           +PG P    I   N+     + YCKKC+AYKP R HHCKTC +C+LMMDHHCPWTMNCVG
Sbjct: 61  DPGSPS---IADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVG 117

Query: 117 YKNFPHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGF 176
           +KN+PHFLRFLFWVIVTT +LL  L  RI F+W +    S L  + EI+ LTI TPMD F
Sbjct: 118 FKNYPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAF 177

Query: 177 VLLTISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQ-----LISNLWEFHPE 231
           +LLTI+LL IRCT+NQ+ SG +QIE WE ERLES FY R+ K +     LI+N++     
Sbjct: 178 ILLTITLLLIRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFSI 237

Query: 232 LKTPDNEAKAEKIV----SKRIRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGD 287
               D + +   ++     +R+ F  +++FPYD+ ++ N T VLG   +WL  +G P GD
Sbjct: 238 ESPEDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEGD 297

Query: 288 GMLFKKNEYSLFEEDSILEDQILSLPWPPD--GGKHGFXXXXXXXXXXXXXXKDGEHVIR 345
           GM F+ NE +  E+ S L D +LSLPWPPD    K+G               + GE V+R
Sbjct: 298 GMHFELNEIAS-EKASTLADLLLSLPWPPDTCTSKYG-KSIDEGTKYVETHIEGGECVLR 355

Query: 346 KR--SPVSKLLE------SRTQWYNDWGENLEDFGVDIDVE 378
            R  SP   L        SR  W N+WGENL+ FGVDI+ E
Sbjct: 356 NRTVSPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396

>TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28
           YOL003C
          Length = 377

 Score =  203 bits (517), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 144/411 (35%), Positives = 216/411 (52%), Gaps = 70/411 (17%)

Query: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60
           M ++   PW G+AIP  +I  +   +++ IL + L+  + IW+  +  MI  SYYLAI T
Sbjct: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60

Query: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPE----------------RTHHCKTCQQCVLMM 104
            P  P      PS   +++       + +                R HHCKTC  CV+MM
Sbjct: 61  -PPTPA-----PSTLTQSFISDVMNNENDIFPTTTCKKCKKIKLPRAHHCKTCNTCVVMM 114

Query: 105 DHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFN--KS 162
           DHHCPWTMNCVGY N+PHF+RFL WVI++TT LL  LI +   L+  RN P +L+   K 
Sbjct: 115 DHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKY 174

Query: 163 EIIFLTITTPMDGFVLLTISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKP--- 219
           +II LT+  P   FV LT+ LL ++   NQ+ +G TQIE W+ E +E+ ++  +      
Sbjct: 175 KIIILTLLIPGTIFVWLTVLLLLLKTLQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVAL 234

Query: 220 --QLISNLWEFHPELKTPDNEAKAEKIVSK-------RIRFDLLVSFPYDLGLINNITTV 270
             QL+ NL  F+ +  + D+  K +K++S           F  +++FPYDLGL NNITT 
Sbjct: 235 QLQLLENLLNFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITTT 294

Query: 271 LGS--PVTWLWFYGEPSGDGMLFKKNEYSLFEEDSI---LEDQILSLPWPPDGGKHGFXX 325
           +GS  P++W   +  P       K NE+++++++     ++D +L LPWP +   +    
Sbjct: 295 MGSLNPLSWFNPWYTPLT-ASYNKINEFAIWDDNETHDNIKDMLLCLPWPLNYSNNS--- 350

Query: 326 XXXXXXXXXXXXKDGEHVIRKRSPVSKLLESRTQWYNDWGENLEDFGVDID 376
                       +DGE V++                ND+GE L+DFGVD D
Sbjct: 351 ----------TFQDGELVVKS---------------NDYGETLQDFGVDYD 376

>NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON}
           Anc_3.12
          Length = 327

 Score = 91.7 bits (226), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 59/213 (27%), Positives = 103/213 (48%), Gaps = 36/213 (16%)

Query: 45  ISVTMIWISYYLAIYTNPGKPGSNY----------------IPPSNQWKN---------- 78
           I  T+   +Y+  + T PG P SN+                +PP    K           
Sbjct: 40  ILATIGIFAYFRVVSTGPGTP-SNFPDLRVYNLEDAKRGIELPPEYIAKRSFTLKKDGRY 98

Query: 79  -YCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYL 137
             C+ C  +KP+R HHC TC +C+L MDHHCPW   C+G++N  +F++FL +    +  +
Sbjct: 99  RLCQTCQVWKPDRCHHCSTCDKCILKMDHHCPWFAECIGFENQKYFVQFLIYCTAYSIVV 158

Query: 138 LYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLTISLLFIRC-TVNQLLSG 196
           L+F    + + +  +        + E+I L + T     +++T+SL+F    ++ QLL  
Sbjct: 159 LFFTSCELHYWFSGKQY------EDELIDLMLLTVWILAIVITVSLIFFSSFSIYQLLKN 212

Query: 197 RTQIETWENERLE-SLFYLRRLKPQLISNLWEF 228
           +T IE +  +R +  L  LR L+   + N+++ 
Sbjct: 213 QTTIEMYGMKREKRDLELLRGLEDAEVDNIFDL 245

>KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 88.6 bits (218), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 73/131 (55%), Gaps = 5/131 (3%)

Query: 80  CKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLLY 139
           C+ C  +KP+R HHC +C +C+L MDHHCPW   C+G+KN  +F++FLF+   + + ++ 
Sbjct: 106 CQTCMFWKPDRCHHCSSCNRCILKMDHHCPWFAECIGFKNQKYFIQFLFYC-TSYSIIVL 164

Query: 140 FLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLTISLLFIRCTVNQLLSGRTQ 199
           F+ S  ++ W       Y F    I F  +T  +   V+    +LF   +V QLL  +T 
Sbjct: 165 FVTSIQIYHWFRSTSYEYEF----IDFKLLTVWLLAIVIFISLVLFTGFSVFQLLGNQTT 220

Query: 200 IETWENERLES 210
           IE +   R ++
Sbjct: 221 IELYAYRRYKA 231

>NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12
          Length = 335

 Score = 87.0 bits (214), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 72/147 (48%), Gaps = 5/147 (3%)

Query: 68  NYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFL 127
           +Y    N     C+ C  +KP+R HHC TC +C+L MDHHCPW   C+G+KN   F++FL
Sbjct: 97  SYTMKRNGRYRLCQTCQVWKPDRCHHCSTCNKCILKMDHHCPWFAECIGFKNQKFFIQFL 156

Query: 128 FWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLTISLLFIR 187
            +  +     L  +  + V  +K++N     +    I F  +   +  FV+    L F  
Sbjct: 157 IYCTIYAFVALGLISYQFVNWYKNQN-----YMNEYIDFTLLIVGLLAFVISISVLAFSS 211

Query: 188 CTVNQLLSGRTQIETWENERLESLFYL 214
            ++ Q+L  RT IE +   R    F +
Sbjct: 212 FSIYQVLKNRTTIEMYGIRRYNRDFAI 238

>CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326c
          Length = 332

 Score = 86.7 bits (213), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 77/141 (54%), Gaps = 7/141 (4%)

Query: 68  NYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFL 127
           +Y    N     CK C+++KP+R HHC TC  CVL MDHHCPW   CVGY+N   F++FL
Sbjct: 94  SYTQKRNGRFRVCKSCSSWKPDRCHHCSTCNVCVLKMDHHCPWFAGCVGYRNQKFFIQFL 153

Query: 128 FWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLTISL-LFI 186
            +  V +  L+  L S  ++ W         F + E+I  T+ +     ++++IS+ +F 
Sbjct: 154 IYCTVYSI-LVLILSSMEIYTWFKGE-----FFEVELINFTLLSLWLLALVVSISITIFT 207

Query: 187 RCTVNQLLSGRTQIETWENER 207
             +++Q+   +T IE +   R
Sbjct: 208 VFSISQVCQNQTTIELYSLRR 228

>Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL326C
           - Hypothetical ORF [contig 124] FULL
          Length = 360

 Score = 84.7 bits (208), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 74/130 (56%), Gaps = 13/130 (10%)

Query: 79  YCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTY-- 136
           +C+ C  +KP+R HHC  C +C L MDHHCPW  +CVGY+N  +F+ FL +   TT Y  
Sbjct: 132 FCRTCVVWKPDRCHHCSGCNKCYLKMDHHCPWFASCVGYRNQKYFIHFLLY---TTAYSI 188

Query: 137 LLYFLISRIVFLW-KSRNLPSYLFNKSEIIFLTITTPMDGFVLLTISLL-FIRCTVNQLL 194
           L++FL    + +W +S+     L N   +I   ++      +++TIS+L F   T+  + 
Sbjct: 189 LVFFLTGADLLMWFRSQGYNQELINLPLLIVWILS------LVITISMLAFTSYTIYLVA 242

Query: 195 SGRTQIETWE 204
             +T IE +E
Sbjct: 243 KNQTTIEMYE 252

>TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 74/143 (51%), Gaps = 5/143 (3%)

Query: 80  CKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLLY 139
           C+ CN +KP+R+HHC TC +CVL MDHHCPW   C+G+KN   F++FL +   T  Y++ 
Sbjct: 110 CRTCNVWKPDRSHHCSTCNRCVLKMDHHCPWFSECIGFKNQKFFIQFLIYN-TTYAYVIA 168

Query: 140 FLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLTISLLFIRCTVNQLLSGRTQ 199
            L S+ ++ W         F    ++FL I   +   V L +S  F   +V  +++ +T 
Sbjct: 169 ILTSKQMYNWFDDGSYENEFVNMYLLFLWILALV---VSLALS-CFAGFSVYMVMNNKTT 224

Query: 200 IETWENERLESLFYLRRLKPQLI 222
           IE +   +      L    P  +
Sbjct: 225 IEMYAMRKYRDDLELYNRNPNRV 247

>Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON}
           (48992..49972) [981 nt, 327 aa]
          Length = 326

 Score = 83.6 bits (205), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 77/151 (50%), Gaps = 7/151 (4%)

Query: 80  CKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLLY 139
           C+ CN +KP+R HHC  C +C+L MDHHCPW   CVG+KN  +F++FL +  V    ++ 
Sbjct: 106 CRTCNVWKPDRCHHCSACDKCILKMDHHCPWFAECVGFKNQKYFVQFLIYTTVYAILVMT 165

Query: 140 FLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLTISLLFIRCTVNQLLSGRTQ 199
           +  S  ++ W    L      K  ++ + I   +   V LT++  F   ++ Q ++ RT 
Sbjct: 166 Y-TSFQIYDWFKNELYETEIIKIRLLMVWI---LSVAVFLTVT-CFTGFSIYQTINNRTT 220

Query: 200 IE--TWENERLESLFYLRRLKPQLISNLWEF 228
           IE  T    R E   Y      QL  N+++ 
Sbjct: 221 IEMYTLRKYREELELYGNYRDSQLTRNIFDL 251

>KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.12
           YNL326C
          Length = 328

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 70/130 (53%), Gaps = 9/130 (6%)

Query: 80  CKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLLY 139
           C+ C  +KP+R HHC +C +C+L MDHHCPW   CVG++N   F++FL +   TT Y ++
Sbjct: 103 CQSCRYWKPDRCHHCSSCDRCILKMDHHCPWIAGCVGFRNQKLFIQFLLY---TTAYAIF 159

Query: 140 FL--ISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLTISLLFIRCTVNQLLSGR 197
            L   S  ++ W   +          ++FL I +     V+     LF   +V+Q+L  +
Sbjct: 160 VLSMTSVQLYRWFYNDKFQEELISGYLLFLWIFS----LVVFIAMTLFSAFSVSQVLKNQ 215

Query: 198 TQIETWENER 207
           T IE +  +R
Sbjct: 216 TTIEMYGVQR 225

>KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 342

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 75/133 (56%), Gaps = 7/133 (5%)

Query: 79  YCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLL 138
           +C+ C  +KP+R HHC  C++C L MDHHCPW  +CVGY N  +F++FL +  V +  L+
Sbjct: 105 FCRVCAVWKPDRCHHCSACKKCFLKMDHHCPWFASCVGYANQKYFVQFLIYGTVFSI-LI 163

Query: 139 YFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLTISLL-FIRCTVNQLLSGR 197
           + L    + LW      +  +N+ E+I L +       V ++IS+L F   TV  +   +
Sbjct: 164 FLLSGTELLLW----FKNQRYNQ-EMIQLPLLVVWILSVAISISMLAFTSYTVYLITKNQ 218

Query: 198 TQIETWENERLES 210
           T IE +E   L++
Sbjct: 219 TTIEMYEWSNLKA 231

>SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 333

 Score = 79.7 bits (195), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 48/71 (67%), Gaps = 3/71 (4%)

Query: 80  CKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLLY 139
           C+ C  +KP+R+HHC +C +C L MDHHCPW  +C+G+KN   F++FL +   TT Y ++
Sbjct: 105 CRNCKVWKPDRSHHCSSCNKCFLKMDHHCPWFASCIGFKNQKLFIQFLLY---TTWYAVF 161

Query: 140 FLISRIVFLWK 150
             ++  + LWK
Sbjct: 162 VFMTTGLQLWK 172

>TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}
           Anc_3.12 YNL326C
          Length = 345

 Score = 79.3 bits (194), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 80/143 (55%), Gaps = 16/143 (11%)

Query: 80  CKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLLY 139
           C+ C  +KP+R HHC +C +C+L MDHHCPW   C+G+KN  +F+ FL +  +  T++  
Sbjct: 106 CRTCLVWKPDRCHHCSSCDRCILKMDHHCPWFAECIGFKNHKYFINFLIYNSLYATFVC- 164

Query: 140 FLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLTISL-LFIRCTVNQLLSGRT 198
            + S+ ++ W S+    Y+   +E+I + +       ++ ++S+ LF   ++ Q+L  RT
Sbjct: 165 LISSKELWNWFSQE--KYV---TELINIHLLLLFIVSLITSVSMTLFTAYSIYQVLINRT 219

Query: 199 QIETWENERLESLFYLRRLKPQL 221
            IE         L+  RR K +L
Sbjct: 220 TIE---------LYAYRRYKEEL 233

>Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON}
           YNL326C (REAL)
          Length = 334

 Score = 78.6 bits (192), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 62/128 (48%), Gaps = 5/128 (3%)

Query: 80  CKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLLY 139
           C+ C+ +KP+R HHC +C  CVL MDHHCPW   C G+KN   F++FL +   TT Y   
Sbjct: 106 CQVCHVWKPDRCHHCSSCDICVLKMDHHCPWFAECTGFKNQKFFIQFLMY---TTCYAFL 162

Query: 140 FLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLTISLLFIRCTVNQLLSGRTQ 199
            LI     L    N  S  FN+  I F  +   +    +    L F   ++ Q+   +T 
Sbjct: 163 VLIYTCYELGTWFNSGS--FNRELIDFQLLGVALLAVAVFITVLAFTVFSIYQVCKNQTT 220

Query: 200 IETWENER 207
           IE     R
Sbjct: 221 IEVHGMRR 228

>Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON}
           YNL326C (REAL)
          Length = 330

 Score = 77.4 bits (189), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 64/128 (50%), Gaps = 5/128 (3%)

Query: 80  CKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLLY 139
           C+ C+ +KP+R HHC +C  C+L MDHHCPW   C G+KN   F++FL +   TT Y   
Sbjct: 106 CQICHVWKPDRCHHCSSCDMCILKMDHHCPWFAECTGFKNQKLFIQFLMY---TTFYAFL 162

Query: 140 FLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLTISLLFIRCTVNQLLSGRTQ 199
            LI     L    +  S  FN+  I F  +   +    +    L F   ++ Q+ + +T 
Sbjct: 163 VLIYSCYELGTWFHSGS--FNQELIDFHLLGVALLAIAIFISVLAFTAFSIYQVCNNQTT 220

Query: 200 IETWENER 207
           IE +   R
Sbjct: 221 IELYGMRR 228

>TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON}
           Anc_3.12 YNL326C
          Length = 329

 Score = 77.4 bits (189), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 42/61 (68%)

Query: 80  CKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLLY 139
           C+ C+ +KP+R HHC  C +C+L MDHHCPW  +CVG++N  +F++FL +  +    +L 
Sbjct: 108 CRTCHVWKPDRCHHCSACNRCILRMDHHCPWLPDCVGFRNQKYFIQFLMYATLYAFNVLI 167

Query: 140 F 140
           F
Sbjct: 168 F 168

>ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 327

 Score = 77.0 bits (188), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 96/216 (44%), Gaps = 49/216 (22%)

Query: 40  QIWFE--ISVTMIWIS-----YYLAIYTNPGKP---------------GSNYIPPS---- 73
           QIW++  +SV +  ++     YY  I T PG P                   +PP     
Sbjct: 34  QIWYKFLVSVDVFLVAIGLYTYYKVIITGPGSPLDYDTIKVYDMQAVESGAELPPEFLSR 93

Query: 74  -------NQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRF 126
                  +     C+ C+ +KP+R HHC  C +C+L MDHHCPW   C+G+ N   F+++
Sbjct: 94  RSITTKRDGRFRVCRTCHVWKPDRCHHCSRCDKCILKMDHHCPWFPGCIGFNNQRFFIQY 153

Query: 127 LFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLTISLLFI 186
           L +    TTY      S ++FL+ S  L  +   K   + L        F LL++ LL +
Sbjct: 154 LLYA---TTY------SIVIFLFSSIQLLHWFNTKQYEVELI------DFHLLSVWLLGV 198

Query: 187 RCTVN-QLLSGRTQIETWENERLESLFYLRRLKPQL 221
             +V+    +G +  +  +N+    +   RR + +L
Sbjct: 199 AVSVSLSFFTGFSIYQVTKNQTTVEMHIYRRYREEL 234

>KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {ON}
           weakly similar to uniprot|P42836 Saccharomyces
           cerevisiae YNL326C PFA3 Palmitoyltransferase for Vac8p
           one of three yeast DHHC-cysteine rich domain proteins
           (Pfa3p Erf2p Akr1p) with palmitoyltransferase activity
           required for vacuolar integrity under stress conditions
          Length = 325

 Score = 77.0 bits (188), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 43/64 (67%), Gaps = 3/64 (4%)

Query: 79  YCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLL 138
           +C+ C  +KP+R HHC  C +C L MDHHCPW  +CVG++N   F++FL +   TT Y L
Sbjct: 104 FCQTCEIWKPDRCHHCSKCNKCFLKMDHHCPWFASCVGFRNQKFFVQFLAY---TTVYSL 160

Query: 139 YFLI 142
           Y L+
Sbjct: 161 YVLL 164

>Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}
           YNL326C (REAL)
          Length = 336

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 83/198 (41%), Gaps = 38/198 (19%)

Query: 42  WFEISVTMI------WISYYLAIYTNPGKP---------------GSNYIPPSNQWKN-- 78
           WF ++VT+I        +YY  I T PG P                   +PP    K   
Sbjct: 37  WF-LAVTLIPTLMVALYTYYKVISTGPGSPLDFPDLLVHDLKAAENGLELPPEYMSKRCM 95

Query: 79  ---------YCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFW 129
                     C+ C+ +KP+R HHC +C  C+L MDHHCPW   C G+KN   F++FL +
Sbjct: 96  TLKRDGRFRVCQICHVWKPDRCHHCSSCDICILKMDHHCPWFAECTGFKNQKFFIQFLMY 155

Query: 130 VIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLTISLLFIRCT 189
              TT Y    LI     L    N  S  F++  I    + T +    +    L F   +
Sbjct: 156 ---TTFYAFLVLIDTCYELGTWFNSGS--FSRELIDLHLLGTALLAIAVFISVLAFSAFS 210

Query: 190 VNQLLSGRTQIETWENER 207
           + Q+ + +T IE     R
Sbjct: 211 IYQVCNNQTTIELHSMRR 228

>YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}
           PFA3Palmitoyltransferase for Vac8p, required for
           vacuolar membrane fusion; contains an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain;
           autoacylates; required for vacuolar integrity under
           stress conditions
          Length = 336

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 62/128 (48%), Gaps = 5/128 (3%)

Query: 80  CKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLLY 139
           C+ C+ +KP+R HHC +C  C+L MDHHCPW   C G++N   F++FL +   TT Y   
Sbjct: 106 CQVCHVWKPDRCHHCSSCDVCILKMDHHCPWFAECTGFRNQKFFIQFLMY---TTLYAFL 162

Query: 140 FLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLTISLLFIRCTVNQLLSGRTQ 199
            LI     L    N  S  FN+  I F  +   +    +    L F   ++ Q+   +T 
Sbjct: 163 VLIYTCYELGTWFNSGS--FNRELIDFHLLGVALLAVAVFISVLAFTCFSIYQVCKNQTT 220

Query: 200 IETWENER 207
           IE     R
Sbjct: 221 IEVHGMRR 228

>ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {ON}
           similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 366

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 48/78 (61%), Gaps = 3/78 (3%)

Query: 79  YCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLL 138
           YC  C  ++P R  HC TC+ C+L  DHHC W  NC+G +N+ +F+ FL   I+++ +L 
Sbjct: 180 YCTSCRIWRPPRASHCSTCEACILTHDHHCIWVNNCIGQRNYRYFILFLASAILSSIFL- 238

Query: 139 YFLISRIVFLWKSRNLPS 156
             + +  + ++  RNLPS
Sbjct: 239 --IANCSIHIYHHRNLPS 254

>KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.389
           YLR246W
          Length = 354

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 46/89 (51%), Gaps = 2/89 (2%)

Query: 78  NYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYL 137
            YC  C  ++P R  HC+ CQ CV   DHHC W  NCVG +N+ +FL FL     T T L
Sbjct: 184 KYCTACKIWRPPRASHCRICQVCVQTQDHHCAWINNCVGQRNYRYFLTFLTATCATCTVL 243

Query: 138 LYFLISRIVFLWKSRNLPSYLFNKSEIIF 166
             F+ S I    ++R +P  L   S I  
Sbjct: 244 --FVSSAIHLSHETRAVPIVLVAYSGIAL 270

>NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389
          Length = 374

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 40/60 (66%)

Query: 79  YCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLL 138
           YCK C  ++P R+ HC  C+ CVLM DHHC W  NCVG +N+ +FL FL    +T+ +L+
Sbjct: 183 YCKTCRIWRPPRSSHCSICETCVLMHDHHCVWVNNCVGQRNYRYFLTFLTSSTLTSIFLI 242

>Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 73.9 bits (180), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 39/60 (65%)

Query: 79  YCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLL 138
           YC+ C  ++P RT HC TC  CV++ DHHC W  NCVG +N+  FL FL   I ++ +LL
Sbjct: 174 YCQSCRIWRPPRTSHCSTCNVCVMVHDHHCVWVNNCVGKRNYRFFLIFLLSAIFSSVFLL 233

>Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON}
           similar to Ashbya gossypii ADL197C
          Length = 339

 Score = 73.6 bits (179), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 65/123 (52%), Gaps = 4/123 (3%)

Query: 79  YCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLL 138
           YC  C  +KP+R+HHC +C +C L  DHHCPW  +C+G+ N   F++FL +  + +  + 
Sbjct: 109 YCATCGVWKPDRSHHCSSCNKCYLKRDHHCPWFSSCIGFNNQKFFVQFLMYSTLYSISIF 168

Query: 139 YFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMD----GFVLLTISLLFIRCTVNQLL 194
                +IV  ++++N  +   + + ++   ++T        F   +I LL    T N+L 
Sbjct: 169 IAATLQIVSWFRNQNYTTQYIDINLLVVWLLSTGASVSLFCFTGFSIYLLTKNQTTNELN 228

Query: 195 SGR 197
           + +
Sbjct: 229 ASK 231

>TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.389
           YLR246W
          Length = 404

 Score = 73.9 bits (180), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 64/121 (52%), Gaps = 9/121 (7%)

Query: 79  YCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLL 138
           YC+ C  ++P R+ HC  C  CV+ +DHHC W  NCVG +N+ +FL FL   I+T  +L 
Sbjct: 195 YCRTCRIWRPPRSSHCSICDCCVMSLDHHCLWLNNCVGKRNYRYFLIFLTSTIMTVIFL- 253

Query: 139 YFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLTISLLFIRCTVNQLLSGRT 198
             LI+  + + K+R+      N    I LT+      +  L+IS   I    + +L+G  
Sbjct: 254 --LINTGIHIGKNRHEKKPASNIPVTILLTV------YGSLSISYPIILLAYHLVLTGTN 305

Query: 199 Q 199
           Q
Sbjct: 306 Q 306

>KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 349

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 61/258 (23%), Positives = 104/258 (40%), Gaps = 36/258 (13%)

Query: 6   KYPWMGIAIPCFLISFIAYTAHYF-------ILLNFLSIGKQIWFEISVTMIWISYYLAI 58
           ++ W   AIP F +S  AY    F       I      + + +   ++++   I+  L I
Sbjct: 47  RFRWKFRAIPAFYLSIYAYCTFLFFKDIEGLIRSRLFGVERLLIIPVALSAPIITGLLTI 106

Query: 59  YTNPGKPGSNYIPPSNQWKN--------YCKKCNAYKPERTHHCKTCQQCVLMMDHHCPW 110
           +    KP S Y  P     +         C+ C   K  RT HC  C QCV + DHHC W
Sbjct: 107 WI---KPKSTYASPMLDAYDELIFHSGVSCRTCKLPKFARTKHCPICDQCVQLADHHCVW 163

Query: 111 TMNCVGYKNFPHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTIT 170
             NC+G  N+ +F  FL    V+  +L  +   R++FL +         +  +++ L+I 
Sbjct: 164 ANNCIGRGNYQYFYLFL----VSNVFLTNYGFLRLLFLQR-------FVHSRQLLILSIL 212

Query: 171 TPMDGFVLLTISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHP 230
               G +L   S         Q +  R  + T E  +   +  + R +  +  +  +++ 
Sbjct: 213 LGCFGVILAVFSYF-------QFVLVRDGMTTNEENKWLVIHDMIRARQMVTDDTGKYYF 265

Query: 231 ELKTPDNEAKAEKIVSKR 248
            L     E  AE + + R
Sbjct: 266 RLLADCQEDSAESLTNPR 283

>NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON} 
          Length = 329

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 46/75 (61%), Gaps = 4/75 (5%)

Query: 80  CKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLLY 139
           C+ C +YKP R+ HC  C +CVL+ DHHC W  NCVG  N+ +F  FL    +T T+ L 
Sbjct: 137 CRTCQSYKPARSKHCSICDRCVLVADHHCIWVNNCVGKGNYTYFYMFL----ITNTFSLT 192

Query: 140 FLISRIVFLWKSRNL 154
           +   R++ ++ + N+
Sbjct: 193 YAFIRLLTIFYTTNV 207

>ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL326C
          Length = 390

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 39/73 (53%), Gaps = 7/73 (9%)

Query: 73  SNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFL----- 127
           S     YC KC  +KP+R HHC  C +C L  DHHC W   C+GY N   FL FL     
Sbjct: 164 STGRHRYCVKCKVWKPDRCHHCSACDKCYLRRDHHCVWFPGCIGYNNHKFFLHFLLYASV 223

Query: 128 --FWVIVTTTYLL 138
             FW+ + TT+ L
Sbjct: 224 YAFWICIITTWDL 236

>TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {ON}
           Anc_8.389 YLR246W
          Length = 359

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 41/74 (55%)

Query: 65  PGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFL 124
           P SN  P S     YC  C  ++P R  HC TC  CV+  DHHC W  NCVG +N+ +F+
Sbjct: 166 PKSNVDPLSKIDIRYCTSCRIWRPPRASHCSTCGVCVMTHDHHCIWVNNCVGQRNYRYFI 225

Query: 125 RFLFWVIVTTTYLL 138
            FL   ++   +L+
Sbjct: 226 IFLIGTVLAELFLI 239

>TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 66/140 (47%), Gaps = 18/140 (12%)

Query: 6   KYPWMGIAIPCFLIS-FIAYTAHYFILLNFLSIGKQIWFE----ISVTMIWISYYLAIYT 60
           KY W    +P F I+ FI    +++  +  L   K  +FE    I +++I   ++  I T
Sbjct: 47  KYRWKFHIVPIFYITLFIYLVINFYAKVEPLIHDKLTYFERFFFIPISIISTPFF-GIIT 105

Query: 61  NPGKPGSNYIPPSNQWKNY------------CKKCNAYKPERTHHCKTCQQCVLMMDHHC 108
               P +  +  ++  K Y            CK C   KP R+ HC  C QC+L+ DHHC
Sbjct: 106 MLINPDTALMYSNDSIKKYAYDRILYFPDTECKTCKVEKPARSKHCAVCDQCILVNDHHC 165

Query: 109 PWTMNCVGYKNFPHFLRFLF 128
            W  NC+G  NF +F  FLF
Sbjct: 166 VWVNNCIGRGNFLYFYLFLF 185

>Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246W
           (REAL)
          Length = 359

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 39/60 (65%)

Query: 79  YCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLL 138
           YC+ C  ++P R+ HC TC  CV++ DHHC W  NC+G +N+  FL FL   ++++  LL
Sbjct: 174 YCQSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLVFLLSAVISSIILL 233

>SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 352

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 45/83 (54%)

Query: 73  SNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIV 132
           +N    YC  C  ++P R  HC TC+ C++  DHHC W  NC+G +N+ +F  FL   ++
Sbjct: 165 ANIEVKYCTTCRIWRPPRASHCSTCEACIITHDHHCKWVNNCIGQRNYHYFFTFLVSCVI 224

Query: 133 TTTYLLYFLISRIVFLWKSRNLP 155
            T +++     R+     +++ P
Sbjct: 225 ATAFIIANCAIRVSRSVHAKDAP 247

>KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 358

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 35/57 (61%)

Query: 79  YCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTT 135
           YC  C  ++P R  HC TC+ CVL  DHHC W  NC+G +N+ +FL FL    + TT
Sbjct: 177 YCATCRIWRPPRASHCSTCEACVLTHDHHCTWVNNCIGQRNYRYFLTFLASCCLATT 233

>YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subunit
           of a palmitoyltransferase, composed of Erf2p and Shr5p,
           that adds a palmitoyl lipid moiety to heterolipidated
           substrates such as Ras1p and Ras2p through a thioester
           linkage; mutants partially mislocalize Ras2p to the
           vacuole
          Length = 359

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 38/60 (63%)

Query: 79  YCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLL 138
           YC  C  ++P R+ HC TC  CV++ DHHC W  NC+G +N+  FL FL   I+++  LL
Sbjct: 174 YCPSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLIFLLGAILSSVILL 233

>Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W
           (REAL)
          Length = 336

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 51/107 (47%), Gaps = 6/107 (5%)

Query: 60  TNPGKPGSNYIPPSNQWKNY----CKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCV 115
           +N  +PGS    P +    Y    C  C   KP R+ HC  C +C+L+ DHHC W  NC+
Sbjct: 112 SNVHRPGSTEKYPYDYLIYYPDVQCSTCRITKPARSRHCSICNRCILVADHHCIWVNNCI 171

Query: 116 GYKNFPHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKS 162
           G  N+  F  FL   IV+ +Y    L S  + L  S  LP  +   S
Sbjct: 172 GKGNYIQFYLFLISNIVSMSYAFLRLCS--ISLKSSTALPRAVLTLS 216

>TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.389
           YLR246W
          Length = 360

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 45/77 (58%)

Query: 79  YCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLL 138
           YC  C+ ++P R  HC  CQ C+ + DHHC W  NCVG +N+ +F+ FL   I+++ +++
Sbjct: 189 YCSTCHIWRPPRASHCSICQACIDVHDHHCIWINNCVGNRNYRYFIIFLVGAILSSIFII 248

Query: 139 YFLISRIVFLWKSRNLP 155
                 +  + ++ N P
Sbjct: 249 INCSIHVARIRRASNAP 265

>Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (61%)

Query: 79  YCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLL 138
           YC  C  ++P R+ HC TC  CV++ DHHC W  NC+G +N+  FL FL   I ++  LL
Sbjct: 174 YCTSCRIWRPPRSSHCSTCNICVMVHDHHCIWVNNCIGKRNYRFFLIFLLSAIFSSILLL 233

>SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 555

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 50/92 (54%), Gaps = 6/92 (6%)

Query: 80  CKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLLY 139
           C+ C+  KP R+ HC  C +C+LM+DHHC W  NC+G  N+ +F  FL   +   +Y   
Sbjct: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191

Query: 140 FLISRIVFLWKSRNLPSYLFNKSEIIFLTITT 171
            L S I  + ++ N+ +       ++ LTI T
Sbjct: 192 RLTS-IQLMSQTENIKT-----KPMLVLTILT 217

>KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 40/72 (55%), Gaps = 4/72 (5%)

Query: 77  KNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTY 136
             +C  C   KP R+ HC  C +CVL+ DHHC W  NC+G  N+ +F  FL    V+ T 
Sbjct: 134 NTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFL----VSNTL 189

Query: 137 LLYFLISRIVFL 148
           LL +   RI+ L
Sbjct: 190 LLGYAFLRIILL 201

>Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar to
           Ashbya gossypii AGL125C
          Length = 368

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 37/60 (61%)

Query: 79  YCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLL 138
           YC  C  ++P R  HC TC  C++  DHHC W  NCVG +N+ +FL F++  ++T   L+
Sbjct: 188 YCTTCRIWRPLRASHCSTCNSCIMTFDHHCIWVNNCVGQRNYRYFLTFIYSAVLTIILLV 247

>AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR246W
           (ERF2)
          Length = 367

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 37/61 (60%)

Query: 78  NYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYL 137
            YC  C  ++P R  HC  C  C+L  DHHC W  NC+G +N  +FL FLF  ++++ +L
Sbjct: 185 KYCTTCRIWRPPRASHCAVCDSCILSFDHHCDWLNNCIGQRNHRYFLAFLFSSVLSSIWL 244

Query: 138 L 138
           L
Sbjct: 245 L 245

>KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.389
           YLR246W
          Length = 361

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 37/60 (61%)

Query: 79  YCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLL 138
           YC+ C  ++P R  HC  C+ CV+  DHHC W  NCVG +N+ +F+ FL    + + +LL
Sbjct: 177 YCRTCRIWRPPRASHCSICEACVMTHDHHCIWINNCVGQRNYRYFVTFLISGTLASIFLL 236

>TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.286
           YDR126W
          Length = 328

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 72/153 (47%), Gaps = 28/153 (18%)

Query: 6   KYPWMGIAIPCFLISFIAYTAHYFILLN---------FLSIGKQIWFEISVTMI----WI 52
           ++ W    +P F +S   Y    F+L+           LS+ K     + V       W+
Sbjct: 48  RFRWKFYVVPAFYLSLYCYII--FVLIRDVIPVIGNRLLSVEKLCIIPVLVVATPVLGWL 105

Query: 53  SYYLAIYTNPG-KPGS------NYIP--PSNQWKNYCKKCNAYKPERTHHCKTCQQCVLM 103
           S  +   T+ G +PGS      +YI   P+ Q    C+ C+  KP R+ HC  C++CVL+
Sbjct: 106 SMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQ----CRTCHIEKPARSRHCNLCRECVLV 161

Query: 104 MDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTY 136
            DHHC W  NC+G  N+  F  FL   +++ +Y
Sbjct: 162 ADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSY 194

>NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389
          Length = 389

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 41/77 (53%)

Query: 79  YCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLL 138
           YC  C  ++P R+ HC  C+ C++  DHHC W  NC+G +N+  FL FL     T+ +L+
Sbjct: 216 YCTTCRIWRPPRSSHCSICEACIITHDHHCIWVNNCIGQRNYRFFLTFLLSGTFTSIFLI 275

Query: 139 YFLISRIVFLWKSRNLP 155
                 I    K R+ P
Sbjct: 276 INASIDIARTPKVRDTP 292

>TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {ON}
           Anc_8.286 YDR126W
          Length = 333

 Score = 67.8 bits (164), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 40/71 (56%), Gaps = 4/71 (5%)

Query: 78  NYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTY- 136
           N C  CN  KP R+ HC  C  C+L+ DHHC W  NC+G  N+ +F  FL    ++ +Y 
Sbjct: 137 NVCSTCNIEKPARSKHCNICGTCILLQDHHCIWVNNCIGLGNYKYFFMFLLLNTISLSYA 196

Query: 137 ---LLYFLISR 144
              LL+  +S+
Sbjct: 197 FLRLLHITLSK 207

>NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8.286
           YDR126W
          Length = 339

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 56/115 (48%), Gaps = 7/115 (6%)

Query: 80  CKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTY--L 137
           C+ C   KP R+ HC+ C  C+L+ DHHC W  NC+G  N+ +F  FL    +T TY  +
Sbjct: 139 CRTCGIVKPARSKHCEICNSCILLCDHHCLWVNNCIGEGNYLYFYSFLLCNCITMTYSFI 198

Query: 138 LYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLTISLLFIRCTVNQ 192
             FL+        SRN+ + L     I+  +      GF  L + L+    T N+
Sbjct: 199 RLFLMYCQGHAPSSRNILTLL-----ILCGSFAVICAGFTFLQLQLVKDGMTTNE 248

>KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]
           {ON} similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 355

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 45/88 (51%)

Query: 71  PPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWV 130
           P ++    YC+ C  ++P R+ HC  C  CVL  DHHC W  NC+G +N+  FL FL   
Sbjct: 165 PNASVSMKYCQTCRIWRPPRSAHCSVCDVCVLSHDHHCKWLNNCIGKRNYRFFLEFLMAS 224

Query: 131 IVTTTYLLYFLISRIVFLWKSRNLPSYL 158
            ++   L+     R+ +  + R  P  L
Sbjct: 225 TISCILLILLSSFRLSYSPQVRYTPVSL 252

>CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {ON}
           similar to uniprot|Q06551 Saccharomyces cerevisiae
           YLR246w ERF2
          Length = 326

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 34/60 (56%)

Query: 79  YCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLL 138
           YC  C  ++P R  HC  C+ CVL  DHHC W  NCVG +N+ +FL FL    +    L+
Sbjct: 159 YCHTCKIWRPPRASHCSVCECCVLTHDHHCIWVNNCVGQRNYRYFLAFLLSSTLACALLI 218

>CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar to
           uniprot|Q04629 Saccharomyces cerevisiae YDR126w
          Length = 330

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 50/105 (47%), Gaps = 17/105 (16%)

Query: 80  CKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLLY 139
           C+ C   KP R+ HC  C  C+ + DHHC W  NCVG  N+ +F  FL     +   LL 
Sbjct: 136 CRTCKQVKPARSKHCTVCNSCIYLADHHCVWINNCVGMGNYMYFYSFL----CSNLLLLS 191

Query: 140 FLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLTISLL 184
           +   R++F+          FNKS       TTP     LL +S+L
Sbjct: 192 YSFIRLIFIQ---------FNKSAY----NTTPTGEKSLLILSIL 223

>ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {ON}
           similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 330

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 34/57 (59%)

Query: 80  CKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTY 136
           C+ C   KP R+ HC  C QCVL +DHHC W  NCVG  N+ +F  FL    ++ +Y
Sbjct: 135 CRTCQLPKPARSKHCNVCNQCVLAVDHHCIWINNCVGLGNYLYFYLFLVLNSLSMSY 191

>Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W
           (ERF2) - Mutation has an Effect on Ras Function [contig
           251] FULL
          Length = 353

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 30/49 (61%)

Query: 79  YCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFL 127
           YC  C  ++P R  HC  C  C+L  DHHC W  NC+G +N+ +FL FL
Sbjct: 172 YCPTCRIWRPPRASHCSVCGACILNHDHHCKWVNNCIGQRNYRYFLTFL 220

>Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 64.3 bits (155), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 36/65 (55%), Gaps = 3/65 (4%)

Query: 80  CKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYL-- 137
           C  C   K  R+ HC  C +CVL+ DHHC W  NC+G  N+  F  FLF  I + +Y   
Sbjct: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195

Query: 138 -LYFL 141
            LYF+
Sbjct: 196 RLYFI 200

>YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}
           SWF1Palmitoyltransferase that acts on transmembrane
           proteins, including the SNAREs Snc1p, Syn8p, Tlg1p and
           likely all SNAREs; contains an Asp-His-His-Cys-cysteine
           rich (DHHC-CRD) domain; may have a role in vacuole
           fusion
          Length = 336

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 31/57 (54%)

Query: 80  CKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTY 136
           C  C   KP R+ HC  C +CVL+ DHHC W  NC+G  N+  F  FL   I +  Y
Sbjct: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCY 192

>Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON}
           (35544..36509) [966 nt, 322 aa]
          Length = 321

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 65/140 (46%), Gaps = 16/140 (11%)

Query: 4   KLKYPWMGIAIP-CFLISFIAYTAHYFILLNFLSIGKQIWFE----ISVTMIWISYY--L 56
           K +Y W    +P  +L  ++    +Y + +NF+      WFE    + +    + Y+  +
Sbjct: 43  KERYRWKYYLVPGLYLGLYLFVIIYYHLRVNFMVNPHLYWFEKGLILPIMFTSLPYFGVM 102

Query: 57  AIYTNPGKPGSNYIPPSNQWK---------NYCKKCNAYKPERTHHCKTCQQCVLMMDHH 107
            + T P     + I  +N+++           CK C   KP R+ HC  C +C+L+ DHH
Sbjct: 103 TMITKPENSIEHGINSNNRYRFDEILYFPNVSCKTCRKPKPARSKHCSICDKCILLQDHH 162

Query: 108 CPWTMNCVGYKNFPHFLRFL 127
           C W  NC+G  N+  F  F+
Sbjct: 163 CIWVNNCIGMGNYKWFYLFI 182

>Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {ON}
           YDR126W (PSL10) - Hypothetical ORF [contig 174] FULL
          Length = 338

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 55/115 (47%), Gaps = 13/115 (11%)

Query: 42  WFEISVTMIWISYYLAIYTNPGKPGSNYI-PPSNQWKNY-------CKKCNAYKPERTHH 93
           WF I V ++       + T   KP S YI PP +Q+          C+ C   K  R+ H
Sbjct: 86  WFIIPVALM-TPISCGLLTMLVKPESTYIAPPVDQFDGILFHAGVECRTCKMPKYARSKH 144

Query: 94  CKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLLYFLISRIVFL 148
           C  C +C  + DHHC W  NC+G  N+ +F  FL     +  +L  +  +R+++L
Sbjct: 145 CAICGRCTQLADHHCVWANNCIGKGNYEYFYLFL----ASNVFLTVYGFTRLLYL 195

>KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} similar
           to uniprot|Q04629 Saccharomyces cerevisiae YDR126W SWF1
           Spore Wall Formation
          Length = 324

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 33/57 (57%)

Query: 80  CKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTY 136
           C+ C   K  R+ HC  C++C+ + DHHC W  NCVGY N+ +F  FL    +  TY
Sbjct: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNCLLLTY 185

>Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii AGR065W
          Length = 340

 Score = 61.2 bits (147), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 77/155 (49%), Gaps = 16/155 (10%)

Query: 80  CKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLLY 139
           C+ C   K  R+ HC  C +C+L+ DHHC W  NC+G  N+ +F  FL    ++   +L 
Sbjct: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFL----LSNCSMLS 188

Query: 140 FLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLTISLLFIRCTVNQLLSGRTQ 199
           +   R+     S   PS L+ +S   FL++   +  F +++IS  ++     Q    R  
Sbjct: 189 YATIRL-----SSVAPSGLW-RSNKSFLSLMILVCCFAVISISFTYM-----QFALVRDG 237

Query: 200 IETWENERLESLFYLRRLKPQL-ISNLWEFHPELK 233
           + T E ++  ++  L R +  L ++N  +F+  +K
Sbjct: 238 MTTNEKDKWYTIHKLMRNEQLLKLNNDCKFYIRIK 272

>Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 32/57 (56%)

Query: 80  CKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTY 136
           C  C+  KP R+ HC  C +C+L+ DHHC W  NC+G  N+  F  FL   I +  Y
Sbjct: 136 CSTCHIIKPARSKHCSICNRCILVADHHCIWVNNCIGKGNYLQFYLFLISNIFSLLY 192

>TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.579
           YDR459C
          Length = 386

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 60/123 (48%), Gaps = 6/123 (4%)

Query: 80  CKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLLY 139
           C +C + K ERTHH      CV   DH+C W    +G  N+  FL+F+ +  +  + +  
Sbjct: 123 CSECQSLKLERTHHSSAMGHCVPRFDHYCVWVGTVIGKDNYLLFLQFVAYYAINLSIIWV 182

Query: 140 FLISRIVFLWKSR-NLPSYLFNKSEIIFLTITTPMDGFVLLTISLLFIRCTVNQLLSGRT 198
            ++S I  + + R N P + FN + II L     + G+ L T+ L F    +  +   RT
Sbjct: 183 SIVSYIHMIIRKRPNQPHHHFNTNLIIILVFA--ILGW-LFTVGLFF--ANIYYISKNRT 237

Query: 199 QIE 201
            +E
Sbjct: 238 SLE 240

>Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa]
           {ON} complement(123368..124456) [1089 nt, 363 aa]
          Length = 362

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 77/171 (45%), Gaps = 25/171 (14%)

Query: 74  NQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVT 133
           N +  +C  C + K  RTHH K    C+   DHHC W    +G  N+  F +F+F+    
Sbjct: 118 NGYPIWCDTCKSLKIGRTHHSKRLGYCIPRFDHHCMWVGTVIGKSNYLLFTQFVFYF--- 174

Query: 134 TTYLLYFLISRIVFLWKSRNLP--SYLFNKSEIIFLTITTPMDGFVLLTISLLFIRCTVN 191
           +  LL F IS + ++ +  + P   Y  + + I+ L ++ P   F ++T+SL      V 
Sbjct: 175 SCLLLIFWISIVSYIKRIVDYPHTGYKLDPNLIVILILSVP---FSIMTLSLFL--SHVY 229

Query: 192 QLLSGRTQIETWENERLESL---------------FYLRRLKPQLISNLWE 227
                RT +E    +R + L                Y+  + P+ ++N+W+
Sbjct: 230 FTFMNRTSLEIINIKRNKKLNIKKFVCYLDKTSGNRYVIEMSPEDMANIWK 280

>KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON}
           Anc_8.286 YDR126W
          Length = 331

 Score = 58.2 bits (139), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 16/107 (14%)

Query: 52  ISYYLAIYTNP---GKPGSNYIPPSNQW---------KNYCKKCNAYKPERTHHCKTCQQ 99
           +S  L ++T P   G       P   QW            C+ C+  K  R+ HC  C++
Sbjct: 99  VSGLLTMFTRPEGCGGRDQGVAPSEGQWPYDGILYYPNTTCRSCHTVKWARSKHCSICRR 158

Query: 100 CVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTY----LLYFLI 142
           C+ + DHHC W   C+G  NF +F  FL    +  TY    L +F++
Sbjct: 159 CIQLADHHCIWFNTCIGRGNFFYFYVFLACHCLILTYAFARLFFFVV 205

>AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR126W (SWF1)
          Length = 326

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 26/44 (59%)

Query: 80  CKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHF 123
           C+ C   KP R+ HC  C +CV + DHHC W  NCVG  N+  F
Sbjct: 126 CRTCRVRKPARSRHCGVCGRCVPLADHHCVWLNNCVGRGNYGLF 169

>Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459C -
           Hypothetical ORF [contig 196] FULL
          Length = 356

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 46/94 (48%)

Query: 60  TNPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKN 119
           T   KP   Y      +  +C  C + K  RTHH  T   C+   DH+C W    VG KN
Sbjct: 105 TRSIKPPRIYQCDPQGYPIWCTACQSLKSNRTHHSSTLGYCIPRFDHYCVWIGTIVGRKN 164

Query: 120 FPHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRN 153
           +  F++F F+  + T Y++  + S +  + KSR+
Sbjct: 165 YRLFVQFAFYFWLFTIYMIASIASFLRRIIKSRS 198

>KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.579
           YDR459C
          Length = 370

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 55/131 (41%), Gaps = 2/131 (1%)

Query: 65  PGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFL 124
           P   Y   SN +  +C  C   K  R+HH      C+   DH+C W    +G  N+  F+
Sbjct: 104 PAKLYQCDSNGYPRWCSNCEGLKSLRSHHSSVANYCIPRFDHYCIWLGTTIGKDNYKQFV 163

Query: 125 RFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLTISLL 184
            FLF+   T ++ + ++ + + +L   R+          ++ L I   M  F +  + L 
Sbjct: 164 IFLFY--CTVSFGIMWISAIVCYLKYGRHYQEQNNFDGNLVTLVILGAMGWFFVAGLLLA 221

Query: 185 FIRCTVNQLLS 195
            I   V  L S
Sbjct: 222 HISYMVRNLTS 232

>ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 365

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 67/151 (44%), Gaps = 7/151 (4%)

Query: 59  YTNPGKPGSN--YIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVG 116
           Y N G  GS+  Y    N +  +C  C + K ER HH +    CV   DH C +  + +G
Sbjct: 104 YQNHGSDGSSICYQCDPNGYPIWCTNCQSLKTERAHHSRELGHCVPKFDHKCTYLGSIIG 163

Query: 117 YKNFPHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGF 176
             N+  F+++  ++ +    +   +++ I  + +         N + I  L +TT    F
Sbjct: 164 KDNYRLFVQYCVFMTIWLAIIWTSIVAYIRSITRDYRGHGSHLNGNLIAILILTTL---F 220

Query: 177 VLLTISLLFIRCTVNQLLSGRTQIETWENER 207
            +   SLL  +  +N ++  +T IE  E  R
Sbjct: 221 WITVTSLLLTQ--LNCIVKNKTSIEVMERRR 249

>KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 367

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 60/130 (46%), Gaps = 8/130 (6%)

Query: 79  YCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLL 138
           +C  C + K  RTHH  T   C+   DH+C W    VG KN+  F++F F+      + +
Sbjct: 131 WCTACQSIKANRTHHSSTLGYCIPRFDHYCVWIGTVVGRKNYRLFVQFAFYF---WAFAI 187

Query: 139 YFLISRIVFLWK-SRNLPSYLFNKSEIIFLTITTPMDGFVLLTISLLFIRCTVNQLLSGR 197
           + ++S   FL K  R+ P        I+   I   + G   L +  LF+  T   +++ R
Sbjct: 188 FVIVSTASFLPKIIRSQPHVPRVNPNIL---IMMGLCGMATLMVGPLFLAHTYYMMVN-R 243

Query: 198 TQIETWENER 207
           T +E    +R
Sbjct: 244 TSLEIIATKR 253

>NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {ON}
           Anc_5.579 YDR459C
          Length = 374

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 3/85 (3%)

Query: 64  KPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHF 123
           KP   Y    N +  +C  C + K  R+HH K   +C+L  DH+C W    +   N+  F
Sbjct: 102 KPPKYYQCDKNGYPPWCTHCQSLKLSRSHHSKQVGRCILRFDHYCAWIGCVIARNNYRLF 161

Query: 124 LRFLFWVIVTTTYLLYFLISRIVFL 148
           L+++ W       LL++ ++  VF+
Sbjct: 162 LQYVGWF---NLLLLWYWLTIAVFI 183

>KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {ON}
           Anc_5.579 YDR459C
          Length = 354

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 36/74 (48%), Gaps = 2/74 (2%)

Query: 59  YTNP--GKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVG 116
           +T+P   KP   Y    N +  +C  C + K  RTHH      CV   DH+C W    +G
Sbjct: 103 FTSPQVNKPPLIYQCDENGYPTWCAHCQSVKSLRTHHSGRTGSCVFKFDHYCGWLGTLIG 162

Query: 117 YKNFPHFLRFLFWV 130
             N+  F++FL ++
Sbjct: 163 AGNYLLFIQFLVYM 176

>Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}
           similar to Ashbya gossypii ABR203W
          Length = 372

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 55/120 (45%), Gaps = 8/120 (6%)

Query: 79  YCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWV---IVTTT 135
           +C  C + K ER+HH +  + CV   DH+C W    +G KN+  F++++ +    +VT +
Sbjct: 126 WCSTCQSLKIERSHHSELLKYCVPRFDHYCVWLGTVIGRKNYKLFMQYVMYFTIYLVTAS 185

Query: 136 YLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFV--LLTISLLFIRCTVNQL 193
             +   + RIV   K  +L     N + I+   +      FV  L  +   ++ C    L
Sbjct: 186 LTIALFMKRIVDYNKEHDLT---LNLNIIVLFILVLAFAFFVTPLFAVFSFYMSCNRTSL 242

>TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {ON}
           Anc_5.579 YDR459C
          Length = 365

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 61  NPGKPGSNYIPP----SNQWKN--YCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNC 114
           +P +   + +PP    S    N  +C  C++ K ER HH    + CV   DH C W    
Sbjct: 102 DPAETAHSLVPPVCYQSCPRGNPIWCSACDSVKTERAHHSSDMEYCVPRFDHKCAWLGAV 161

Query: 115 VGYKNFPHFLRFLFWVIVTTTYLL 138
           +G  N+  F++F+ ++ + + ++ 
Sbjct: 162 IGRDNYRFFIQFVMYMAILSLFVF 185

>Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {ON}
           YDR459C (REAL)
          Length = 378

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 58/124 (46%), Gaps = 11/124 (8%)

Query: 65  PGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFL 124
           P   Y    N +  +C  C + K ER+HH      C+   DH+C W    +G  N+  F+
Sbjct: 116 PPKCYQSDPNGYPIWCSPCQSLKMERSHHSSELGHCIPRFDHYCVWIGTIIGRDNYRPFV 175

Query: 125 RFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEI----IFLTITTPMDGFVLLT 180
           +F  +    ++ LL   +S  VF+   RN+  +  N +      +FLT+   + G+ L T
Sbjct: 176 QFTGYF---SSLLLIMWVSICVFI---RNITQHHHNHNSPLNANVFLTLAFAIFGW-LFT 228

Query: 181 ISLL 184
            S+L
Sbjct: 229 TSML 232

>SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 364

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 33/66 (50%), Gaps = 6/66 (9%)

Query: 80  CKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLLY 139
           C  C + K ERTHH  T   CV   DH+C W    VG KN+  F++F  +      +  Y
Sbjct: 127 CSMCQSLKMERTHHSATLGYCVPRFDHYCVWIGTVVGRKNYRLFIQFSMY------FFFY 180

Query: 140 FLISRI 145
           F+I  I
Sbjct: 181 FVIVLI 186

>TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {ON}
           Anc_5.626 YOR034C
          Length = 739

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 47/104 (45%), Gaps = 13/104 (12%)

Query: 43  FEISVTMIWISYYLAIYTNPGKPGSNYIPPSNQ-------------WKNYCKKCNAYKPE 89
           F +S+  +   +Y  I +NPG+   N+   S +              +++C +    KP 
Sbjct: 418 FGVSIIGVIYEFYKLIRSNPGRKNRNHDMESVRKTIQTLMELGKFDIRHFCLETWVRKPL 477

Query: 90  RTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVT 133
           R+      Q  V   DH+CPW  N +G +N   F+ F+F+  VT
Sbjct: 478 RSKFSYLNQSVVNRYDHYCPWVYNDIGLRNHKRFIMFIFFSEVT 521

>NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {ON}
           Anc_5.579 YDR459C
          Length = 406

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%)

Query: 64  KPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHF 123
           KP   Y    N +  +C  C + K ER HH +    C+   DH+C W    +G  N+  F
Sbjct: 101 KPPLYYQCDPNGYPIWCTYCQSLKLERVHHSRQLGYCIFRFDHYCAWIGTVIGRNNYRLF 160

Query: 124 LRFLFW 129
           ++++F+
Sbjct: 161 IQYVFY 166

>CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459c
          Length = 352

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 52/108 (48%), Gaps = 8/108 (7%)

Query: 79  YCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLL 138
           +C  C + K  RT H      CV   DH+C W    +G+KN+  F++F+F+  V    L+
Sbjct: 115 WCSNCQSLKVGRTKHSSHQGHCVPRFDHYCVWLGAVIGFKNYRLFVQFVFYFAVL---LM 171

Query: 139 YFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLTISLLFI 186
              I+  V++   R   + L N + I+ L I+    G   L  S LF+
Sbjct: 172 IVWITISVYIRDIRQYHARL-NANLIVLLIIS----GIGWLMTSGLFV 214

>YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}
           PFA5Palmitoyltransferase with autoacylation activity;
           likely functions in pathway(s) outside Ras; member of a
           family of putative palmitoyltransferases containing an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain
          Length = 374

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 55/107 (51%), Gaps = 5/107 (4%)

Query: 79  YCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLL 138
           +C +C + K ERTHH      C+   DH+C W    +G  N+  F++F  +    +T LL
Sbjct: 130 WCSECQSLKMERTHHSSELGHCIPRFDHYCMWIGTVIGRDNYRLFVQFAAYF---STLLL 186

Query: 139 YFLISRIVFLW-KSRNLPSYLFNKSEIIFLTITTPMDGFVLLTISLL 184
              +S  V++   +++  +Y  N +  I  T+   + G+ LLT SLL
Sbjct: 187 IMWVSICVYIRIITQHNHNYSPNLNANIISTLVFAILGW-LLTASLL 232

>Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {ON}
           YDR459C (REAL)
          Length = 380

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%)

Query: 79  YCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFL 127
           +C  C + K ERTHH      CV   DH+C W    +G  N+  F++F+
Sbjct: 131 WCSPCQSLKTERTHHSSELGHCVPRFDHYCMWAGTVIGRDNYRLFVQFV 179

>KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} similar
           to uniprot|Q03289 Saccharomyces cerevisiae YDR459C
           likely functions in pathway(s) outside Ras
          Length = 349

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 48/117 (41%)

Query: 57  AIYTNPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVG 116
           A+  N   P   Y      +  +C  C + K  RTHH      CV   DH+C W    +G
Sbjct: 105 AVPDNSIAPPDIYPCDERGYPIWCSNCQSLKMSRTHHSTKVGYCVPRFDHYCVWIGTVLG 164

Query: 117 YKNFPHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPM 173
             N+  F++F F++ +    L+  + +++  +  S N   Y         L +  P+
Sbjct: 165 RLNYKLFVQFTFYLDLVVLILMISIATQMRQMKGSANGNVYAVFALACCALLMAGPL 221

>NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa]
           {ON} Anc_5.626
          Length = 757

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 33/67 (49%), Gaps = 4/67 (5%)

Query: 77  KNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTY 136
           KN+C +    KP R+H        V   DH CPW  N +G KN  +F+    W I+ T  
Sbjct: 454 KNFCLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFM----WFILLTEV 509

Query: 137 LLYFLIS 143
            ++F IS
Sbjct: 510 GIWFFIS 516

>Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}
           complement(77926..80259) [2334 nt, 778 aa]
          Length = 777

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 73/174 (41%), Gaps = 16/174 (9%)

Query: 77  KNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTT-- 134
            N+C + +  KP R+ +       V   DH CPW  N +G KN   F+ F+  +++    
Sbjct: 476 NNFCIESSVRKPLRSRYSYLNSAIVTRFDHFCPWIYNDIGLKNHKLFVLFIILMVIGIWE 535

Query: 135 -TYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLTISL-------LFI 186
            TYL       +  L+K  +   +L    E+    +T     F ++  SL       + I
Sbjct: 536 YTYLAMEYFDELEDLYK--DASCFLLGDDELC-AGLTYGTFTFFIMIWSLFQSIWVSILI 592

Query: 187 RCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK 240
                Q+  G T   ++E  ++     +R  KP  +++ +   P+  T  N+A+
Sbjct: 593 FVQTFQMFKGVT---SYEFSKIVKGSRVRNPKPSRVNDTFNTTPDGYTSGNDAE 643

>Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {ON}
           YDR459C (REAL)
          Length = 388

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%)

Query: 79  YCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFL 127
           +C  C + K ERTHH      CV   DH+C W    +G  N+  F++F+
Sbjct: 136 WCSPCQSLKMERTHHSSELGHCVPRFDHYCLWVGTVIGRDNYRLFVQFV 184

>Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON}
           YDR264C (REAL)
          Length = 763

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 26/51 (50%)

Query: 77  KNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFL 127
           KN+C +  A KP R+         V   DH+CPW  N VG KN   F+ F+
Sbjct: 468 KNFCIETWARKPLRSRFSSLNNAVVARFDHYCPWIFNDVGLKNHKGFMFFI 518

>NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.626
           YDR264C
          Length = 786

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 27/54 (50%)

Query: 77  KNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWV 130
           KN+C +    KP R+ +       V   DH CPW  N VG KN  +F+ F+  V
Sbjct: 471 KNFCLESWTRKPLRSKYSHLNNALVARFDHFCPWIYNDVGLKNHKNFIGFILLV 524

>KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.626
           YOR034C
          Length = 682

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 41/86 (47%), Gaps = 2/86 (2%)

Query: 79  YCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLL 138
           +C K    KP R    K  QQ V   DH+C W  N VG KN  H L   F +++ T  + 
Sbjct: 404 FCLKTWIRKPVRCSLSKLNQQQVARFDHYCAWIYNDVGLKN--HKLYIFFLILLETFLMT 461

Query: 139 YFLISRIVFLWKSRNLPSYLFNKSEI 164
           + +++   F    +    +LFN++ I
Sbjct: 462 FGVLNWRYFGLMEKTAECFLFNRTII 487

>Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%)

Query: 77  KNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFL 127
           KN+C +    KP R+         V   DH+CPW  N VG KN   F+ F+
Sbjct: 469 KNFCIETWTRKPLRSKFSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR459C
          Length = 359

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 39/85 (45%), Gaps = 6/85 (7%)

Query: 79  YCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLL 138
           +C  C + K  RTHH      CV  +DH+C W    +G +N+  F +FL        +L+
Sbjct: 121 WCSVCQSLKGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLFNQFLM------CFLM 174

Query: 139 YFLISRIVFLWKSRNLPSYLFNKSE 163
           + LI  +  +   R + S    + E
Sbjct: 175 HALIIFVSVVSLQRRIASSARMRGE 199

>TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626
           YOR034C
          Length = 759

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 25/52 (48%)

Query: 77  KNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLF 128
            N+C +    KP R+ +       V   DH+CPW  N VG KN   FL F+ 
Sbjct: 461 SNFCIETLTRKPLRSRYSYMNNALVSRFDHYCPWVYNDVGLKNHKTFLFFIL 512

>Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%)

Query: 77  KNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFL 127
           K++C +    KP R+ +       V   DH+CPW  N VG KN   F+ F+
Sbjct: 469 KSFCIETWTRKPLRSKYSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}
           AKR1Palmitoyl transferase involved in protein
           palmitoylation; acts as a negative regulator of
           pheromone response pathway; required for endocytosis of
           pheromone receptors; involved in cell shape control;
           contains ankyrin repeats
          Length = 764

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%)

Query: 77  KNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFL 127
           KN+C +    KP R+         V   DH+CPW  N VG KN   F+ F+
Sbjct: 469 KNFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 759

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 25/54 (46%)

Query: 77  KNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWV 130
           KN+C +    KP R+         V   DH+CPW  N +G +N   FL  +  V
Sbjct: 461 KNFCIETWVKKPLRSRFSSLSNSLVARFDHYCPWVYNDIGLRNHKAFLMCILLV 514

>KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa]
           {ON} Anc_5.626 YOR034C
          Length = 752

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 46/103 (44%), Gaps = 13/103 (12%)

Query: 41  IWFEISVTMIWISYYLAIYTNPG--KPGSNYIPPSNQ-----------WKNYCKKCNAYK 87
           I F   +  + + ++  +Y++PG  +P +++    N+            KN+C +    K
Sbjct: 408 ILFVAVLGCVHLLFFQLVYSDPGVLEPETDFNEIRNKISELLKIGKFDTKNFCIETWQRK 467

Query: 88  PERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWV 130
           P R        + VL  DH+CPW  N VG  N   F+ ++  V
Sbjct: 468 PLRCKFSSFHSRLVLRFDHYCPWVYNDVGLLNHKKFMYYVMSV 510

>KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 734

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 27/55 (49%)

Query: 77  KNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVI 131
           +++C      KP R+   +  +  ++  DH CPW  N VG  N   F+ FL  ++
Sbjct: 451 RHFCVDTYKRKPLRSKFSRFNEALIVRFDHFCPWIYNDVGLLNHKQFIYFLLSLV 505

>CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264c
           ankyrin repeat-containing protein
          Length = 763

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 39/89 (43%), Gaps = 13/89 (14%)

Query: 53  SYYLAIYTNPGKPGS------------NYIPPSN-QWKNYCKKCNAYKPERTHHCKTCQQ 99
           S +L  +++PG  GS            N +       +++C +    KP R+ +      
Sbjct: 416 SLFLLAFSDPGHIGSENDHEKIRETISNLLKEGKFDTRSFCLETWVRKPLRSKYSYLNDA 475

Query: 100 CVLMMDHHCPWTMNCVGYKNFPHFLRFLF 128
            +L  DH+CPW  N VG KN   F+ F+ 
Sbjct: 476 LILRFDHYCPWIYNDVGLKNHKLFIFFIL 504

>Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}
           YOR034C (REAL)
          Length = 730

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%)

Query: 78  NYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWV 130
           N+C +    KP R+ +       V   +H+CPW  N +G KN   F+ F F V
Sbjct: 429 NFCVETLERKPLRSKYSLFSGALVARFNHYCPWVYNDIGLKNHKLFMFFAFSV 481

>YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON}
           AKR2Ankyrin repeat-containing protein similar to Akr1p;
           member of a family of putative palmitoyltransferases
           containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD)
           domain; possibly involved in constitutive endocytosis of
           Ste3p
          Length = 749

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 3/65 (4%)

Query: 77  KNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTY 136
           +N+C +    KP R+ +       V   DH+CPW  N VG KN  H L F+F+ +    +
Sbjct: 445 ENFCVETLERKPLRSKYSFFSGALVARYDHYCPWIYNDVGLKN--HKL-FVFFAVTVQYH 501

Query: 137 LLYFL 141
           +  F+
Sbjct: 502 MFLFM 506

>TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {ON}
           Anc_5.626 YOR034C
          Length = 750

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 27/57 (47%)

Query: 77  KNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVT 133
           +++C +    KP R+         +   DH+CPW  N VG KN   FL F+  + V 
Sbjct: 459 RHFCIESWIRKPLRSRFSSLNGTLIARFDHYCPWIYNDVGLKNHKRFLYFVALIEVA 515

>KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.626
           YOR034C
          Length = 757

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 26/54 (48%)

Query: 77  KNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWV 130
           +N+C +    KP R+         V   DH+CPW  N +G KN   F+ F+  V
Sbjct: 460 RNFCIETWIRKPLRSKFSTFYNSTVSRFDHYCPWVYNDIGLKNHKIFIFFIISV 513

>Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {ON}
           YOR034C (REAL)
          Length = 744

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 49/118 (41%), Gaps = 16/118 (13%)

Query: 37  IGKQIWFEISVTMIWISYYLAIYTNPG--KPGSNYIPPSNQWK-----------NYCKKC 83
           I K + F ++  + +I +   + ++PG  K   + I      K           N+C + 
Sbjct: 389 IMKNVQFLVTSLLTFILFLKLVRSDPGCLKTDDSLISIQETIKQLIQLGKFDRENFCVET 448

Query: 84  NAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLLYFL 141
              KP R+         V   DH CPW  N +G KN  H L FLF+ +    ++  F+
Sbjct: 449 LERKPLRSKFSPFSGALVARYDHFCPWVYNDIGLKN--HKL-FLFFALTVQYHMFLFM 503

>SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {ON}
           uniprot|Q875S9 Saccharomyces kluyveri AKR1
           Palmitoyltransferase AKR1
          Length = 737

 Score = 37.7 bits (86), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 3/65 (4%)

Query: 77  KNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTY 136
           K++C      KP R+      +  V   DH CPW  N +G +N      FLF+++   T 
Sbjct: 449 KHFCISTWVRKPIRSKFSNFSRALVTRFDHFCPWIYNDIGLRNHK---TFLFFILCLETC 505

Query: 137 LLYFL 141
           +  FL
Sbjct: 506 IFVFL 510

>AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR264C
           (AKR1) and YOR034C (AKR2)
          Length = 724

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 25/50 (50%)

Query: 77  KNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRF 126
           K++C       P R  + +     +L  DH+CPW  N +G++N   F+ F
Sbjct: 445 KHFCIHSWIRLPLRAKYKRFVHSVILRYDHYCPWIYNYIGFRNHKIFIYF 494

>Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {ON}
           YOR034C (REAL)
          Length = 741

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 2/71 (2%)

Query: 77  KNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTY 136
           +N+C +    K  R+ +       V   DH+CPW  N +G KN  H L   F + V    
Sbjct: 439 ENFCVETLERKSLRSKYSVFSGALVARFDHYCPWIYNDIGLKN--HKLSLFFAMTVQYHM 496

Query: 137 LLYFLISRIVF 147
            L+  +S   F
Sbjct: 497 FLFMWLSLAYF 507

>Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar to
           Ashbya gossypii AER388C
          Length = 739

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 26/54 (48%)

Query: 77  KNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWV 130
           K++C       P R+ +       +   DH+CPW  N +G+ N   FL F+ ++
Sbjct: 453 KHFCIHSWVRIPLRSKYKTARNVLIARYDHYCPWVYNQIGFCNHKIFLFFIMFL 506

>AFR738C Chr6 complement(1793162..1795600) [2439 bp, 812 aa] {ON}
           NOHBY664; No homolog in Saccharomyces cerevisiae
          Length = 812

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 1/60 (1%)

Query: 21  FIAYTAHYF-ILLNFLSIGKQIWFEISVTMIWISYYLAIYTNPGKPGSNYIPPSNQWKNY 79
           F A T+H F I+LN    GK + FE+S    W    + +Y   G  G  Y    N++ N+
Sbjct: 316 FAAITSHLFLIILNPYGTGKAVLFEVSYQSNWRYLEIVLYVLIGAAGGVYGALFNKFVNF 375

>KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264C AKR1
           Palmitoyl transferase involved in protein palmitoylation
          Length = 752

 Score = 31.2 bits (69), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 2/56 (3%)

Query: 77  KNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIV 132
           K++C       P R+ + +     +   DH CPW  N +G  N  H L ++F V++
Sbjct: 465 KHFCVHTWIRIPLRSKYDRDSACLISAFDHFCPWVYNQIGLLN--HKLFYMFVVLL 518

>CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q07959 Saccharomyces cerevisiae
           YLR023c
          Length = 545

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 29/62 (46%), Gaps = 9/62 (14%)

Query: 190 VNQLLSGRTQIETWENERLESLFYLRRLK-----PQLISNLW----EFHPELKTPDNEAK 240
           V+Q       +  W+   L+++  +R+       P+ I N W     +  EL+ PDN+AK
Sbjct: 11  VSQYFDFEPSLHKWKQRGLDNIHRVRQTGRNVRYPRFIHNTWNSLTSYTDELRAPDNDAK 70

Query: 241 AE 242
           A 
Sbjct: 71  AR 72

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.142    0.472 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,412,390
Number of extensions: 1844783
Number of successful extensions: 6274
Number of sequences better than 10.0: 141
Number of HSP's gapped: 6298
Number of HSP's successfully gapped: 141
Length of query: 378
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 267
Effective length of database: 40,753,473
Effective search space: 10881177291
Effective search space used: 10881177291
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 66 (30.0 bits)