Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1037.226.29ON1496117257770.0
ZYRO0C07524g6.29ON1670119035280.0
TDEL0G044006.29ON1490115035150.0
TPHA0J004006.29ON1512116534740.0
NCAS0D021306.29ON1434114532720.0
SAKL0E01540g6.29ON1415113632360.0
KAFR0A051206.29ON1479116632320.0
KNAG0F029206.29ON1492112731820.0
ACL004W6.29ON1377116831800.0
YOL004W (SIN3)6.29ON1536115831620.0
CAGL0E02475g6.29ON1493122730800.0
NDAI0C026606.29ON1657113730130.0
TBLA0E031606.29ON173991729910.0
Smik_15.1666.29ON1566101529440.0
Suva_15.1716.29ON1561101829230.0
Ecym_30336.29ON1474101329060.0
Skud_15.1586.29ON155598028920.0
KLLA0C06182g6.29ON151997728640.0
Kwal_56.224626.29ON154197428490.0
KLTH0C10956g6.29ON1433103428440.0
CAGL0J11594g6.29ON9377718643e-97
Kpol_1064.538.403ON48969791.6
CAGL0I08415g7.519ON1308100792.2
KLLA0C12771g2.582ON100931755.9
KLLA0C06336g8.854ON51992746.0
KNAG0D002506.363ON65596746.8
Suva_8.2618.623ON75664747.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1037.22
         (1496 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON} (46639...  2229   0.0  
ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} simil...  1363   0.0  
TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6....  1358   0.0  
TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {O...  1342   0.0  
NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6....  1264   0.0  
SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] ...  1251   0.0  
KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_...  1249   0.0  
KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6....  1230   0.0  
ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic h...  1229   0.0  
YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Comp...  1222   0.0  
CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} simil...  1191   0.0  
NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {...  1165   0.0  
TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6....  1156   0.0  
Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL00...  1138   0.0  
Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL00...  1130   0.0  
Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON} ...  1123   0.0  
Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL00...  1118   0.0  
KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} simil...  1107   0.0  
Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] ...  1102   0.0  
KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} simil...  1100   0.0  
CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa...   337   3e-97
Kpol_1064.53 s1064 (95468..96937) [1470 bp, 489 aa] {ON} (95468....    35   1.6  
CAGL0I08415g Chr9 (820773..824699) [3927 bp, 1308 aa] {ON} some ...    35   2.2  
KLLA0C12771g Chr3 (1081988..1085017) [3030 bp, 1009 aa] {ON} sim...    33   5.9  
KLLA0C06336g Chr3 (561371..562930) [1560 bp, 519 aa] {ON} highly...    33   6.0  
KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363...    33   6.8  
Suva_8.261 Chr8 (472765..475035) [2271 bp, 756 aa] {ON} YOR208W ...    33   7.1  

>Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON}
            (46639..51129) [4491 nt, 1497 aa]
          Length = 1496

 Score = 2229 bits (5777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1091/1172 (93%), Positives = 1091/1172 (93%)

Query: 312  ESKKPAVLQVSNTNTGISSPSSTIPAGTVPGTTVANNIQGTTQIEKPADVEFSQAVSYVN 371
            ESKKPAVLQVSNTNTGISSPSSTIPAGTVPGTTVANNIQGTTQIEKPADVEFSQAVSYVN
Sbjct: 312  ESKKPAVLQVSNTNTGISSPSSTIPAGTVPGTTVANNIQGTTQIEKPADVEFSQAVSYVN 371

Query: 372  KIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNAXXXXXXXXXXXXXSSP 431
            KIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNA             SSP
Sbjct: 372  KIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNAPDLLDDFKKFLPDSSP 431

Query: 432  SVTTXXXXXXXXXXXXXXXXXMYGVNNGYYQAGKIPSANQNLPPLGNFSPPSNGAVPGRP 491
            SVTT                 MYGVNNGYYQAGKIPSANQNLPPLGNFSPPSNGAVPGRP
Sbjct: 432  SVTTQQPVQPQQQALPQQQQPMYGVNNGYYQAGKIPSANQNLPPLGNFSPPSNGAVPGRP 491

Query: 492  EEFSTEAQHHMMALPSMLQAPTEHAQLHAQQHIAPMTNEAIPISDLRSQIIDNNHVHNYT 551
            EEFSTEAQHHMMALPSMLQAPTEHAQLHAQQHIAPMTNEAIPISDLRSQIIDNNHVHNYT
Sbjct: 492  EEFSTEAQHHMMALPSMLQAPTEHAQLHAQQHIAPMTNEAIPISDLRSQIIDNNHVHNYT 551

Query: 552  PIELAXXXXXXXXXXXXXXXXXXXXXXLEAAYATEGIVRPEIDLDXXXXXXXXXXXXXXX 611
            PIELA                      LEAAYATEGIVRPEIDLD               
Sbjct: 552  PIELAQLQQQQQQQQQQQQQQQQQQMQLEAAYATEGIVRPEIDLDPSIVPVIPEPTEPIE 611

Query: 612  XXXXXVEEANFFDKAKKFIGNKQVYVEFLKILNLYSQDILSLDDLIEKVDYYLGSNKELF 671
                 VEEANFFDKAKKFIGNKQVYVEFLKILNLYSQDILSLDDLIEKVDYYLGSNKELF
Sbjct: 612  ESLSLVEEANFFDKAKKFIGNKQVYVEFLKILNLYSQDILSLDDLIEKVDYYLGSNKELF 671

Query: 672  DWFKNFVGFQDKPKHIENVVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEV 731
            DWFKNFVGFQDKPKHIENVVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEV
Sbjct: 672  DWFKNFVGFQDKPKHIENVVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEV 731

Query: 732  LNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASK 791
            LNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASK
Sbjct: 732  LNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASK 791

Query: 792  IANMTEEEKQAFKLPIGLGHTSTTIYQKVIRKVYDKERGFEIIDALHEYPSVAVPVVLKR 851
            IANMTEEEKQAFKLPIGLGHTSTTIYQKVIRKVYDKERGFEIIDALHEYPSVAVPVVLKR
Sbjct: 792  IANMTEEEKQAFKLPIGLGHTSTTIYQKVIRKVYDKERGFEIIDALHEYPSVAVPVVLKR 851

Query: 852  LKQKDKEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQSDKKLLTTKQLLAEISSIKV 911
            LKQKDKEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQSDKKLLTTKQLLAEISSIKV
Sbjct: 852  LKQKDKEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQSDKKLLTTKQLLAEISSIKV 911

Query: 912  DQTNKRIHWLTPKPKSQLDYEVKDKRVLFDILRLADVFINHTSSYSNPDKERLRDFLQSY 971
            DQTNKRIHWLTPKPKSQLDYEVKDKRVLFDILRLADVFINHTSSYSNPDKERLRDFLQSY
Sbjct: 912  DQTNKRIHWLTPKPKSQLDYEVKDKRVLFDILRLADVFINHTSSYSNPDKERLRDFLQSY 971

Query: 972  IGLFFSIPIREIKDAVEAAIDNGKQLDENEQXXXXXXXXXRPRDVEICLSDILNRSRYQR 1031
            IGLFFSIPIREIKDAVEAAIDNGKQLDENEQ         RPRDVEICLSDILNRSRYQR
Sbjct: 972  IGLFFSIPIREIKDAVEAAIDNGKQLDENEQNSSKKNSNKRPRDVEICLSDILNRSRYQR 1031

Query: 1032 LKHSLDSSEASLGAVSPGQNEQDDMDEMIRQEAKKPWLLGSLVEEANSQGLIQNRKIYNM 1091
            LKHSLDSSEASLGAVSPGQNEQDDMDEMIRQEAKKPWLLGSLVEEANSQGLIQNRKIYNM
Sbjct: 1032 LKHSLDSSEASLGAVSPGQNEQDDMDEMIRQEAKKPWLLGSLVEEANSQGLIQNRKIYNM 1091

Query: 1092 FANVNMYVFMRNLITIYDRLHEVKDINDVVTKEINGRKVVQFAKDLNLISAQLKNMGLDF 1151
            FANVNMYVFMRNLITIYDRLHEVKDINDVVTKEINGRKVVQFAKDLNLISAQLKNMGLDF
Sbjct: 1092 FANVNMYVFMRNLITIYDRLHEVKDINDVVTKEINGRKVVQFAKDLNLISAQLKNMGLDF 1151

Query: 1152 SGGDSYTQLLLLSKRLIEGDLEHQWFEESLRQAYRNRAFKLYTIDKVIQSLVKHAHAIMT 1211
            SGGDSYTQLLLLSKRLIEGDLEHQWFEESLRQAYRNRAFKLYTIDKVIQSLVKHAHAIMT
Sbjct: 1152 SGGDSYTQLLLLSKRLIEGDLEHQWFEESLRQAYRNRAFKLYTIDKVIQSLVKHAHAIMT 1211

Query: 1212 DSKSSDVMALFEKDRISSSTTSKDQILYRLQTRSHMSTTEHMFRIEYNTKKSSISIQYIA 1271
            DSKSSDVMALFEKDRISSSTTSKDQILYRLQTRSHMSTTEHMFRIEYNTKKSSISIQYIA
Sbjct: 1212 DSKSSDVMALFEKDRISSSTTSKDQILYRLQTRSHMSTTEHMFRIEYNTKKSSISIQYIA 1271

Query: 1272 LDDLTLEEPKTLEDKWKYYITSYSLSHPTEGIPQEEIKIPFLDKVIESEQVHMEDEDDNP 1331
            LDDLTLEEPKTLEDKWKYYITSYSLSHPTEGIPQEEIKIPFLDKVIESEQVHMEDEDDNP
Sbjct: 1272 LDDLTLEEPKTLEDKWKYYITSYSLSHPTEGIPQEEIKIPFLDKVIESEQVHMEDEDDNP 1331

Query: 1332 KYSPEGVSKSNLMIKIDPETYRLEVEPGSFDIFSRKSVNKFPVDVFSESYKVKKQTRRNR 1391
            KYSPEGVSKSNLMIKIDPETYRLEVEPGSFDIFSRKSVNKFPVDVFSESYKVKKQTRRNR
Sbjct: 1332 KYSPEGVSKSNLMIKIDPETYRLEVEPGSFDIFSRKSVNKFPVDVFSESYKVKKQTRRNR 1391

Query: 1392 CKNFLNGKHGWKRQLSSDAISKIEQKFNDLKNGTFQQRSRSATSETTSVPLNASDSTQKE 1451
            CKNFLNGKHGWKRQLSSDAISKIEQKFNDLKNGTFQQRSRSATSETTSVPLNASDSTQKE
Sbjct: 1392 CKNFLNGKHGWKRQLSSDAISKIEQKFNDLKNGTFQQRSRSATSETTSVPLNASDSTQKE 1451

Query: 1452 QESTGTSETSQPALQKVPINSAEPDQEERGND 1483
            QESTGTSETSQPALQKVPINSAEPDQEERGND
Sbjct: 1452 QESTGTSETSQPALQKVPINSAEPDQEERGND 1483

 Score =  328 bits (840), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 165/223 (73%), Positives = 165/223 (73%)

Query: 1   MSQIWXXXXXXXXXXXXXXXXXXXHVVLPSFSNINPEXXXXXXXXXXXXXXXXXXXXXXX 60
           MSQIW                   HVVLPSFSNINPE                       
Sbjct: 1   MSQIWNQNGTSNTSNNENQQQQQQHVVLPSFSNINPENTTNISQQSNNKSTNTTPSSTSN 60

Query: 61  XXXXGVKLENSSSLSRPNLPKTSTTLSVASFDNPLPPAPAAHLXXXXXXXXXXXXADGSY 120
               GVKLENSSSLSRPNLPKTSTTLSVASFDNPLPPAPAAHL            ADGSY
Sbjct: 61  TPNTGVKLENSSSLSRPNLPKTSTTLSVASFDNPLPPAPAAHLQQQQQQQQQQQQADGSY 120

Query: 121 YRPLNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPN 180
           YRPLNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPN
Sbjct: 121 YRPLNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPN 180

Query: 181 LIQGFNTFLPQGYTIECSSNPDDPIKVTTPLGSQIVTNSSIAK 223
           LIQGFNTFLPQGYTIECSSNPDDPIKVTTPLGSQIVTNSSIAK
Sbjct: 181 LIQGFNTFLPQGYTIECSSNPDDPIKVTTPLGSQIVTNSSIAK 223

 Score = 53.5 bits (127), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 40/62 (64%)

Query: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTF 188
           A++Y+ ++K +F  +PDIY HFL+I++ ++ +      V  +V+ LF+  P+L+  F  F
Sbjct: 366 AVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNAPDLLDDFKKF 425

Query: 189 LP 190
           LP
Sbjct: 426 LP 427

 Score = 40.0 bits (92), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 32/48 (66%)

Query: 366 AVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQ 413
           A++Y+ ++K +F  +PDIY HFL+I++ ++ +      V  +V+ LF+
Sbjct: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFR 176

>ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1670

 Score = 1363 bits (3528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 705/1190 (59%), Positives = 855/1190 (71%), Gaps = 52/1190 (4%)

Query: 331  PSSTIPAGTVPG---TTVANNIQGTTQIEKPADVEFSQAVSYVNKIKNRFADQPDIYKHF 387
            P+S + +GT P           Q   Q +K ADVEFSQA+SYVNKIKNRF+DQPDIYKHF
Sbjct: 487  PTSAVSSGTGPTQPEVPAPVQPQLADQTKKAADVEFSQAISYVNKIKNRFSDQPDIYKHF 546

Query: 388  LEILQTYQREQKPISEVYAQVTVLFQNAXXXXXXXXXXXXXSSPSVTTXXXXXXXXXXXX 447
            LEILQTYQREQKPI+EVYAQVTVLFQNA             SS S               
Sbjct: 547  LEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDSSASAAQQQRQQLQPVMQH 606

Query: 448  XXXXXMYGVNNGYYQAGKIPSANQNLPPLGNFSPPSNGAVPGRPEEFSTEAQHHMMALPS 507
                   G   GYY   + P A QNLPPLG+FSPP NG     P ++  E     MALP 
Sbjct: 607  QQAAAATGY--GYYGENQ-PVARQNLPPLGSFSPPPNGTA---PRDYYQEPSQG-MALPP 659

Query: 508  MLQAPTEHAQLHAQQHIAP--MTNEAIPISDLRSQIIDNNHVHNYTPIELAXXXXXXXXX 565
            M    T+ A++    ++    M+N+AIP+S++RS  +        TP+E A         
Sbjct: 660  MTHLETQAAKVTPSHYVMTQGMSNDAIPLSNMRSPTVGAPGAQ--TPVETAPQHPQQYSP 717

Query: 566  XXXXXXXXXXXXXL-------------------------EAAYATEGIVRPEIDLDXXXX 600
                                                   E  Y    + RPEIDLD    
Sbjct: 718  QQAPQPQLPQQQLPPQQQEQSLPPQTIPLTQPSQLGPQQEVQYVDIAV-RPEIDLDPSIV 776

Query: 601  XXXXXXXXXXXXXXXXVEEANFFDKAKKFIGNKQVYVEFLKILNLYSQDILSLDDLIEKV 660
                            VEE +FFDKAKKFIGNKQ+Y EFLKILNLYSQD+L +D L+EKV
Sbjct: 777  PVVPEPTEPIEDSLSLVEETSFFDKAKKFIGNKQLYTEFLKILNLYSQDLLDIDGLVEKV 836

Query: 661  DYYLGSNKELFDWFKNFVGFQDKPKHIENVVHEKHKLDLDLCEACGPSYKKLPKTDTFMP 720
            ++YLG +KELF WFKNFVG+QD+PK+IENV+HEKH+LDLD+CEA GPSYKKLPK+DTFMP
Sbjct: 837  EHYLGGSKELFTWFKNFVGYQDRPKNIENVIHEKHRLDLDMCEASGPSYKKLPKSDTFMP 896

Query: 721  CSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLR 780
            CSGRDEMCWEVLNDEW+GHPVWASEDSGFIAHRKNQYEETLFK+EEERHEYDFYIESNLR
Sbjct: 897  CSGRDEMCWEVLNDEWIGHPVWASEDSGFIAHRKNQYEETLFKVEEERHEYDFYIESNLR 956

Query: 781  TIQTLETIASKIANMTEEEKQAFKLPIGLGHTSTTIYQKVIRKVYDKERGFEIIDALHEY 840
            TIQTLETIASKIANMTEEEK  FKLP GLGHTS TIY+KVIRKVYDKERGFEIIDALHE+
Sbjct: 957  TIQTLETIASKIANMTEEEKANFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEH 1016

Query: 841  PSVAVPVVLKRLKQKDKEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQSDKKLLTTK 900
            P+VAVPVVLKRLKQKD+EWRRAQREWNKVWRELEQKV+FKSLDHLGLTFKQ+DKKLLTTK
Sbjct: 1017 PAVAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTK 1076

Query: 901  QLLAEISSIKVDQTNKRIHWLTPKPKSQLDYEVKDKRVLFDILRLADVFINHTSSYSNPD 960
            QL++EISSIKVDQTNKRIHWLTPKPKSQLDY+  D+ +  DIL L +VF+NHT +YSN D
Sbjct: 1077 QLISEISSIKVDQTNKRIHWLTPKPKSQLDYDFPDREIFCDILSLTEVFLNHTGNYSNSD 1136

Query: 961  KERLRDFLQSYIGLFFSIPIREIKDAVEAAIDNGKQLDE--NEQXXXXXXXXXRPRDVEI 1018
            KERL+DFL+S++ LFFSIP+ E+ D +     + K+  E   ++         RPR++E+
Sbjct: 1137 KERLKDFLKSFLSLFFSIPVSEVNDGLRRRSPSNKEEHEANKKENGTALAHGKRPREIEL 1196

Query: 1019 CLSDILNRSRYQRLKHSLDSSEASLGAVSPG---QNEQDDMDEMIRQEAKKPWLLGSLVE 1075
             L DIL+R++YQ+LK   D  E S+G    G   Q E D+ +E+I+QEAKKPWLLG++VE
Sbjct: 1197 PLRDILHRNKYQKLKLRSDGEEGSIGQSEEGLDEQEEVDEEEEIIKQEAKKPWLLGNIVE 1256

Query: 1076 EANSQGLIQNRKIYNMFANVNMYVFMRNLITIYDRLHEVKDINDVVTKEINGRKVVQFAK 1135
            EAN+QG+I NRK +N+FAN ++YVF R+L T+Y+RL EVK I+  VT+EIN RKV QFAK
Sbjct: 1257 EANAQGIISNRKSFNLFANTSIYVFFRHLTTLYERLIEVKSIDQEVTQEINSRKVSQFAK 1316

Query: 1136 DLNLISAQLKNMGLDFSGGDSYTQLLLLSKRLIEGDLEHQWFEESLRQAYRNRAFKLYTI 1195
            DLNLIS QLKNMGLDF+G D+Y QLL LSKRLIEGD+EHQWFEESLRQAY NRAFK YT+
Sbjct: 1317 DLNLISEQLKNMGLDFAGLDAYEQLLHLSKRLIEGDIEHQWFEESLRQAYNNRAFKFYTV 1376

Query: 1196 DKVIQSLVKHAHAIMTDSKSSDVMALFEKDRISSSTTSKDQILYRLQTRSHMSTTEHMFR 1255
            DKV+Q+LVKHAH I+TD K S++M LFEKDR  ++T++KDQILYR+Q RSHMS TE+MFR
Sbjct: 1377 DKVVQALVKHAHTILTDIKCSEIMVLFEKDRTLATTSAKDQILYRMQARSHMSNTENMFR 1436

Query: 1256 IEYNTKKSSISIQYIALDDLTLEEPKTLEDKWKYYITSYSLSHPTEGIPQEEIKIPFLDK 1315
            IE+N     + IQYIA+DDLTL E K+LEDKWKYY+TSYSLSHPTEGI  E++++PFL+K
Sbjct: 1437 IEFNRISKHVCIQYIAIDDLTLAEAKSLEDKWKYYVTSYSLSHPTEGISHEDLQVPFLEK 1496

Query: 1316 VIESEQVHMEDEDDNPKYSPEGVSKSNLMIKIDPETYRLEVEPGSFDIFSRKSVNKFPVD 1375
            +IESEQ + ED   +PK+SPEGVSKS+L IKIDPETY LEVEPGS D+FSRK+VNKFP++
Sbjct: 1497 IIESEQEYDEDNGGDPKFSPEGVSKSSLRIKIDPETYFLEVEPGSCDVFSRKAVNKFPLE 1556

Query: 1376 VFSESYKVKKQTRRNRCKNFLNGKHGWKRQLSSDAISKIEQKFNDLKN-GTFQQ-RSRSA 1433
              SES+K K   +    + +L+ + GWK+ L + +I  +E+K N +KN GT Q  R++  
Sbjct: 1557 KNSESHKTKVDKKNELIRGYLDSEKGWKKNLDAKSIQSVEEKLNFVKNYGTLQGYRAQEN 1616

Query: 1434 TSETTSVPLNASDSTQKEQESTGTSETSQPALQKVPINSAEPDQEERGND 1483
              E+T+     SD+ +++ +S   ++    A    P N+A    EERG +
Sbjct: 1617 GLESTTKEAPFSDAVERKADSAAQADG---AANGGPSNTA--GVEERGGN 1661

 Score =  203 bits (517), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 109/156 (69%), Gaps = 20/156 (12%)

Query: 83  STTLSVASFDNPLPPA----PAAHLXXXXXXXXXXXXADGS----------------YYR 122
           S  +SVASFDNPLPP+    P+ H                                 YYR
Sbjct: 219 SAGMSVASFDNPLPPSQPSVPSLHYQMLSSQQQQEQKGQDQQQQHQQQQQQIPLHDQYYR 278

Query: 123 PLNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLI 182
           PLNVKDAL+YLEQVK QFNSRPD+YNHFLDIMKDFKSQ+IDTPGVIERVSTLFRGYPNLI
Sbjct: 279 PLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPNLI 338

Query: 183 QGFNTFLPQGYTIECSSNPDDPIKVTTPLGSQIVTN 218
           QGFNTFLPQGY I+CS NPD+PIKVTTP+GS  V  
Sbjct: 339 QGFNTFLPQGYRIDCSQNPDEPIKVTTPMGSSTVAG 374

 Score = 53.5 bits (127), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 41/62 (66%)

Query: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTF 188
           A++Y+ ++K +F+ +PDIY HFL+I++ ++ +      V  +V+ LF+  P+L+  F  F
Sbjct: 525 AISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 584

Query: 189 LP 190
           LP
Sbjct: 585 LP 586

 Score = 40.8 bits (94), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 38/61 (62%), Gaps = 2/61 (3%)

Query: 354 QIEKPADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQ 413
           Q  +P +V+   A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LF+
Sbjct: 275 QYYRPLNVK--DALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFR 332

Query: 414 N 414
            
Sbjct: 333 G 333

>TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6.29
            YOL004W
          Length = 1490

 Score = 1358 bits (3515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 694/1150 (60%), Positives = 835/1150 (72%), Gaps = 39/1150 (3%)

Query: 341  PGTTVANNIQGTTQIEKPADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKP 400
            P     + +    Q +K ADVEFSQA++YVNKIKNRFA+QPDIYKHFLEILQTYQREQKP
Sbjct: 360  PAAGQQSQLPSNDQGKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKP 419

Query: 401  ISEVYAQVTVLFQNAXXXXXXXXXXXXXSSPSVTTXXXXXXXXXXXXXXXXXMYGVNNGY 460
            I+EVYAQVTVLFQNA             SSPS                     +G++  Y
Sbjct: 420  INEVYAQVTVLFQNAPDLLDDFKKFLPDSSPSAN----RQQQQPGVLQQQSPAFGLS-AY 474

Query: 461  YQAGKIPSANQNLPPLGNFSPPSNGAVPGRPEEFSTEAQHHMMALPSMLQAPTEHAQLHA 520
            Y     P++ QNLPPLG+FSPP NGAVP     +  + Q   + LP + Q    H    +
Sbjct: 475  YNETSPPTSRQNLPPLGSFSPPPNGAVP---HNYYRDQQPQTLGLPPVAQV-ENHIDQRS 530

Query: 521  QQHIAP--MTNEAIPISDLRSQIIDNNHVHNYTPIELAXXXXXXXXXXXXXXXXXXXXXX 578
              HIA   +  E +P+S+LRSQI         +P ELA                      
Sbjct: 531  PPHIATQGIAGEPMPVSNLRSQITAQ------SPSELAQLHQQQQIPSQPTAN------- 577

Query: 579  LEAAYATEGIVRPEIDLDXXXXXXXXXXXXXXXXXXXXVEEANFFDKAKKFIGNKQVYVE 638
            +      +  VRPEIDLD                    VEE +FFD+AKKFIGNKQ+Y E
Sbjct: 578  IPDGQYLDIAVRPEIDLDPSIVPVVPEPTAPIEDSLTLVEETSFFDRAKKFIGNKQIYTE 637

Query: 639  FLKILNLYSQDILSLDDLIEKVDYYLGSNKELFDWFKNFVGFQDKPKHIENVVHEKHKLD 698
            FLKILNL+SQD+L +D+L+ +V++YLG NKELF WFKNFVGFQDKPKHIEN+VHEKH+LD
Sbjct: 638  FLKILNLFSQDLLDVDELVGRVEHYLGGNKELFVWFKNFVGFQDKPKHIENIVHEKHRLD 697

Query: 699  LDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE 758
            LDLCEACGPSYKKLPK+DTFMPCSGRDEMCW VLNDEWVGHPVWASEDSGFIAHRKNQYE
Sbjct: 698  LDLCEACGPSYKKLPKSDTFMPCSGRDEMCWAVLNDEWVGHPVWASEDSGFIAHRKNQYE 757

Query: 759  ETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKQAFKLPIGLGHTSTTIYQ 818
            ETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANM+EEEK  FKLP GLGHTS TIY+
Sbjct: 758  ETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMSEEEKATFKLPPGLGHTSLTIYK 817

Query: 819  KVIRKVYDKERGFEIIDALHEYPSVAVPVVLKRLKQKDKEWRRAQREWNKVWRELEQKVF 878
            KVIRKVYDKERGFEIIDALHEYP++AVPVVLKRLKQKD+EWRRAQREWNKVWRELEQKV+
Sbjct: 818  KVIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVY 877

Query: 879  FKSLDHLGLTFKQSDKKLLTTKQLLAEISSIKVDQTNKRIHWLTPKPKSQLDYEVKDKRV 938
            +KSLDHLGLTFKQ+DKKLLTTKQL++EI SIK DQTNKR+HWLTPKPK QLDY V DK V
Sbjct: 878  YKSLDHLGLTFKQADKKLLTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQLDYYVPDKSV 937

Query: 939  LFDILRLADVFINHTSSYSNPDKERLRDFLQSYIGLFFSIPIREIKDAV--EAAIDNGKQ 996
             FDIL L D FINH SSYSNPDK RL+D  + ++ LFFSIP+ E+ +AV     +D+ K+
Sbjct: 938  FFDILSLTDTFINHNSSYSNPDKIRLKDLFKIFVSLFFSIPMYEVNEAVSRRGNLDDDKE 997

Query: 997  LDENEQXXXXXXXXXRPRDVEICLSDILNRSRYQRLKHSLDSSEASLGAVSPGQNEQDDM 1056
                +          RPR+ EI LS++L+R++ QR K S  + E S  + +  + E ++ 
Sbjct: 998  DSTQKMESDNLNNSKRPREDEISLSEVLHRAKNQRFK-SRAADETSEESAAEPEPELNEE 1056

Query: 1057 DEMIRQEAKKPWLLGSLVEEANSQGLIQNRKIYNMFANVNMYVFMRNLITIYDRLHEVKD 1116
            +E IRQEAKKPWLLG+LVEE N+QGLI NRK +NMFAN N+YVF R+L T+Y+RL EVK 
Sbjct: 1057 EETIRQEAKKPWLLGNLVEEVNAQGLINNRKTFNMFANTNIYVFFRHLTTLYERLEEVKK 1116

Query: 1117 INDVVTKEINGRKVVQFAKDLNLISAQLKNMGLDFSGGDSYTQLLLLSKRLIEGDLEHQW 1176
            +ND VTKEIN RKVVQFAKDLNLIS QLK MGLDF G D+Y QL  L KRLIEGD+EHQW
Sbjct: 1117 MNDAVTKEINSRKVVQFAKDLNLISQQLKEMGLDFEGADAYEQLRHLCKRLIEGDIEHQW 1176

Query: 1177 FEESLRQAYRNRAFKLYTIDKVIQSLVKHAHAIMTDSKSSDVMALFEKDRISSSTTSKDQ 1236
            FEESLRQAY N+AFKLYT+DKVIQSLVKHAH I+TDSK+S++M  FEKDR   +T++KDQ
Sbjct: 1177 FEESLRQAYNNKAFKLYTVDKVIQSLVKHAHTILTDSKTSEIMTSFEKDRTQINTSAKDQ 1236

Query: 1237 ILYRLQTRSHMSTTEHMFRIEYNTKKSSISIQYIALDDLTLEEPKTLEDKWKYYITSYSL 1296
            ILYRLQ RS+MS+TE+MFRIEYN +  ++ IQ+IA+DDLTL EP++LE+KW+YY+TSYSL
Sbjct: 1237 ILYRLQVRSYMSSTENMFRIEYNKQSKNVRIQFIAVDDLTLAEPRSLEEKWRYYVTSYSL 1296

Query: 1297 SHPTEGIPQEEIKIPFLDKVIESEQVHMEDEDDNP--KYSPEGVSKSNLMIKIDPETYRL 1354
            SHPTEGI QEE+++PFL+KV+E+E+ +  D D+    K+SPEGVSKS L IKIDPETY L
Sbjct: 1297 SHPTEGISQEELQLPFLEKVLETEEDYGSDVDNFSIDKFSPEGVSKSTLKIKIDPETYLL 1356

Query: 1355 EVEPGSFDIFSRKSVNKFPVDVFSESYKVKKQTRRNRCKNFLNGKHGWKRQLSSDAISKI 1414
            ++E GS+D+FSRKSVN+FPV V S  Y  KK+ ++N    FL  K GWK+ L  D +  I
Sbjct: 1357 DIEAGSYDVFSRKSVNRFPVIVDSNDYTTKKEKKKNMVIQFLESKKGWKKNLDDDQVKAI 1416

Query: 1415 EQKFNDLK-NGTFQQRSRSATSETTSVPLNASDSTQKEQESTGTSETSQPALQKVPINSA 1473
            ++K   +K NG+    + ++ ++  S  + A    ++ +EST     S P          
Sbjct: 1417 QEKLARVKENGSLDDFNEASQTQQAS-EIIAPSKVEQSKESTVADVNSLP--------KE 1467

Query: 1474 EPDQEERGND 1483
              + E+RGND
Sbjct: 1468 LVEAEDRGND 1477

 Score =  199 bits (507), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 108/152 (71%), Gaps = 13/152 (8%)

Query: 81  KTSTTLSVASFDNPLPPA-------------PAAHLXXXXXXXXXXXXADGSYYRPLNVK 127
           + S  LS ASFDNPLPP              P                   +YYRPLNVK
Sbjct: 138 QNSVGLSFASFDNPLPPQQQTILSSSHFQVLPPHQQQQEQQQQMQQQMQHDAYYRPLNVK 197

Query: 128 DALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNT 187
           DAL+YLEQVK QFNSRPD+YNHFLDIMKDFKSQ+IDTPGVI+RVSTLF+GYP LIQGFNT
Sbjct: 198 DALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPGLIQGFNT 257

Query: 188 FLPQGYTIECSSNPDDPIKVTTPLGSQIVTNS 219
           FLPQGY IECS+NPD+PI+VTTP+GS  V  +
Sbjct: 258 FLPQGYRIECSANPDEPIRVTTPMGSSSVAGT 289

 Score = 52.4 bits (124), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 39/62 (62%)

Query: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTF 188
           A+ Y+ ++K +F  +PDIY HFL+I++ ++ +      V  +V+ LF+  P+L+  F  F
Sbjct: 385 AINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 444

Query: 189 LP 190
           LP
Sbjct: 445 LP 446

 Score = 40.4 bits (93), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 32/48 (66%)

Query: 366 AVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQ 413
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LF+
Sbjct: 199 ALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFK 246

>TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1512

 Score = 1342 bits (3474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 697/1165 (59%), Positives = 849/1165 (72%), Gaps = 72/1165 (6%)

Query: 347  NNIQGTTQI-EKPADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVY 405
            N  Q T +I EKPADVEFSQAVSYVNKIKNRF D+PDIYK FLEILQTYQ+EQKPI EVY
Sbjct: 337  NMTQDTMKITEKPADVEFSQAVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVY 396

Query: 406  AQVTVLFQNAXXXXXXXXXXXXXSSPSVTTXXXXXXXXXXXXXXXXXMYGV--------N 457
            +QVT+LFQNA             ++ S                       V        N
Sbjct: 397  SQVTILFQNAPDLLDDFKKFLPDNNNSAGAETNQNIQANAMQYQQLHQNNVAIPQHIYEN 456

Query: 458  NGYYQAGKIPSAN-------------QNLPPLGNFSPPSNGAVPGRPEEFSTEAQHHMMA 504
            N YYQ   +P+A              Q+LPPLGNF PPSN          +T   +++M 
Sbjct: 457  NTYYQ-NNVPTAAAAAANAAGNVVTIQSLPPLGNFLPPSNKN------NNTTAVNNNLMG 509

Query: 505  LPSMLQAPTEHAQLHAQQHIA---------------PMTNEAIPISDLR-SQIIDNNHVH 548
            + S++    +H Q  +QQ+IA                +TNEA+ IS+LR S ++D     
Sbjct: 510  ISSIMHPKVDHIQ--SQQYIADQKQAYTPAQQQSTTQLTNEAMQISELRGSPMMDGQTAR 567

Query: 549  N-----YTPIEL---------AXXXXXXXXXXXXXXXXXXXXXXLEAAYATEGIVRPEID 594
            N     Y+P EL         +                      ++  Y  +  VRPEID
Sbjct: 568  NLANVNYSPAELNQLQAQQHISIQQQQQQQQQQQQQLQMQMQMQMDGGYPQDISVRPEID 627

Query: 595  LDXXXXXXXXXXXXXXXXXXXXVEEANFFDKAKKFIGNKQVYVEFLKILNLYSQDILSLD 654
            LD                    VEE NFFDKAKKFI NKQ+Y+EFLKILNLYSQ+IL+++
Sbjct: 628  LDPSIVPVIPEPVEPIEDSLSLVEETNFFDKAKKFINNKQIYMEFLKILNLYSQNILNVN 687

Query: 655  DLIEKVDYYLGSNKELFDWFKNFVGFQDKPKHIENVVHEKHKLDLDLCEACGPSYKKLPK 714
            +L+EKV YYLGSNKELFDWFK FVG+QDKPKHIEN+VHEKHKLDLDLCEA GPSYKKLPK
Sbjct: 688  ELVEKVQYYLGSNKELFDWFKGFVGYQDKPKHIENIVHEKHKLDLDLCEAYGPSYKKLPK 747

Query: 715  TDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFY 774
            TDTFMPCSGRDEMCWEVLND+WVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFY
Sbjct: 748  TDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFY 807

Query: 775  IESNLRTIQTLETIASKIANMTEEEKQAFKLPIGLGHTSTTIYQKVIRKVYDKERGFEII 834
            IESNLRTIQTLETIASKIANMTEEE+  FKLPIGLGHTS TIYQKVIRKVY KERGFE+I
Sbjct: 808  IESNLRTIQTLETIASKIANMTEEERANFKLPIGLGHTSVTIYQKVIRKVYGKERGFELI 867

Query: 835  DALHEYPSVAVPVVLKRLKQKDKEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQSDK 894
            DALHEYP+VAVP++LKRLKQKD+EWRRAQREWNKVWREL+QKV++KSLDHLGLTFKQ+DK
Sbjct: 868  DALHEYPAVAVPIILKRLKQKDEEWRRAQREWNKVWRELQQKVYYKSLDHLGLTFKQADK 927

Query: 895  KLLTTKQLLAEISSIKVDQTNKRIHWLTPKPKSQLDYEVKDKRVLFDILRLADVFINHTS 954
            KLLTTKQL++EISSIKVDQTNK++HWLTPKPKSQLDY+V D+++L+DIL+L DVFINHTS
Sbjct: 928  KLLTTKQLISEISSIKVDQTNKKLHWLTPKPKSQLDYKVADRQILYDILKLTDVFINHTS 987

Query: 955  SYSNPDKERLRDFLQSYIGLFFSIPIREIKDAVE--AAIDNGKQLDENEQXXXXXXXXXR 1012
            +YSNPDKERLRDFLQS+I LFF IP+ +IK A++  + +D+ K   ++E+         +
Sbjct: 988  NYSNPDKERLRDFLQSFISLFFFIPLADIKAAIKIRSPLDDTKT--DSEESSGDSDKFPK 1045

Query: 1013 PRDVE---ICLSDILNRSRYQRLKHSLDSSEASLGAVSPGQNEQDDMDEMIRQEAKKPWL 1069
             R +E   I   DIL++ +YQ++K  LD +E     +S   +  D  DE+IRQEA+KPWL
Sbjct: 1046 KRSIEDDDISFHDILDKVKYQKVKQGLDKNETFSNDISSATSVDD--DELIRQEAQKPWL 1103

Query: 1070 LGSLVEEANSQGLIQNRKIYNMFANVNMYVFMRNLITIYDRLHEVKDINDVVTKEINGRK 1129
            LGS+V++ANS G+IQNR  YN+F N N+YVF+R+LIT+Y+RL+E K +N  VT+EI  R 
Sbjct: 1104 LGSIVDDANSLGIIQNRSKYNIFGNTNIYVFIRHLITLYERLNEAKQMNAEVTEEIKNRS 1163

Query: 1130 VVQFAKDLNLISAQLKNMGLDFSGGDSYTQLLLLSKRLIEGDLEHQWFEESLRQAYRNRA 1189
            +V FAKDLNL+S QLKNMGLDF G DSY QLL LS RLIEG+LEH WFEESLRQA+RN+A
Sbjct: 1164 IVPFAKDLNLVSTQLKNMGLDFEGTDSYKQLLDLSTRLIEGNLEHHWFEESLRQAFRNKA 1223

Query: 1190 FKLYTIDKVIQSLVKHAHAIMTDSKSSDVMALFEKDRISSSTTSKDQILYRLQTRSHMST 1249
            FKLYTIDKV QS+VKHAH IM+D+K++++M L EKDR  ++T+SKDQILYRLQ RSHMST
Sbjct: 1224 FKLYTIDKVTQSIVKHAHTIMSDTKTAEIMMLMEKDRSCATTSSKDQILYRLQARSHMST 1283

Query: 1250 TEHMFRIEYNTKKSSISIQYIALDDLTLEEPKTLEDKWKYYITSYSLSHPTEGIPQEEIK 1309
            T++MFRIE+N    +ISIQYI +DDLTL EPKT E+KWKYYITSY+LSHPTEG+PQEEI+
Sbjct: 1284 TDNMFRIEFNKSSDNISIQYIGMDDLTLGEPKTAEEKWKYYITSYALSHPTEGVPQEEIQ 1343

Query: 1310 IPFLDKVIESEQVHMEDEDD-NPKYSPEGVSKSNLMIKIDPETYRLEVEPGSFDIFSRKS 1368
            IPFL+K++E+E+ + E+E+  N KYSP+GVS+S+L IKI PE Y LE+EPGSFD FSR S
Sbjct: 1344 IPFLEKILETEEAYAEEEEVINDKYSPKGVSQSDLKIKISPENYALEIEPGSFDTFSRLS 1403

Query: 1369 VNKFPVDVFSESYKVKKQTRRNRCKNFLNGKHGWKRQLSSDAISKIEQKFNDLKN-GTFQ 1427
            +NK+P+DV S+ YK KK+   +R   FLNGK GWK+ LS D I+ I  K++ +K  G+ +
Sbjct: 1404 MNKYPIDVTSDDYKNKKKLSIDRVNAFLNGKFGWKQSLSEDEINNINLKYSHIKKYGSLK 1463

Query: 1428 QRSRSATSETTSVPLNASDSTQKEQ 1452
                   +   + PL   + TQ+E+
Sbjct: 1464 NYVVPVVAAIPNKPLENKEKTQEEE 1488

 Score =  204 bits (518), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 101/147 (68%), Positives = 111/147 (75%), Gaps = 18/147 (12%)

Query: 88  VASFDNPLP------PAPAAHLXXXXXXXXXXXXA------------DGSYYRPLNVKDA 129
           VASFDNPLP      PA +A              A            D  +YRPLNVKDA
Sbjct: 91  VASFDNPLPVKTETTPAISAETSIPNVNTTYSATAGTTASANDSKESDEQFYRPLNVKDA 150

Query: 130 LTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTFL 189
           LTYLEQVKLQF+SRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYP+LIQGFNTFL
Sbjct: 151 LTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPSLIQGFNTFL 210

Query: 190 PQGYTIECSSNPDDPIKVTTPLGSQIV 216
           PQGYTIEC++NP+DPIKVTTP+GS+ +
Sbjct: 211 PQGYTIECTNNPNDPIKVTTPIGSETI 237

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 38/62 (61%)

Query: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTF 188
           A++Y+ ++K +F   PDIY  FL+I++ ++ +      V  +V+ LF+  P+L+  F  F
Sbjct: 357 AVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQNAPDLLDDFKKF 416

Query: 189 LP 190
           LP
Sbjct: 417 LP 418

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 48/87 (55%), Gaps = 4/87 (4%)

Query: 329 SSPSSTIPAGTVPGTTVANN--IQGTTQIEKPADVEFSQAVSYVNKIKNRFADQPDIYKH 386
           S P+         GTT + N   +   Q  +P +V+   A++Y+ ++K +F+ +PDIY H
Sbjct: 113 SIPNVNTTYSATAGTTASANDSKESDEQFYRPLNVK--DALTYLEQVKLQFSSRPDIYNH 170

Query: 387 FLEILQTYQREQKPISEVYAQVTVLFQ 413
           FL+I++ ++ +      V  +V+ LF+
Sbjct: 171 FLDIMKDFKSQSIDTPGVIERVSTLFR 197

>NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6.29
            YOL004W
          Length = 1434

 Score = 1264 bits (3272), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 655/1145 (57%), Positives = 810/1145 (70%), Gaps = 85/1145 (7%)

Query: 332  SSTIPAGTVPGTTVANNIQGTTQIE----KPADVEFSQAVSYVNKIKNRFADQPDIYKHF 387
            S TIP+     T   +N Q T Q E    K A+VEFSQA++YVNKIKNRFADQPDIYK F
Sbjct: 326  SPTIPS-LAASTFQESNFQQTPQPEDQSAKNAEVEFSQAINYVNKIKNRFADQPDIYKRF 384

Query: 388  LEILQTYQREQKPISEVYAQVTVLFQNAXXXXXXXXXXXXXSSPSVTTXXXXXXXXXXXX 447
            LEILQTYQREQKPI+EVY+QVTVLFQ+A             SS + +T            
Sbjct: 385  LEILQTYQREQKPINEVYSQVTVLFQHAPDLLDDFKKFLPESSGTTSTSELPQNAGIQQR 444

Query: 448  XX------XXXMYGVNNGYYQAGKIPSANQNLPPLGNFSPPSNGA----VPGRPEEFSTE 497
                        YG  N YY  G      QNLPP+G+F+PP+  A     PG   +F   
Sbjct: 445  AAIPTPNPKHQQYGYPNNYYPNGT--GTQQNLPPIGSFAPPNGTASREYAPGN--QFVGP 500

Query: 498  AQHHMMALPSMLQAPTEHAQLHAQQHIAPMTNEAIPISDLRSQIIDN------NHVHNYT 551
                   LPSM+       Q      +   TNEAIP+S+LRS + D       N  +  T
Sbjct: 501  G-----GLPSMIPNDQALQQQQQPGLVHGYTNEAIPVSNLRSPLTDQQYPNLLNMQNQMT 555

Query: 552  PIELAXXXXXXXXXXXXXXXXXXXXXXLEAAYATEGIVRPEIDLDXXXXXXXXXXXXXXX 611
            P ++                       +   Y  E  +RPEIDLD               
Sbjct: 556  PGQM---------------DINNATAPMAQQYTNEAPIRPEIDLDPSIVPVIPEPTEPLE 600

Query: 612  XXXXXVEEANFFDKAKKFIGNKQVYVEFLKILNLYSQDILSLDDLIEKVDYYLGSNKELF 671
                 VEE NFF+KAKKFIG KQVY EFLKILNLYSQD+L+ D+L  KV+YYLGSN+ELF
Sbjct: 601  YNVSLVEETNFFEKAKKFIGTKQVYTEFLKILNLYSQDLLTTDELCVKVEYYLGSNEELF 660

Query: 672  DWFKNFVGFQDKPKHIENVVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEV 731
             WFKNFVGFQ+KP  IEN+VHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEV
Sbjct: 661  TWFKNFVGFQEKPLIIENIVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEV 720

Query: 732  LNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASK 791
            LNDEWVGHPVWASEDSGFIAHRKNQYEE+LFK EEERHEYDF IESNLRTIQTLETIA+K
Sbjct: 721  LNDEWVGHPVWASEDSGFIAHRKNQYEESLFKTEEERHEYDFCIESNLRTIQTLETIANK 780

Query: 792  IANMTEEEKQAFKLPIGLGHTSTTIYQKVIRKVYDKERGFEIIDALHEYPSVAVPVVLKR 851
            I NMT EEK+ FKLP GLGHTS+TIY+KVIRKVYDK+RGFEIID LHE P++ VPVVLKR
Sbjct: 781  IGNMTNEEKKNFKLPPGLGHTSSTIYKKVIRKVYDKDRGFEIIDLLHEEPALTVPVVLKR 840

Query: 852  LKQKDKEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQSDKKLLTTKQLLAEISSIKV 911
            LKQKD+EWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQ+DKKLLTTKQLL+EISSIKV
Sbjct: 841  LKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKV 900

Query: 912  DQTNKRIHWLTPKPKSQLDYEVKDKRVLFDILRLADVFINHTSSYSNPDKERLRDFLQSY 971
            DQTNKRIHWLTPKPKSQL+++  D  +  DIL L  VFINH+S+YSNP+KER++DFL+ +
Sbjct: 901  DQTNKRIHWLTPKPKSQLEFQFDDNDIFVDILGLTSVFINHSSTYSNPEKERMKDFLRVF 960

Query: 972  IGLFFSIPIREIKDAVEAAIDNGKQLDENEQXXXXXXX---------------XXRPRDV 1016
            + LFFSIP+ ++ +A+    D    L E E+                        RP ++
Sbjct: 961  VSLFFSIPLDKVNEALS---DRSHWLQEKEKKTKESSRNIDSTTSSSSSGSNSKKRPLNI 1017

Query: 1017 EICLSDILNRSRYQRLKHSLDSS----------EASLGAVSPGQNEQDDMDEMIRQEAKK 1066
            +I L+DIL + +YQ+++     S          E  +G  +   NEQD+ +E+I +E K+
Sbjct: 1018 DIPLADILRKHKYQKIRKQAKESNEENAQEEDDENIVGDSNEELNEQDE-NEIILEEIKR 1076

Query: 1067 PWLLGSLVEEANSQGLIQNRKIYNMFANVNMYVFMRNLITIYDRLHEVKDINDVVTKEIN 1126
            PWLLG+++E A++ G I NRK++NMFAN N+YVF R    IY+RL+E+K IN+ VTKE+N
Sbjct: 1077 PWLLGNIIETASNHGTISNRKVFNMFANTNIYVFFRLWTVIYERLYEMKQINEKVTKEVN 1136

Query: 1127 GRKVVQFAKDLNLISAQLKNMGLDFSGGDSYTQLLLLSKRLIEGDLEHQWFEESLRQAYR 1186
             R++ QFAKDLNLIS QLK+MGLDF G +SY +LL+LSKRLI+ D+EHQWFEESLRQA+ 
Sbjct: 1137 SRRISQFAKDLNLISTQLKDMGLDFVGVNSYQELLVLSKRLIQNDIEHQWFEESLRQAFN 1196

Query: 1187 NRAFKLYTIDKVIQSLVKHAHAIMTDSKSSDVMALFEKDRISSSTTSKDQILYRLQTRSH 1246
            N+AFKLYT+DKVIQSLVKHAH I+ D K+S++M LFEKDR+ SST++K+QILYRLQTR+H
Sbjct: 1197 NKAFKLYTVDKVIQSLVKHAHTILGDVKTSEIMVLFEKDRLCSSTSAKEQILYRLQTRAH 1256

Query: 1247 MSTTEHMFRIEYNTKKSSISIQYIALDDLTLEEPKTLEDKWKYYITSYSLSHPTEGIPQE 1306
            M+ TE+MFRIE+N +K+ + IQYIAL+DLT+++PK++E  W+YY+TSYSL HPTEG+PQ+
Sbjct: 1257 MTNTENMFRIEFNEEKNHVCIQYIALEDLTIKQPKSMEKNWEYYVTSYSLPHPTEGVPQD 1316

Query: 1307 EIKIPFLDKVIESEQVHMEDEDDNPKYSPEGVSKSNLMIKIDPETYRLEVEPGSFDIFSR 1366
            E+KIPFL+K +E E   +++E DN K SPEGVS S L IKIDP++Y LE+EPGSFD+FSR
Sbjct: 1317 ELKIPFLEKTLELE---VDEEGDN-KSSPEGVSSSKLKIKIDPKSYALEIEPGSFDLFSR 1372

Query: 1367 KSVNKFPVDVFSESYKVKKQTRRNRCKNFLNGKHGWKRQLSSDAISKIE---QKFNDLKN 1423
            KS+N +P    + S + KK+   ++   FL+GK+GWK+ L++   + IE   +K  +L  
Sbjct: 1373 KSMNVYP----TYSDETKKRKSIDQMTKFLDGKNGWKKNLTTADSTNIEDLVKKSRELSK 1428

Query: 1424 GTFQQ 1428
             T +Q
Sbjct: 1429 ATGEQ 1433

 Score =  176 bits (445), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 88/97 (90%)

Query: 121 YRPLNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPN 180
           YRPLNVKDAL+YLEQVK QF+ RPDIYN FLDIMKDFKSQSIDTPGVIERVS LFRGYP 
Sbjct: 207 YRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFRGYPM 266

Query: 181 LIQGFNTFLPQGYTIECSSNPDDPIKVTTPLGSQIVT 217
           L+QGFNTFLPQGY IEC+++PD PI+VTTP+G+  ++
Sbjct: 267 LVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGTSTLS 303

 Score = 49.3 bits (116), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 39/64 (60%)

Query: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTF 188
           A+ Y+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ LF+  P+L+  F  F
Sbjct: 363 AINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQHAPDLLDDFKKF 422

Query: 189 LPQG 192
           LP+ 
Sbjct: 423 LPES 426

 Score = 39.3 bits (90), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 32/48 (66%)

Query: 366 AVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQ 413
           A+SY+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 215 ALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFR 262

>SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] {ON}
            similar to uniprot|Q75CF0 Ashbya gossypii ACL004W
            ACL004Wp and some similarites with YOL004W uniprot|P22579
            Saccharomyces cerevisiae YOL004W SIN3 DNA binding protein
            involved in transcriptional regulation
          Length = 1415

 Score = 1251 bits (3236), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 662/1136 (58%), Positives = 810/1136 (71%), Gaps = 91/1136 (8%)

Query: 356  EKPADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNA 415
            +K  DVEFS A+SYVNKIK RFA+QPDIYKHFLEILQTYQREQKPI+EVYAQVTVLFQNA
Sbjct: 334  KKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNA 393

Query: 416  XXXXXXXXXXX-XXSSPSVTTXXXXXXXXXXXXXXXXXMYGVNNGYYQAGKIPSANQNLP 474
                          S+P  TT                    VN G +     P   QNLP
Sbjct: 394  PDLLDDFKKFLPDASAPQSTTTPAP----------------VNGGTFYPQAAPQ--QNLP 435

Query: 475  PLGNFSPPSNGAVPGRPEEFSTEAQHHMMALPSMLQAPTEHAQLHAQQHIAP--MTNEAI 532
            PLG+FSPPS+G+        + E +H  + LP+ +Q P+       QQHI    M+N+ I
Sbjct: 436  PLGSFSPPSSGS--------AREGEH--VGLPA-VQPPSMDISGQPQQHIITQGMSNDDI 484

Query: 533  PISDLRSQIIDNNHVHNYTPIELAXXXXXXXXXXXXXXXXXXXXXXLEAAYATEGIVRPE 592
            PIS++R+                                        E  Y  E + RPE
Sbjct: 485  PISEVRN--------------------------TADGAYRSDLRNSGEVQYM-EPVARPE 517

Query: 593  IDLDXXXXXXXXXXXXXXXXXXXXVEEANFFDKAKKFIGNKQVYVEFLKILNLYSQDILS 652
            IDLD                    VEE +FFDKAKKFIGNKQ+Y EFLKILNLYSQD+L 
Sbjct: 518  IDLDPSLVPVIPEPIEPMENEVSLVEETSFFDKAKKFIGNKQIYTEFLKILNLYSQDLLD 577

Query: 653  LDDLIEKVDYYLGSNKELFDWFKNFVGFQDKPKHIENVVHEKHKLDLDLCEACGPSYKKL 712
             D+L+EKV+YYLG NKELFDWFKNFVG++ KPKHIEN+VHEKH+LDLDLCEACGPSYKKL
Sbjct: 578  RDELVEKVEYYLGGNKELFDWFKNFVGYEKKPKHIENIVHEKHRLDLDLCEACGPSYKKL 637

Query: 713  PKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD 772
            PK DTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD
Sbjct: 638  PKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD 697

Query: 773  FYIESNLRTIQTLETIASKIANMTEEEKQAFKLPIGLGHTSTTIYQKVIRKVYDKERGFE 832
            FYIE+NLRTIQTLETIA+KIANMT EEK  FKL  GLGHTS TIY+KVIRKVYDK+RGFE
Sbjct: 698  FYIEANLRTIQTLETIANKIANMTPEEKATFKLSPGLGHTSVTIYKKVIRKVYDKDRGFE 757

Query: 833  IIDALHEYPSVAVPVVLKRLKQKDKEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQS 892
            IIDALHE PS+AVP+VLKRLKQKD+EWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQ+
Sbjct: 758  IIDALHETPSIAVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQA 817

Query: 893  DKKLLTTKQLLAEISSIKVDQTNKRIHWLTPKPKSQLDYEVKDKRVLFDILRLADVFINH 952
            DKKLLTTKQL++EIS+IKVDQ NKRIH LTPKPKSQLDY  KD+ VL+DIL LA VFI+ 
Sbjct: 818  DKKLLTTKQLVSEISTIKVDQANKRIHPLTPKPKSQLDYHFKDREVLYDILNLAKVFIDC 877

Query: 953  TSSYSNPDKERLRDFLQSYIGLFFSIPIREIKDAV-----EAAIDNGKQLDENEQXXXXX 1007
             ++YSNPDKE++ DFL+S++ LFFS P+ E++ A      +  + +G   +EN       
Sbjct: 878  NTTYSNPDKEKMFDFLKSFLVLFFSYPMYEVETAFARRRGDIGVQDG---EENSGQENSD 934

Query: 1008 XXXXRPRDVEICLSDILNRSRYQRLKH-SLDSSEASLGAVSPGQNEQDDMDEMIRQEAKK 1066
                R R+ E  L D+L R++YQ+ ++ + +         +    E+ + +E+IRQEAKK
Sbjct: 935  LSRKRTREEENLLKDVLRRNKYQKGRNFAEEEPIPEESEFAEKTVEEKEEEEIIRQEAKK 994

Query: 1067 PWLLGSLVEEANSQGLIQNRKIYNMFANVNMYVFMRNLITIYDRLHEVKDINDVVTKEIN 1126
            PWLLGS+V+EAN  G ++NRK +NMFAN N+YVF R+L T+Y RL EVKDIN+ VT+EI 
Sbjct: 995  PWLLGSIVDEANEHGFVENRKTFNMFANTNIYVFFRHLATLYTRLSEVKDINEAVTEEIK 1054

Query: 1127 GRKVVQFAKDLNLISAQLKNMGLDFSGGDSYTQLLLLSKRLIEGDLEHQWFEESLRQAYR 1186
             RKVVQFAKDLNLIS QL +MGLDF G D+Y Q+L LSKRLIEGD+EHQWFEESLRQAY+
Sbjct: 1055 NRKVVQFAKDLNLISTQLSDMGLDFEGADAYGQVLTLSKRLIEGDIEHQWFEESLRQAYK 1114

Query: 1187 NRAFKLYTIDKVIQSLVKHAHAIMTDSKSSDVMALFEKDRISSSTTSKDQILYRLQTRSH 1246
            N+AFK+YTIDKV+QSLVKHAH I+TD K+ ++M LFEKDR   +T++K+QILYRLQ RSH
Sbjct: 1115 NKAFKIYTIDKVVQSLVKHAHTIITDPKTVEIMILFEKDRTCLNTSAKEQILYRLQVRSH 1174

Query: 1247 MSTTEHMFRIEYNTKKSSISIQYIALDDLTLEEPKTLEDKWKYYITSYSLSHPTEGIPQE 1306
            M+T E+MFRIEYN + +  SIQ++A+DDLTLEEPK+LED+WKYY+TSYSLSHPTEGI  E
Sbjct: 1175 MTTAENMFRIEYNRQSTHASIQFVAVDDLTLEEPKSLEDRWKYYVTSYSLSHPTEGISHE 1234

Query: 1307 EIKIPFLDKVIESEQVHMEDEDDNPKYSPEGVSKSNLMIKIDPETYRLEVEPGSFDIFSR 1366
            E++ PFL+K++E E+     + +N +YSPEGVS SNL +KI+PETY L+V+PGS+D FSR
Sbjct: 1235 ELQPPFLEKILEKEEEF---QCENGEYSPEGVSSSNLKVKINPETYSLDVQPGSYDFFSR 1291

Query: 1367 KSVNKFPVDVFSESYKVKKQTRRNRCKNFLNGKHGWKRQLSSDAISKIEQKF-------- 1418
            KS+NKFP+++ +++YK K+  +     ++LNG  GWKR L +  + K + +         
Sbjct: 1292 KSINKFPIEINNDTYKSKRGEKAKCLTSYLNGAKGWKRGLVASKVLKAQTEIEYVKTKGT 1351

Query: 1419 ---------NDLKNGTFQQRSRSATSETTSVPLNASD---STQKEQESTGTSETSQ 1462
                     ND+        ++S T  T  +  +  D   S Q+E ES G   T++
Sbjct: 1352 LVGLESKDKNDIVKNDIDGENKSYTFSTGQLHDHEEDKPISHQEEPESKGNDTTTE 1407

 Score =  184 bits (467), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 102/138 (73%), Gaps = 7/138 (5%)

Query: 82  TSTTLSVASFDNPLPPAPAAHLXXXXXXXXXXXXA----DGSYYRPLNVKDALTYLEQVK 137
           + T  SVAS +NPLP                        D SY RPLNVKDAL+YLEQVK
Sbjct: 116 SGTGFSVASLNNPLPEQQQQQQQQQQQQQQQQQQQQQPQDPSY-RPLNVKDALSYLEQVK 174

Query: 138 LQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTFLPQGYTIEC 197
            QFN+RPD+YNHFLDIMKDFKSQ+IDTPGVIERVS LF+GYPNLIQGFNTFLPQGY IEC
Sbjct: 175 FQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPNLIQGFNTFLPQGYKIEC 234

Query: 198 SSNPDD--PIKVTTPLGS 213
           SSNP+D  PIKVTTP G+
Sbjct: 235 SSNPNDPHPIKVTTPFGT 252

 Score = 55.8 bits (133), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 44/73 (60%)

Query: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTF 188
           A++Y+ ++K +F  +PDIY HFL+I++ ++ +      V  +V+ LF+  P+L+  F  F
Sbjct: 344 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 403

Query: 189 LPQGYTIECSSNP 201
           LP     + ++ P
Sbjct: 404 LPDASAPQSTTTP 416

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 33/49 (67%)

Query: 366 AVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQN 414
           A+SY+ ++K +F ++PD+Y HFL+I++ ++ +      V  +V+ LFQ 
Sbjct: 166 ALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQG 214

>KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_6.29
            YOL004W
          Length = 1479

 Score = 1249 bits (3232), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 644/1166 (55%), Positives = 816/1166 (69%), Gaps = 67/1166 (5%)

Query: 335  IPAGTVPGTTVAN------NIQGTTQIEKPADVEFSQAVSYVNKIKNRFADQPDIYKHFL 388
            IP G++      N      + Q     +KPADVEFSQA++YVNKIKNRFADQPDIYK+FL
Sbjct: 336  IPIGSISNNANLNAAVQSVDDQAKQANKKPADVEFSQAINYVNKIKNRFADQPDIYKNFL 395

Query: 389  EILQTYQREQKPISEVYAQVTVLFQNAXXXXXXXXXXXXXSSPSVTTXXXXXXXXXXXXX 448
            EILQTYQREQKPI+EVYAQVT+LFQNA               P  +              
Sbjct: 396  EILQTYQREQKPINEVYAQVTILFQNAPDLLDDFKKFL----PDSSKEQQYTGQLPQQIP 451

Query: 449  XXXXMYGVNNGYYQAGKIP---SANQNLPPLGNFSPPSNGAVPGRPEEFSTEAQH-HMMA 504
                +   +  Y +    P    A Q+LPP+G+FSPP+N  +         ++Q  HMMA
Sbjct: 452  NQEQLEEFSGSYARPPNAPLDMVAQQSLPPIGSFSPPANTGI-----SMHDQSQRPHMMA 506

Query: 505  LPSMLQAPTEHAQL-HAQQHIAP------MTNEAIPISDLRSQIIDNNHVHNY------- 550
            LPSMLQ    H Q+     H  P      ++N+ IP+SD+R     N  V +Y       
Sbjct: 507  LPSMLQ----HEQIIDMNNHPKPAVSTQGISNDEIPVSDVRMAQYPNGAVPDYGQYPTHP 562

Query: 551  -------TPIELAXXXXXXXXXXXXXXXXXXXXXXLEAAYATEGIVRPEIDLDXXXXXXX 603
                   T   +                        +     E  VRPEIDLD       
Sbjct: 563  QMKPDLATQRHILQQQEIQQQQLMLQQQQEQELLEQQQQQYVEAPVRPEIDLDPSIVPVV 622

Query: 604  XXXXXXXXXXXXXVEEANFFDKAKKFIGNKQVYVEFLKILNLYSQDILSLDDLIEKVDYY 663
                         +EE +FFDKAKKFI NKQ+Y EFLK+LNL+SQD++S+DDL+ KV+YY
Sbjct: 623  PEPTEPIESNFTLIEETSFFDKAKKFINNKQIYTEFLKVLNLFSQDLISVDDLVNKVEYY 682

Query: 664  LGSNKELFDWFKNFVGFQDKPKHIENVVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSG 723
            +GS+KELF+WF+NFVG+Q  PK IEN+VHEKH+LDLDLCEACGPSYK+LPK+DTFMPCSG
Sbjct: 683  IGSSKELFEWFRNFVGYQGNPKIIENIVHEKHRLDLDLCEACGPSYKRLPKSDTFMPCSG 742

Query: 724  RDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQ 783
            RD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD+YIESNLRTIQ
Sbjct: 743  RDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQ 802

Query: 784  TLETIASKIANMTEEEKQAFKLPIGLGHTSTTIYQKVIRKVYDKERGFEIIDALHEYPSV 843
            TLE I +KI+NM+EEEK+ FKL  GLGHTS TIY+KVIRKVYDKERGFEIIDALHE+P++
Sbjct: 803  TLEAIVNKISNMSEEEKKNFKLEPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAI 862

Query: 844  AVPVVLKRLKQKDKEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQSDKKLLTTKQLL 903
            A P+VLKRLKQKD+EWRRAQREWNKVWRELEQKV+FKSLDHLGLTFKQ+DKKLLT KQL+
Sbjct: 863  AAPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTIKQLI 922

Query: 904  AEISSIKVDQTNKRIHWLTPKPKSQLDYEVKDKRVLFDILRLADVFINHTSSYSNPDKER 963
            +EISSIKVDQ NKRIHWLTPKPKSQL++++KD  +LFDIL L++ FINH+S+YS  DKER
Sbjct: 923  SEISSIKVDQNNKRIHWLTPKPKSQLNFDIKDFEILFDILSLSENFINHSSTYSTSDKER 982

Query: 964  LRDFLQSYIGLFFSIPIREIKDAVEAAID--NGKQLDENEQXXXXXXXXXRP-RDVEICL 1020
            L DFL+S+I LFFS+P+ EI +A++   +  N +++ ++           R   D+E+ +
Sbjct: 983  LNDFLKSFISLFFSVPLNEINNALDKRNNQKNSEKVTDSALPDGTENQKKRSIHDIELSM 1042

Query: 1021 SDILNRSRYQRLKHSLDSS----EASLGAVSPGQNEQDDMDE--MIRQEAKKPWLLGSLV 1074
            SDIL+R++YQ++K S   S    E ++  +   ++++   +E  +IRQ+AK+PWLLG ++
Sbjct: 1043 SDILHRTKYQKMKLSNRGSDSQEENNIDTIIDEESDERLAEEADLIRQDAKRPWLLGDII 1102

Query: 1075 EEANSQGLIQNRKIYNMFANVNMYVFMRNLITIYDRLHEVKDINDVVTKEINGRKVVQFA 1134
            ++ N+QG+I +RK +N+FAN N+YVF+R+  T+Y+RL E+K++N  VTKEIN RK V+FA
Sbjct: 1103 DKTNTQGIITDRKKFNLFANTNIYVFLRHWTTLYERLLELKEMNGEVTKEINNRKSVKFA 1162

Query: 1135 KDLNLISAQLKNMGLDFSGGDSYTQLLLLSKRLIEGDLEHQWFEESLRQAYRNRAFKLYT 1194
            +DL L+S QLKNMGLDF   DSY +LL LSKRLIE D+EHQWFEESLRQAY NRAFKLYT
Sbjct: 1163 EDLGLVSTQLKNMGLDFVDKDSYEELLRLSKRLIENDIEHQWFEESLRQAYNNRAFKLYT 1222

Query: 1195 IDKVIQSLVKHAHAIMTDSKSSDVMALFEKDRISSSTTSKDQILYRLQTRSHMSTTEHMF 1254
            +DKV+Q+LVKH H +MTD K+++VM LFEKDR+SS+T++KDQILYRLQ RSHMS TE+MF
Sbjct: 1223 VDKVVQALVKHGHTLMTDYKTTEVMKLFEKDRLSSATSAKDQILYRLQARSHMSNTEYMF 1282

Query: 1255 RIEYNTKKSSISIQYIALDDLTLEEPKTLEDKWKYYITSYSLSHPTEGIPQEEIKIPFLD 1314
            RIEYN    +I IQYIALDDLTL+E  T E+KWKYY+TSYSL HPTEGI  E ++IPFL 
Sbjct: 1283 RIEYNKDDRNICIQYIALDDLTLKEGNTEEEKWKYYVTSYSLPHPTEGIDHESLQIPFLQ 1342

Query: 1315 KVIESEQ----VHMEDEDDNPKYSPEGVSKSNLMIKIDPETYRLEVEPGSFDIFSRKSVN 1370
            K++E +Q     + E+   N KYSPEGVS S   IKI P  Y L+++ GSFDIFSRKS+N
Sbjct: 1343 KILEFDQEELENNDEENKSNGKYSPEGVSNSMYKIKIHPGNYALDIQTGSFDIFSRKSLN 1402

Query: 1371 KFPVDVFSESYKVKKQTRRNRCKNFLNGKHGWKRQLSSDAISKIEQKFNDLKNGTFQQRS 1430
            K+PV V  +   +K   ++N    FL   +GWK+ L      ++  K N+ +  + + R+
Sbjct: 1403 KYPVKVNEDHESLKLNKKKNILNTFLESNNGWKKHLK----KQLSLKKNESEPESAETRT 1458

Query: 1431 RSATSETTSVPLNASDSTQKEQESTG 1456
              A      VP + +D     ++STG
Sbjct: 1459 IPA------VPASTTDKPPSMEQSTG 1478

 Score =  198 bits (504), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 109/150 (72%), Gaps = 13/150 (8%)

Query: 80  PKTSTTLSVASFDNPLPPA---------PAAHLXXXXXXXXXXXXA----DGSYYRPLNV 126
           P   T +SVASFDNPLPP          PA H+                 D + YRPLNV
Sbjct: 156 PFFGTGVSVASFDNPLPPLNQQQSQPSFPAMHMRDQQQQQQMAAAPAAAEDDASYRPLNV 215

Query: 127 KDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFN 186
           KDAL+YLEQVK QFNSRPDIYN FLDIMKDFKSQ+IDTPGVIERVSTLFRGYP+LIQGFN
Sbjct: 216 KDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYPSLIQGFN 275

Query: 187 TFLPQGYTIECSSNPDDPIKVTTPLGSQIV 216
           TFLP GY I+C SNP+DPIKVTTP+GS  +
Sbjct: 276 TFLPTGYRIDCPSNPNDPIKVTTPIGSSTL 305

 Score = 49.3 bits (116), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 39/62 (62%)

Query: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTF 188
           A+ Y+ ++K +F  +PDIY +FL+I++ ++ +      V  +V+ LF+  P+L+  F  F
Sbjct: 373 AINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQNAPDLLDDFKKF 432

Query: 189 LP 190
           LP
Sbjct: 433 LP 434

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 31/48 (64%)

Query: 366 AVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQ 413
           A+SY+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 218 ALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFR 265

>KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6.29
            YOL004W
          Length = 1492

 Score = 1230 bits (3182), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 625/1127 (55%), Positives = 784/1127 (69%), Gaps = 44/1127 (3%)

Query: 314  KKPAVLQVSNTNTGISS----PSST---IPAGTVPGTTV--ANNIQGTTQIEKPADVEFS 364
            ++PA+ Q+  T + I +    P S    +P+     TTV  + N+    + +K  DVEFS
Sbjct: 323  QQPAIGQLPTTQSPIQASLPPPQSAHLHLPSTVAAATTVQQSANVHAENEPKKANDVEFS 382

Query: 365  QAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNAXXXXXXXXX 424
            QA+SYVNKIKNRF+DQPDIYK+FLEILQTYQREQKPI+EVYAQVTVLF NA         
Sbjct: 383  QAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLFHNAPDLLDDFKK 442

Query: 425  XXXXSSPSVTTXXXXXXXXXXXXXXXXXMYGV---NNGYYQAGKIPSANQNLPPLGNFSP 481
                SS S                      G    N G Y   ++     NLPP+G+FSP
Sbjct: 443  FLPDSSASNEQQPKQSPYSPQVYSGADMARGYMYNNTGVYYPPQVNQPQSNLPPIGSFSP 502

Query: 482  PSNGAVPGRPEEF-STEAQHHMMALPSMLQAPTEHAQLHAQQHIAPM-TNEAIPISDLRS 539
            P+NG  P         + QH +  +P+M  AP      H QQH   M  N+ I IS++R 
Sbjct: 503  PANGVAPTTGTAIPHADEQHVVAGVPAM--AP------HEQQHAPSMINNDGIQISNMRG 554

Query: 540  --QIIDNNHVHNYTPIELAXXXXXXXXXXXXXXXXXXXXXXLEAAYATEG--IVRPEIDL 595
               +   N     +P +                        +       G   VRPEIDL
Sbjct: 555  GGTVPALNQYGMISPHDYTQQQAKQVQQFQEDQQQQQQQSMMMDEQYGSGDMQVRPEIDL 614

Query: 596  DXXXXXXXXXXXXXXXXXXXXVEEANFFDKAKKFIGNKQVYVEFLKILNLYSQDILSLDD 655
            D                     EE +FF+K KK IGN+Q+Y+EFLK+LNL+SQD++++D+
Sbjct: 615  DPSIVPVVPEPTEPIENNLSLSEETSFFEKVKKNIGNRQIYIEFLKVLNLFSQDLIAVDE 674

Query: 656  LIEKVDYYLGSNKELFDWFKNFVGFQDKPKHIENVVHEKHKLDLDLCEACGPSYKKLPKT 715
            L+ KV+ YL    ELF+WFKNFVG+QDKPK IENV+HEKH+LDLDLCEA GPSYKKLPK+
Sbjct: 675  LVTKVENYLAGQPELFEWFKNFVGYQDKPKIIENVIHEKHRLDLDLCEAYGPSYKKLPKS 734

Query: 716  DTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYI 775
            DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYI
Sbjct: 735  DTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYI 794

Query: 776  ESNLRTIQTLETIASKIANMTEEEKQAFKLPIGLGHTSTTIYQKVIRKVYDKERGFEIID 835
            ESNLRTIQTLETIASKIANMTEEEK  FKLP GLGHTS TIY+K+IRKVYDKERGFEIID
Sbjct: 795  ESNLRTIQTLETIASKIANMTEEEKNMFKLPPGLGHTSLTIYKKIIRKVYDKERGFEIID 854

Query: 836  ALHEYPSVAVPVVLKRLKQKDKEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQSDKK 895
             LHE+P++ VP+VLKRLKQKD+EWRRAQREWNKVWRELEQKV+FKSLDHLGLTFKQ+DKK
Sbjct: 855  ELHEHPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKK 914

Query: 896  LLTTKQLLAEISSIKVDQTNKRIHWLTPKPKSQLDYEVKDKRVLFDILRLADVFINHTSS 955
            LLTTKQL++EISSIKVDQ NKR+HWLTPKPK QLDY+  D  ++FDI+ L DVF++H S+
Sbjct: 915  LLTTKQLISEISSIKVDQNNKRMHWLTPKPKKQLDYQFNDMDIIFDIVGLTDVFVDHCST 974

Query: 956  YSNPDKERLRDFLQSYIGLFFSIPIREIKDAVEAAIDNGKQLDENEQXXXXXXXXXRPRD 1015
            YSNPDKERL+D  + +I LFF IP   I  A++   D GK  D   +         RP D
Sbjct: 975  YSNPDKERLKDLFRVFISLFFFIPRDLISAALDTKSDEGKSTDTKFEKADDSKKRPRP-D 1033

Query: 1016 VEICLSDILNRSRYQRLKHSLDSSEASLGAVSPGQNEQDD-------MDEMIRQEAKKPW 1068
            VE+ LSDIL+R++YQ+LK+              G +E DD        +EM  + A KPW
Sbjct: 1034 VELSLSDILHRAKYQKLKN----------GEGLGMSEDDDEEKLAKEAEEMSEKNASKPW 1083

Query: 1069 LLGSLVEEANSQGLIQNRKIYNMFANVNMYVFMRNLITIYDRLHEVKDINDVVTKEINGR 1128
            L+G +VE ANS GL+ +R +YN+F N N+Y+F+R+  T+Y RL E+K +++ VTKEIN R
Sbjct: 1084 LVGDIVERANSHGLVTDRAVYNLFGNTNVYIFIRHWSTLYGRLLELKQMDERVTKEINNR 1143

Query: 1129 KVVQFAKDLNLISAQLKNMGLDFSGGDSYTQLLLLSKRLIEGDLEHQWFEESLRQAYRNR 1188
            KVVQFA+DLNL+S QL++MGLDF G ++Y + L LSKRLI  +LEHQWFEESLRQAY N+
Sbjct: 1144 KVVQFAEDLNLLSTQLRDMGLDFDGKNAYQETLKLSKRLIRNELEHQWFEESLRQAYNNK 1203

Query: 1189 AFKLYTIDKVIQSLVKHAHAIMTDSKSSDVMALFEKDRISSSTTSKDQILYRLQTRSHMS 1248
            AFKLYT+DKV+ SLVKHAH +MTD+KSS++M LFEKDR+ SST  KDQILYRL TRSHMS
Sbjct: 1204 AFKLYTVDKVVHSLVKHAHTLMTDNKSSELMELFEKDRLQSSTCVKDQILYRLLTRSHMS 1263

Query: 1249 TTEHMFRIEYNTKKSSISIQYIALDDLTLEEPKTLEDKWKYYITSYSLSHPTEGIPQEEI 1308
            +TE+MFR++YN     +SIQYI LDD+TLE+ K   ++W YY+TSY+L HPTEGI Q+++
Sbjct: 1264 STENMFRVQYNKDTRHVSIQYIGLDDVTLEDAKDDNERWNYYMTSYALPHPTEGIMQDKL 1323

Query: 1309 KIPFLDKVIESEQVHMEDEDDNPKYSPEGVSKSNLMIKIDPETYRLEVEPGSFDIFSRKS 1368
             +PFL++++E E   ++ E  + +Y+P G S S L I IDP+TY+L ++ GS+DIFSR S
Sbjct: 1324 VVPFLERILEFENDMLDVEAGSDRYNPVGTSYSKLKINIDPKTYKLIIQDGSYDIFSRSS 1383

Query: 1369 VNKFPVDVFSESYKVKKQTRRNRCKNFLNGKHGWKRQLSSDAISKIE 1415
            +N++P+   S+ Y    + R+   + FL+G+ GWK+ LS D I+ +E
Sbjct: 1384 INEYPIRPDSKGYVQMVEKRKETAQKFLDGRFGWKKDLSDDVINTVE 1430

 Score =  179 bits (454), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 89/94 (94%)

Query: 119 SYYRPLNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGY 178
           S YRPLNVKDAL+YLEQVKLQFNSRP IYN FLDIMKDFKSQ+IDTPGVIERVSTLF+G+
Sbjct: 216 SPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKGF 275

Query: 179 PNLIQGFNTFLPQGYTIECSSNPDDPIKVTTPLG 212
           P LIQGFNTFLPQGY IECSSNP++PIKVTTP+G
Sbjct: 276 PALIQGFNTFLPQGYRIECSSNPNEPIKVTTPMG 309

 Score = 52.4 bits (124), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 54/95 (56%), Gaps = 6/95 (6%)

Query: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTF 188
           A++Y+ ++K +F+ +PDIY +FL+I++ ++ +      V  +V+ LF   P+L+  F  F
Sbjct: 384 AISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLFHNAPDLLDDFKKF 443

Query: 189 LPQGYTIECSSNPDDPIKVTTPLGSQIVTNSSIAK 223
           LP       +SN   P +  +P   Q+ + + +A+
Sbjct: 444 LPDS----SASNEQQPKQ--SPYSPQVYSGADMAR 472

 Score = 34.7 bits (78), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 30/48 (62%)

Query: 366 AVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQ 413
           A+SY+ ++K +F  +P IY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 226 ALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFK 273

>ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YOL004W (SIN3)
          Length = 1377

 Score = 1229 bits (3180), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 645/1168 (55%), Positives = 801/1168 (68%), Gaps = 85/1168 (7%)

Query: 315  KPAVLQVSNTNTGISSPSSTIPAGTVPGTTVANNIQGTTQIEKPADVEFSQAVSYVNKIK 374
            +P +    N  T   S   +  A   P TT     Q  T  +K  DVEFS A+SYVNKIK
Sbjct: 241  EPRLQSTQNVPTVYRSAEGSPAAIATPATTQE---QYGTGPKKAGDVEFSHAISYVNKIK 297

Query: 375  NRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNAXXXXXXXXXXXXXSS-PSV 433
             RFA+QPDIYKHFLEILQTYQREQKPI+EVYAQVTVLFQNA             SS P +
Sbjct: 298  TRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDSSAPQL 357

Query: 434  TTXXXXXXXXXXXXXXXXXMYGVNNGYYQAG---KIPSAN-----QNLPPLGNFSPPSNG 485
             +                 M     G+ Q+G    +P        QNLPPLGNFS P + 
Sbjct: 358  QSHQQINGA----------MVAPGFGHAQSGLQQALPGTQPLMHQQNLPPLGNFSTPGD- 406

Query: 486  AVPGRPEEFSTEAQHHMMALPSMLQAPTEHAQLHAQQHIAP--MTNEAIPISDLRSQIID 543
                          HH M+LPS +Q P          HI    ++N+ IP+SDLR     
Sbjct: 407  --------------HHPMSLPS-VQGPNVGLSQGQSGHIVTQGVSNQHIPVSDLRGAPDA 451

Query: 544  NNHVHNYTPIELAXXXXXXXXXXXXXXXXXXXXXXLEAAYATEGIVRPEIDLDXXXXXXX 603
            +     Y  ++                         +  Y  E  VRPEIDLD       
Sbjct: 452  SFRASEYNQVQ-------------------------DVQY-MEPTVRPEIDLDPSLVPVI 485

Query: 604  XXXXXXXXXXXXXVEEANFFDKAKKFIGNKQVYVEFLKILNLYSQDILSLDDLIEKVDYY 663
                         VEEA FFDKAKKFIGNKQ+Y EFLKILNLYSQD+L  + L+E V +Y
Sbjct: 486  PEPIKPLEDELNLVEEATFFDKAKKFIGNKQIYTEFLKILNLYSQDLLEKEKLVEDVSHY 545

Query: 664  LGSNKELFDWFKNFVGFQDKPKHIENVVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSG 723
            L  + ELFDWFK+FVG+Q++PKHIENV+HEKH+LDLDLCEACGPSYK+LPK DTFMPCSG
Sbjct: 546  LSGSPELFDWFKSFVGYQERPKHIENVIHEKHRLDLDLCEACGPSYKRLPKADTFMPCSG 605

Query: 724  RDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQ 783
            RDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIEEERHEYDFYIE+NLRTIQ
Sbjct: 606  RDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQ 665

Query: 784  TLETIASKIANMTEEEKQAFKLPIGLGHTSTTIYQKVIRKVYDKERGFEIIDALHEYPSV 843
            TLETIA+KIANMT EEK AFKLP GLGHTS TIY+KVIRKVYDK+RGFEIIDALHE+P++
Sbjct: 666  TLETIANKIANMTPEEKAAFKLPPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHEHPAI 725

Query: 844  AVPVVLKRLKQKDKEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQSDKKLLTTKQLL 903
             VP+VLKRLKQKD+EWRRAQREWNKVWRELEQKVF+KSLDHLGLTFKQ+DKKLLT KQL+
Sbjct: 726  TVPLVLKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLI 785

Query: 904  AEISSIKVDQTNKRIHWLTPKPKSQLDYEVKDKRVLFDILRLADVFINHTSSYSNPDKER 963
            +EISSIKVDQ+NKRIH LTPK KSQL Y+ K+  V  DIL L  VF+ + ++YS  D ER
Sbjct: 786  SEISSIKVDQSNKRIHPLTPKAKSQLSYDFKEPEVFQDILSLVMVFLANNNTYSPSDNER 845

Query: 964  LRDFLQSYIGLFFSIPIREIKDAV------EAAIDNGKQLDENEQXXXXXXXXXRPR--- 1014
            L+DF + +I LFFS P+ EI++ +         I +G    ++++         R R   
Sbjct: 846  LKDFFKGFISLFFSYPLHEIEEGLLKRSSQNGTISHGDDTRKSKEDPKTEKHSARKRVRD 905

Query: 1015 DVEICLSDILNRSRYQRLKHSLDSSEASLGAVSPGQNEQD-DMDEMIRQEAKKPWLLGSL 1073
            D E  L DIL R++ Q++     + ++S       + E D +  E++RQEAKKPWLLGS+
Sbjct: 906  DTEHLLRDILYRNKQQKVNKGPQNDQSS----EEFEKESDIEEKEIVRQEAKKPWLLGSI 961

Query: 1074 VEEANSQGLIQNRKIYNMFANVNMYVFMRNLITIYDRLHEVKDINDVVTKEINGRKVVQF 1133
            V+EA++ G + +R  +NMFAN N+YVF R+L T+Y+RL EVK IN  VTKEI+ RKVVQF
Sbjct: 962  VDEADNHGHVSDRVTFNMFANTNIYVFFRHLTTMYERLVEVKKINGEVTKEISNRKVVQF 1021

Query: 1134 AKDLNLISAQLKNMGLDFSGGDSYTQLLLLSKRLIEGDLEHQWFEESLRQAYRNRAFKLY 1193
            AKDLNLIS QL +MGLDF G D+Y +LL LS+ LI G+LEHQWFEESLRQAY+N+AFKLY
Sbjct: 1022 AKDLNLISTQLTDMGLDFKGADAYEELLRLSRSLISGELEHQWFEESLRQAYKNKAFKLY 1081

Query: 1194 TIDKVIQSLVKHAHAIMTDSKSSDVMALFEKDRISSSTTSKDQILYRLQTRSHMSTTEHM 1253
            TIDKVIQ+LVKHAH I+ D K+ ++M LF+ DR S+ST++KDQILYRLQ RS+MS  E+M
Sbjct: 1082 TIDKVIQALVKHAHTILMDHKTVEIMLLFDNDRTSTSTSTKDQILYRLQVRSNMSNIENM 1141

Query: 1254 FRIEYNTKKSSISIQYIALDDLTLEEPKTLEDKWKYYITSYSLSHPTEGIPQEEIKIPFL 1313
            FRIEYNT  S  SIQ++A++DLTL+EPK+L DKW+YY+TSYSLSHPTEGI  + ++ PFL
Sbjct: 1142 FRIEYNTTTSHASIQFVAVEDLTLDEPKSLRDKWQYYLTSYSLSHPTEGISHDNLRTPFL 1201

Query: 1314 DKVIESEQVHMEDEDDNPKYSPEGVSKSNLMIKIDPETYRLEVEPGSFDIFSRKSVNKFP 1373
            +K+IE ++ +++D D+  +YSPEGV+ SN+ +KIDP TY +EVEPG  DIFSRKSVNKFP
Sbjct: 1202 EKIIERDEGYIDDGDE--RYSPEGVASSNMKVKIDPLTYSMEVEPGCHDIFSRKSVNKFP 1259

Query: 1374 VDVFSESYKVKKQTRRNRCKNFLNGKHGWKRQLSSDAISKIEQKFNDLK-NGTFQQRSRS 1432
              V  +  K K    +   + FLNG+ GWKR L++   ++ E++   +K NGT    +  
Sbjct: 1260 TRV--DVKKKKSAELKLVLEGFLNGERGWKRGLTTKRTAEAERRLEYVKNNGTLDDYAEE 1317

Query: 1433 ATSETTSVPLNASDSTQKEQESTGTSET 1460
             +++T +     +D+      ++ +S+T
Sbjct: 1318 ISTDTKAALSTTTDTAGNVSTASFSSQT 1345

 Score =  184 bits (468), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 82/97 (84%), Positives = 89/97 (91%)

Query: 117 DGSYYRPLNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFR 176
           DGS YRPLNVKDAL+YLEQVK QF+SRPD+YNHFLDIMKDFKSQ+IDTPGVIERVSTLF 
Sbjct: 125 DGSAYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFH 184

Query: 177 GYPNLIQGFNTFLPQGYTIECSSNPDDPIKVTTPLGS 213
           GYP LIQGFNTFLP GY IEC S+P+DPIKVTTP G+
Sbjct: 185 GYPALIQGFNTFLPHGYNIECPSDPNDPIKVTTPFGT 221

 Score = 53.5 bits (127), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 40/62 (64%)

Query: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTF 188
           A++Y+ ++K +F  +PDIY HFL+I++ ++ +      V  +V+ LF+  P+L+  F  F
Sbjct: 289 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 348

Query: 189 LP 190
           LP
Sbjct: 349 LP 350

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 32/49 (65%)

Query: 366 AVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQN 414
           A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +V+ LF  
Sbjct: 137 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHG 185

 Score = 33.5 bits (75), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 3/70 (4%)

Query: 124 LNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQ 183
           LN+ +  T+ ++ K +F     IY  FL I+  +    ++   ++E VS    G P L  
Sbjct: 496 LNLVEEATFFDKAK-KFIGNKQIYTEFLKILNLYSQDLLEKEKLVEDVSHYLSGSPELFD 554

Query: 184 GFNTFLPQGY 193
            F +F+  GY
Sbjct: 555 WFKSFV--GY 562

>YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Component
            of the Sin3p-Rpd3p histone deacetylase complex, involved
            in transcriptional repression and activation of diverse
            processes, including mating-type switching and meiosis;
            involved in the maintenance of chromosomal integrity
          Length = 1536

 Score = 1222 bits (3162), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 649/1158 (56%), Positives = 789/1158 (68%), Gaps = 81/1158 (6%)

Query: 356  EKPADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNA 415
            +K  DVEFSQA+SYVNKIK RFADQPDIYKHFLEILQTYQREQKPI+EVYAQVT LFQNA
Sbjct: 401  KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNA 460

Query: 416  XXXXXXXXXXXXXSSPSVTTXXXXXXXXXXXXXXXXX----------------------- 452
                         SS S                                           
Sbjct: 461  PDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQAQAQAQAQAQVEQQKQQQQF 520

Query: 453  MYGVNNGYYQAGKIPSANQNLPPLGNFSPPSNGAVPGRPEEFSTEAQH----HMMALPSM 508
            +Y  +  Y          QNLPP+G+FSPP+NG+      E   + QH    H M LPS+
Sbjct: 521  LYPASGYYGHPSNRGIPQQNLPPIGSFSPPTNGSTV---HEAYQDQQHMQPPHFMPLPSI 577

Query: 509  LQAPTEHAQLHAQQHIAPMTNEAIPISDLRSQIIDNNHVHNYTPIELAXXXXXXXXXXXX 568
            +Q    H      Q IA   NE  P+SDLR+ + +      Y P  +             
Sbjct: 578  VQ----HGPNMVHQGIA---NENPPLSDLRTSLTEQ-----YAPSSI-----------QH 614

Query: 569  XXXXXXXXXXLEAAYATEGIVRPEIDLDXXXXXXXXXXXXXXXXXXXXVEEANFFDKAKK 628
                      +      +  VRPEIDLD                     EE  FF+KAK+
Sbjct: 615  QQQHPQSISPIANTQYGDIPVRPEIDLDPSIVPVVPEPTEPIENNISLNEEVTFFEKAKR 674

Query: 629  FIGNKQVYVEFLKILNLYSQDILSLDDLIEKVDYYLGSNKELFDWFKNFVGFQDKPKHIE 688
            +IGNK +Y EFLKILNLYSQDIL LDDL+EKVD+YLGSNKELF WFKNFVG+Q+K K IE
Sbjct: 675  YIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFTWFKNFVGYQEKTKCIE 734

Query: 689  NVVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSG 748
            N+VHEKH+LDLDLCEA GPSYK+LPK+DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSG
Sbjct: 735  NIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSG 794

Query: 749  FIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKQAFKLPIG 808
            FIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQ LETI +KI NMTE EK  FKLP G
Sbjct: 795  FIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPG 854

Query: 809  LGHTSTTIYQKVIRKVYDKERGFEIIDALHEYPSVAVPVVLKRLKQKDKEWRRAQREWNK 868
            LGHTS TIY+KVIRKVYDKERGFEIIDALHE+P+V  PVVLKRLKQKD+EWRRAQREWNK
Sbjct: 855  LGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNK 914

Query: 869  VWRELEQKVFFKSLDHLGLTFKQSDKKLLTTKQLLAEISSIKVDQTNKRIHWLTPKPKSQ 928
            VWRELEQKVFFKSLDHLGLTFKQ+DKKLLTTKQL++EISSIKVDQTNK+IHWLTPKPKSQ
Sbjct: 915  VWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQ 974

Query: 929  LDYEVKDKRVLFDILRLADVFINHTSSYSNPDKERLRDFLQSYIGLFFSIPIREIKDAVE 988
            LD++  DK + +DIL LAD FI HT++YSNPDKERL+D L+ +I LFFSI   +I++++ 
Sbjct: 975  LDFDFPDKNIFYDILCLADTFITHTTAYSNPDKERLKDLLKYFISLFFSISFEKIEESLY 1034

Query: 989  AAIDNGKQLDENEQXXXXXXXXXRPRDVEICLSDILNRSRYQRLKHS--LDSSEASLGAV 1046
            +   N  +               RP   E+ L DIL+RSRYQ+LK S   D     L   
Sbjct: 1035 SHKQNVSES-SGSDDGSSIASRKRPYQQEMSLLDILHRSRYQKLKRSNDEDGKVPQLSEP 1093

Query: 1047 SPGQNEQDDMDEMIRQEAKKPWLLGSLVEEANSQGLIQNRKIYNMFANVNMYVFMRNLIT 1106
               +    + +E+I +EAK PWL G+LVEEANSQG+IQNR I+N+FAN N+Y+F R+  T
Sbjct: 1094 PEEEPNTIEEEELIDEEAKNPWLTGNLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTT 1153

Query: 1107 IYDRLHEVKDINDVVTKEINGRKVVQFAKDLNLISAQLKNMGLDFSGGDSYTQLLLLSKR 1166
            IY+RL E+K +N+ VTKEIN R  V FAKDL+L+S+QL  MGLDF G D+Y Q+L LS+R
Sbjct: 1154 IYERLLEIKQMNERVTKEINTRSTVTFAKDLDLLSSQLSEMGLDFVGEDAYKQVLRLSRR 1213

Query: 1167 LIEGDLEHQWFEESLRQAYRNRAFKLYTIDKVIQSLVKHAHAIMTDSKSSDVMALFEKDR 1226
            LI GDLEHQWFEESLRQAY N+AFKLYTIDKV QSLVKHAH +MTD+K++++MALF KDR
Sbjct: 1214 LINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDR 1273

Query: 1227 ISSSTTSKDQILYRLQTRSHMSTTEHMFRIEYNTKKSSISIQYIALDDLTLEEPKTLEDK 1286
             +S+T++KDQI+YRLQ RSHMS TE+MFRIE++ +   +SIQYIALDDLTL+EPK  EDK
Sbjct: 1274 NASTTSAKDQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKADEDK 1333

Query: 1287 WKYYITSYSLSHPTEGIPQEEIKIPFLDKVIESEQVHMEDEDDNPKYSPEGVSKSNLMIK 1346
            WKYY+TSY+L HPTEGIP E++KIPFL+++IE  Q  ++  + + ++SPEG+S S L IK
Sbjct: 1334 WKYYVTSYALPHPTEGIPHEKLKIPFLERLIEFGQ-DIDGTEVDEEFSPEGISVSTLKIK 1392

Query: 1347 IDPETYRLEVEPGSFDIFSRKSVNKFPVDVFSESYKVKKQTRRNRCKNFLNGKHGWKRQL 1406
            I P TY+L +E GS+D+F+RK+ NK+P      + K     ++     FL+   G +  L
Sbjct: 1393 IQPITYQLHIENGSYDVFTRKATNKYPTIANDNTQKGMVSQKKELISKFLDCAVGLRNNL 1452

Query: 1407 SSDAISKIEQKFNDLKNG--------------------TFQQRSRSATSETTSVPLNASD 1446
                   +++K+ +LK+                     T Q++S +  S T SV L AS 
Sbjct: 1453 DEAQKLSMQKKWENLKDSIAKTSAGNQGIESETEKGKITKQEQSDNLDSSTASV-LPASI 1511

Query: 1447 STQKEQ---ESTGTSETS 1461
            +T  +    E+TG +E+S
Sbjct: 1512 TTVPQDDNIETTGNTESS 1529

 Score =  187 bits (474), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 85/99 (85%), Positives = 92/99 (92%)

Query: 121 YRPLNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPN 180
           YRPLNVKDAL+YLEQVK QF+SRPDIYN FLDIMKDFKSQ+IDTPGVIERVSTLFRGYP 
Sbjct: 216 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 275

Query: 181 LIQGFNTFLPQGYTIECSSNPDDPIKVTTPLGSQIVTNS 219
           LIQGFNTFLPQGY IECSSNPDDPI+VTTP+G+  V N+
Sbjct: 276 LIQGFNTFLPQGYRIECSSNPDDPIRVTTPMGTTTVNNN 314

 Score = 53.9 bits (128), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 41/62 (66%)

Query: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTF 188
           A++Y+ ++K +F  +PDIY HFL+I++ ++ +      V  +V+ LF+  P+L++ F  F
Sbjct: 411 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 470

Query: 189 LP 190
           LP
Sbjct: 471 LP 472

 Score = 37.7 bits (86), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 32/48 (66%)

Query: 366 AVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQ 413
           A+SY+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 224 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 271

>CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004w SIN3
            transcription regulatory protein
          Length = 1493

 Score = 1191 bits (3080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 628/1227 (51%), Positives = 810/1227 (66%), Gaps = 91/1227 (7%)

Query: 312  ESKKPAVLQVSNTNTGISSPSSTIPAGTVPGTTVANNIQGTTQIEKPADVEFSQAVSYVN 371
            +S  P+ +Q +N  T   +  + + +   P  T  +  Q     +KPADVEFSQA++YVN
Sbjct: 288  KSPSPSDIQTNNQQTQAIAQEAQLQSQATPIPTQHDVGQNFGSAKKPADVEFSQAITYVN 347

Query: 372  KIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNAXXXXXXXXXXXXXSSP 431
            KIK RFADQPDIYK FLEILQTYQREQKPI EVYAQVT+LFQNA             SS 
Sbjct: 348  KIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNAPDLLDDFKKFLPDSSA 407

Query: 432  SVT----------TXXXXXXXXXXXXXXXXXMYGVN--NGYYQAGK---------IPSAN 470
            S +                              G+N   GYY+  K              
Sbjct: 408  SGSEETQVQQQQHYQSLSDKMGGNAEAANYAASGMNAQTGYYEPVKGGVSYNTQQNQHQQ 467

Query: 471  QNLPPLGNFSPPSNGAVPGRPEEFST-EAQHHMMALPSML---QAPTEHA--QLHA---- 520
            QNLPP+G+FSPP+NG    + ++ +  E Q  +M+LPSM+   +A  E A  Q H+    
Sbjct: 468  QNLPPIGSFSPPTNGPFVDQTQQSANPETQKGVMSLPSMMNNAEAVKEQAIKQAHSRLIS 527

Query: 521  -------QQHIAPM---TNEAIPISDLRSQIIDNNHVHNYTPIELAXXXXXXXXXXXXXX 570
                   QQ +      +N+ IP+S+LR+ +++     NY P  +               
Sbjct: 528  DSHDHNSQQQVLSQNIHSNDDIPVSNLRTTVVE----QNYHPETI------------YQQ 571

Query: 571  XXXXXXXXLEAAYA---TEGIVRPEIDLDXXXXXXXXXXXXXXXXXXXXVEEANFFDKAK 627
                    ++  Y    +E +VRPEIDLD                    +EE NFF++ K
Sbjct: 572  QGNAQQHMVDGGYVGTPSELVVRPEIDLDPSLVPVVPEPTEPIENSLNLMEETNFFERVK 631

Query: 628  KFIGNKQVYVEFLKILNLYSQDILSLDDLIEKVDYYLGSNKELFDWFKNFVGFQDKPKHI 687
            K IGNKQ+Y EFLKILNL+S D+L++D+L++KV+YY+G+NKELFDWFK FVG+QDKPK I
Sbjct: 632  KSIGNKQIYNEFLKILNLFSLDLLTVDELVDKVEYYIGANKELFDWFKVFVGYQDKPKRI 691

Query: 688  ENVVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDS 747
            EN+VHEKHKLDLDLCEA GPSYKKLPKTDTFMPCSGRD+MCWEVLNDEWVGHPVWASEDS
Sbjct: 692  ENIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDS 751

Query: 748  GFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKQAFKLPI 807
            GFIAHRKNQYEETLFKIEEERHEYD+YIESNLRTIQTLETIA+KIANMT+ EK  F+LP 
Sbjct: 752  GFIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLETIANKIANMTDAEKAQFRLPP 811

Query: 808  GLGHTSTTIYQKVIRKVYDKERGFEIIDALHEYPSVAVPVVLKRLKQKDKEWRRAQREWN 867
            GLGHTS TIY+KVIRKVYDKERGFEIIDALH YP+++VP++L+RLKQKD+EWRRAQREWN
Sbjct: 812  GLGHTSMTIYKKVIRKVYDKERGFEIIDALHNYPAISVPIILRRLKQKDEEWRRAQREWN 871

Query: 868  KVWRELEQKVFFKSLDHLGLTFKQSDKKLLTTKQLLAEISSIKVDQTNKRIHWLTPKPKS 927
            K+WR+LEQKV+FKSLDHLGLTFKQ+DKKLLTTKQL++EI+ IKVDQ +KRIHWLTPKPK+
Sbjct: 872  KIWRDLEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEINGIKVDQNSKRIHWLTPKPKN 931

Query: 928  QLDYEVKDKRVLFDILRLADVFINHTSSYSNPDKERLRDFLQSYIGLFFSIPIREIKDAV 987
            QLDY+  D  +LFDI+ L  VF  +T+ YSNPDKER++D L+ ++  FFSIP++E+ DA+
Sbjct: 932  QLDYDFPDYDILFDIIALGFVFTINTNLYSNPDKERIKDMLRVFVSQFFSIPLKEVSDAL 991

Query: 988  EA---AIDNGKQLDE------------NEQXXXXXXXXXRPRDVEICLSDILNRSRYQRL 1032
            E    + DN    D+             E          RP D ++ +SDIL++++ Q+ 
Sbjct: 992  ERRGFSDDNNNDSDKGSGKMDQIAEEIGETEQDTSSSKKRPFDNDLNMSDILHKTKQQKT 1051

Query: 1033 KHS--LDSSEASLGAVSPGQNEQDDMDEMIRQEAKKPWLLGSLVEEANSQGLIQNRKIYN 1090
            K +  +D S++    +   +N     D     E +K WL+G +V+ AN +  + NR IYN
Sbjct: 1052 KMNKEMDGSKSPSEDLGTDRNVGTIEDSGSLSEHRKQWLVGDVVDSANKETPMDNRNIYN 1111

Query: 1091 MFANVNMYVFMRNLITIYDRLHEVKDINDVVTKEINGRKVVQFAKDLNLISAQLKNMGLD 1150
            +FAN N+Y+F R+L+T+Y+RL EVK IND + KEI  R+V  FAKDL LIS QL  +GLD
Sbjct: 1112 LFANTNIYIFFRHLVTLYERLSEVKQINDEINKEIKSRRVTTFAKDLGLISTQLSELGLD 1171

Query: 1151 FSGGDSYTQLLLLSKRLIEGDLEHQWFEESLRQAYRNRAFKLYTIDKVIQSLVKHAHAIM 1210
            F+  D+Y QLL LSKRLIEGD+EHQWFEES+RQAY NRAFKLYTIDKV+QS VKHAH ++
Sbjct: 1172 FNSSDAYQQLLTLSKRLIEGDIEHQWFEESIRQAYNNRAFKLYTIDKVVQSFVKHAHTLI 1231

Query: 1211 TDSKSSDVMALFEKDRISSSTTSKDQILYRLQTRSHMSTTEHMFRIEYNTKKSSISIQYI 1270
            +DSK+S++M LFE  R ++ TT+KDQILYR+Q RSHMS+TE+MFRIEY  +K   SIQYI
Sbjct: 1232 SDSKTSEIMLLFENQRNNTLTTTKDQILYRIQCRSHMSSTENMFRIEYKREKRHASIQYI 1291

Query: 1271 ALDDLTLEEPKTLEDKWKYYITSYSLSHPTEGIPQEEIKIPFLDKVIESEQVHMEDEDDN 1330
            ALDDLTL+  K+ E+ W YY+TSYSLS+PTEG+P E +++PFL+KVIE +Q + +D  +N
Sbjct: 1292 ALDDLTLKTAKSPEEAWNYYVTSYSLSNPTEGVPHENLEVPFLEKVIEFDQEYSKDNGNN 1351

Query: 1331 PKYSPEGVSKSNLMIKIDPETYRLEVEPGSFDIFSRKSVNKFPVDVFSESYKVKKQTRRN 1390
              YS  G+SKSNL I ID E Y L ++ GS D++SR ++ K+P+    ES       +  
Sbjct: 1352 STYSLAGISKSNLHIDIDREKYNLILQGGSSDVYSRATIQKYPIVASDESRAANISEKTQ 1411

Query: 1391 RCKNFLNGKHGWKRQLSSDAISKIEQKFN-DLKNGTFQQRSRSATSETTSVPLNASDSTQ 1449
              +  L+   G       ++   + +KFN  L NGT     R + +         +D + 
Sbjct: 1412 EIRKVLSHYDG-------NSNDDVNEKFNYILANGTIDGYVRQSAAVVQETEKTYNDDSG 1464

Query: 1450 KEQES------TGTSETSQPALQKVPI 1470
            +   S      + T  T +P +   PI
Sbjct: 1465 RNTSSIKSIIGSATERTEKPLINGSPI 1491

 Score =  183 bits (464), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 82/98 (83%), Positives = 91/98 (92%)

Query: 116 ADGSYYRPLNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLF 175
            D   YRPLNVKDAL+YLEQVK QF++RPDIYN FLDIMKDFKSQ+IDTPGVIERVS+LF
Sbjct: 180 GDPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLF 239

Query: 176 RGYPNLIQGFNTFLPQGYTIECSSNPDDPIKVTTPLGS 213
           +GYPNLIQGFNTFLPQGY IECS+NP+DPIKVTTP+GS
Sbjct: 240 KGYPNLIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGS 277

 Score = 54.7 bits (130), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 46/75 (61%), Gaps = 2/75 (2%)

Query: 118 GSYYRPLNVK--DALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLF 175
           GS  +P +V+   A+TY+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ LF
Sbjct: 329 GSAKKPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILF 388

Query: 176 RGYPNLIQGFNTFLP 190
           +  P+L+  F  FLP
Sbjct: 389 QNAPDLLDDFKKFLP 403

 Score = 38.5 bits (88), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 48/89 (53%), Gaps = 8/89 (8%)

Query: 326 TGISSPSST-IPAGTVPGTTVANNIQGTTQIEKPADVEFSQAVSYVNKIKNRFADQPDIY 384
           TG S  S+T  P  + P  T     QG     +P +V+   A+SY+ ++K +F  +PDIY
Sbjct: 159 TGASETSTTQSPLVSGPAQT-----QGDPMSYRPLNVK--DALSYLEQVKFQFHTRPDIY 211

Query: 385 KHFLEILQTYQREQKPISEVYAQVTVLFQ 413
             FL+I++ ++ +      V  +V+ LF+
Sbjct: 212 NLFLDIMKDFKSQTIDTPGVIERVSSLFK 240

>NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1657

 Score = 1165 bits (3013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 610/1137 (53%), Positives = 769/1137 (67%), Gaps = 70/1137 (6%)

Query: 360  DVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNA---- 415
            +VEFSQA++YVNKIK R+ADQP IYKHFLEILQTYQRE+KPISEVY QVTVLF +A    
Sbjct: 464  EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLL 523

Query: 416  --------XXXXXXXXXXXXXSSPSVTTXXXXXXXXXXXXXXXXXMYGVNNGYYQAGKIP 467
                                 + P +                       NNG   +G   
Sbjct: 524  EDFKKFLPETPANNQPVQQPHAHPQLQQLQPRIPSISQQQQPSQLYPFSNNGPVPSGFYQ 583

Query: 468  SANQNLPPLGNFSPPSNGAVPGRPEEFSTEAQHHM-------MALPSMLQAPTEH---AQ 517
               QNLPP+G+FSPP+           +    ++         ALPSM+   TE    + 
Sbjct: 584  IPQQNLPPIGSFSPPTATNANATTTPAAGTVVNNFRHGISMQTALPSMMTPDTEAIPISN 643

Query: 518  LHAQQHIAPMTNEAIPISDLRSQIID------------NNHVHNYTPIELAXXXXXXXXX 565
            L +     P +   IP+ +  +Q  D             N + +  P++           
Sbjct: 644  LRSVDGFPPSSGGVIPMPN--NQTADFQYQQQQPQPPLTNRLPDQFPLDQQQSQQQQAQQ 701

Query: 566  XXXXXXXXXXXXXLEAAYATEGIVRPEIDLDXXXXXXXXXXXXXXXXXXXXVEEANFFDK 625
                          +    +E   RPEIDLD                    VEE +FF+K
Sbjct: 702  QAQQQ---------QQQLISEAPTRPEIDLDPSIVPIIPEPTEPIENNITLVEETSFFEK 752

Query: 626  AKKFIGNKQVYVEFLKILNLYSQDILSLDDLIEKVDYYLGSNKELFDWFKNFVGFQDKPK 685
             KKFI +K +Y+EFLK+LNLYSQD+LS ++L+ +VDYY+GSNKELFDWFK FVG+ + P 
Sbjct: 753  VKKFISSKPIYMEFLKVLNLYSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVGYSEIPS 812

Query: 686  HIENVVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASE 745
             IEN++HEKHKLDLDLCEA GPSYKKLPKTDTFMPCSGRD MCWEVLNDEWVGHPVWASE
Sbjct: 813  TIENIIHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWASE 872

Query: 746  DSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKQAFKL 805
            DSGFIAHRKNQYEETLFKIEEERHEYDF+IESNLRTIQTLETIA+KI NMT EEK+ FKL
Sbjct: 873  DSGFIAHRKNQYEETLFKIEEERHEYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKL 932

Query: 806  PIGLGHTSTTIYQKVIRKVYDKERGFEIIDALHEYPSVAVPVVLKRLKQKDKEWRRAQRE 865
            P+GLGHTS+TIY+KVIRKVYDKERGFEIIDALHE+P+ AVP++L+RLK+KD+EWRRAQRE
Sbjct: 933  PVGLGHTSSTIYKKVIRKVYDKERGFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQRE 992

Query: 866  WNKVWRELEQKVFFKSLDHLGLTFKQSDKKLLTTKQLLAEISSIKVDQTNKRIHWLTPKP 925
            WNKVWRELEQKV++KSLDHLGLTFKQ+DKKLLTTKQL++EISSI+VDQ NKRIHWLTPKP
Sbjct: 993  WNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIQVDQNNKRIHWLTPKP 1052

Query: 926  KSQLDYEVKDKRVLFDILRLADVFINHTSSYSNPDKERLRDFLQSYIGLFFSIPIREIKD 985
            KSQLD+   D  +L DIL LA+VFI+HTS+YSN +KERL+DFL+ +IGLFFSIP  EI  
Sbjct: 1053 KSQLDFTFNDHDILVDILDLANVFIDHTSTYSNSEKERLKDFLRVFIGLFFSIPSSEIDK 1112

Query: 986  AVEAAIDNGKQ---LDENEQXXXXXXXXXRPRDVEICLSDILNRSRYQRLKHSL------ 1036
             +    D   +      +           R  +++I L+D+L + +YQ++K  +      
Sbjct: 1113 KLSGKNDEKFEKGSSSSSSTSNSTPSAKKRSLELDIPLADVLRKYKYQKIKEKVINELEN 1172

Query: 1037 ------DSSEASLGAVSPGQNEQDDMDEMIRQEAKKPWLLGSLVEEANSQGLIQNRKIYN 1090
                  +  E     +   Q EQ++ D MI +E KKPWLLGS++++ +  GLI+NR I+N
Sbjct: 1173 NSNEYDERDEEFDEELKRQQQEQEEEDHMIDEEMKKPWLLGSVIDKTSEHGLIENRHIFN 1232

Query: 1091 MFANVNMYVFMRNLITIYDRLHEVKDINDVVTKEINGRKVVQFAKDLNLISAQLKNMGLD 1150
            +FAN N+YVF R+  TIY+RL E+K IND VT+EIN RKV  FAKDL LIS QL  MGLD
Sbjct: 1233 LFANTNIYVFFRHWTTIYERLLELKQINDKVTREINSRKVTPFAKDLGLISTQLTMMGLD 1292

Query: 1151 FSGGDSYTQLLLLSKRLIEGDLEHQWFEESLRQAYRNRAFKLYTIDKVIQSLVKHAHAIM 1210
            F   DSY +LL L+KRLI+ D+EHQWFEESLRQAY N+AFKLYT DKVIQ+LVKHA++I+
Sbjct: 1293 FKTSDSYKELLNLTKRLIKNDIEHQWFEESLRQAYNNKAFKLYTADKVIQALVKHANSIL 1352

Query: 1211 TDSKSSDVMALFEKDRISSSTTSKDQILYRLQTRSHMSTTEHMFRIEYNTKKSSISIQYI 1270
            TDSK+S++MALFEKDR+ SSTT++DQI+YRLQTR+HM+ TE+MFRIE+N   + + IQYI
Sbjct: 1353 TDSKASEIMALFEKDRLRSSTTTRDQIIYRLQTRTHMTNTENMFRIEFNENTNHVCIQYI 1412

Query: 1271 ALDDLTLEEPKTLEDKWKYYITSYSLSHPTEGIPQEEIKIPFLDKVIESEQVHMEDEDDN 1330
            A++DLTL+   T ++ W+YY+TSY+L HPTEG+PQE +K+PFL+K +  E  + +D D+ 
Sbjct: 1413 AVEDLTLKPSPTTKETWEYYVTSYALPHPTEGVPQEGLKVPFLEKNLNLELENAQDLDNE 1472

Query: 1331 P-------KYSPEGVSKSNLMIKIDPETYRLEVEPGSFDIFSRKSVNKFPVDVFSESYKV 1383
                    K SPEG+S S L IKID ETY L+VEPGSFD+FSRKS+NKFP D       +
Sbjct: 1473 TEKNEFIEKISPEGISTSKLKIKIDQETYNLDVEPGSFDVFSRKSLNKFPTDAKKIESSI 1532

Query: 1384 KKQTRRNRCKNFLNGKHGWKRQLSSDAISKIEQKFNDLK-NGTFQQRSRSATSETTS 1439
            K+++       FL+ K GW  Q   D ++ IE+ +   +  G F    +  T+E+T+
Sbjct: 1533 KEKSE--AFNKFLSSKRGWNNQFKPDQVAGIEEGWKKFQETGEFIPIPKPITTESTT 1587

 Score =  181 bits (459), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 81/98 (82%), Positives = 90/98 (91%)

Query: 121 YRPLNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPN 180
           YRPLNVKDAL+YLEQVK+QFNS+P IYN FLDIMKDFKSQ+IDTPGVIERVSTLF+GYP 
Sbjct: 270 YRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYPV 329

Query: 181 LIQGFNTFLPQGYTIECSSNPDDPIKVTTPLGSQIVTN 218
           LIQGFNTFLPQGYTI CS NPDDP++VTTP+G+   TN
Sbjct: 330 LIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGTSTYTN 367

 Score = 51.2 bits (121), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 40/63 (63%)

Query: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTF 188
           A+ Y+ ++K ++  +P IY HFL+I++ ++ +      V E+V+ LF   P+L++ F  F
Sbjct: 470 AINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKF 529

Query: 189 LPQ 191
           LP+
Sbjct: 530 LPE 532

 Score = 36.2 bits (82), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 30/48 (62%)

Query: 366 AVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQ 413
           A+SY+ ++K +F  QP IY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 278 ALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFK 325

>TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6.29
            YOL004W
          Length = 1739

 Score = 1156 bits (2991), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 571/917 (62%), Positives = 699/917 (76%), Gaps = 36/917 (3%)

Query: 586  EGIVRPEIDLDXXXXXXXXXXXXXXXXXXXXVEEANFFDKAKKFIGNKQVYVEFLKILNL 645
            E  VRPEIDLD                    VEE NFFDK KK+IGNK +Y EFLK+LNL
Sbjct: 827  ENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEFLKVLNL 886

Query: 646  YSQDILSLDDLIEKVDYYLGSNKELFDWFKNFVGFQDKPKHIENVVHEKHKLDLDLCEAC 705
            YS D+L +D+L+EK+ YYL  N+ELF WFKNFVG+ +KPKHIEN+VHEKHKLDLDLCEAC
Sbjct: 887  YSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDLDLCEAC 946

Query: 706  GPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 765
            GPSYKKLPKTDT MPCSGRDEMCWE+LNDEWVGHPVWASEDSGFIAHRK   ++   +++
Sbjct: 947  GPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKKPYLRLK 1006

Query: 766  EERHEYDFYIESNLRTIQTLETIASKIANMTEEEKQAFKLPIGLGHTSTTIYQKVIRKVY 825
            ++ HEYDFYIESNLRTIQTLETIASKIANMTE EK  FKLP GLGHT++TIY+KVIRKVY
Sbjct: 1007 KKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKKVIRKVY 1066

Query: 826  DKERGFEIIDALHEYPSVAVPVVLKRLKQKDKEWRRAQREWNKVWRELEQKVFFKSLDHL 885
            DKERGFEIIDALHEYP++AVPVVLKRLKQKD+EWRRAQREWNKVWRELEQKVFFKSLDHL
Sbjct: 1067 DKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHL 1126

Query: 886  GLTFKQSDKKLLTTKQLLAEISSIKVDQTNKRIHWLTPKPKSQLDYEVKDKRVLFDILRL 945
            GLTFKQ+DKKLLTTKQL++EISSIKVDQT+KR+HWLTPKPKSQLD+ + DK ++FDIL  
Sbjct: 1127 GLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDIIFDILSF 1186

Query: 946  ADVFINHTSSYSNPDKERLRDFLQSYIGLFFSIPIREIKDAV---EAAIDNGKQLDENEQ 1002
             ++F+ HTS+YSNP+KERL DF++ +  LFFSIP+ EIK+A+   +    N ++L++ ++
Sbjct: 1187 VEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDITEKNDEKLEDKQK 1246

Query: 1003 XXXXXXXXXRPRDVEICLSDILNRSRYQRLKHSLDSSEASLGAVSPGQNEQDDMD----- 1057
                       RD+ + L DIL R++YQRLK+  DS E     V    N  DD       
Sbjct: 1247 NGEENSKKRTSRDITLSLEDILQRTKYQRLKYGDDSDE-----VDGHGNRHDDQKLLEEE 1301

Query: 1058 EMIRQEAKKPWLLGSLVEEANSQGLIQNRKIYNMFANVNMYVFMRNLITIYDRLHEVKDI 1117
            E++RQEAKKPWLLG+LVEEAN+QG I +R I+NMF+N NMY+F+R+L T+Y+RLHE+K +
Sbjct: 1302 ELLRQEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLTTMYERLHEIKQM 1361

Query: 1118 NDVVTKEINGRKVVQFAKDLNLISAQLKNMGLDFSGGDSYTQLLLLSKRLIEGDLEHQWF 1177
            ND V++EI+GRK+ +FAKDLNLIS QL  MGLDFS GD Y QLL+L KRLI GDLEHQWF
Sbjct: 1362 NDKVSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCKRLILGDLEHQWF 1421

Query: 1178 EESLRQAYRNRAFKLYTIDKVIQSLVKHAHAIMTDSKSSDVMALFEKDRISSSTTSKDQI 1237
            EESLRQA+ N+AFKLYT+DKV Q+LVKHAH I++D K++++MALFEKDR  +ST+SKDQI
Sbjct: 1422 EESLRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKDRTKNSTSSKDQI 1481

Query: 1238 LYRLQTRSHMSTTEHMFRIEYNTKKSSISIQYIALDDLTLEEPKTLEDKWKYYITSYSLS 1297
            LYRLQTR+ M+  E+MFRIEYN     I IQYIALDDLT+++ KTLE+KWKYYITSY+LS
Sbjct: 1482 LYRLQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEEKWKYYITSYALS 1541

Query: 1298 HPTEGIPQEEIKIPFLDKVIESEQVHMEDEDDNP-------KYSPEGVSKSNLMIKIDPE 1350
            HPTEGI QE I+IPFL+++IE EQ++ ++E D+        KYSPEG+S S L IKIDP+
Sbjct: 1542 HPTEGIFQENIQIPFLERIIEEEQLYEDEETDDQKQTKSLMKYSPEGISGSTLKIKIDPQ 1601

Query: 1351 TYRLEVEPGSFDIFSRKSVNKFPVDVFSESYKVKKQTRRNRCKNFLNGKHGWKRQLSSDA 1410
             Y L +E GSFDIFSRKS+N+FPV +  +S        +N  + FLN K GWKR +S D 
Sbjct: 1602 NYCLNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNSKMGWKRAISKDQ 1661

Query: 1411 ISKIEQKFNDLKNG----TFQQRSRSATSETTSVPLNASDSTQKEQESTGTSETSQPALQ 1466
            +  IE K++ L N      +Q++S           L   + T   + S   + T   +  
Sbjct: 1662 MESIESKWDHLSNNGNLEGYQEKSI----------LKDVNGTDISKISPMKTFTVTESAN 1711

Query: 1467 KVPINSAEPDQEERGND 1483
             VP + A  D EERGND
Sbjct: 1712 GVPNDKA--DGEERGND 1726

 Score =  175 bits (444), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 87/97 (89%)

Query: 121 YRPLNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPN 180
           YRPLNVKDAL+YLEQVK QFNSRPD+YNHFLDIMKDFKSQ+IDTPGVI RVS+LF  YP+
Sbjct: 299 YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHDYPS 358

Query: 181 LIQGFNTFLPQGYTIECSSNPDDPIKVTTPLGSQIVT 217
           LIQGFNTFLPQGY IECSSNP+ PI V TP+G+  V+
Sbjct: 359 LIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTTVS 395

 Score =  116 bits (290), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 93/175 (53%), Gaps = 16/175 (9%)

Query: 323 NTNTGISSPSSTIP-AGTVPG-----TTVANNIQGTTQIEKPADVEFSQAVSYVNKIKNR 376
           NTNT  S  +  I  AGT        ++V+  +Q   +  +  DVEFSQA+SYVNKIKNR
Sbjct: 499 NTNTPKSQTTPPIATAGTATQQFPMVSSVSPPLQELPEQRRTQDVEFSQAISYVNKIKNR 558

Query: 377 FADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNAXXXXXXXXXXXXXSSPSVTTX 436
           FA+QP IYKHFLEILQTYQREQKPI+EVY+QVTVLFQ A             SS +    
Sbjct: 559 FANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLLEDFKKFLPDSSAN---- 614

Query: 437 XXXXXXXXXXXXXXXXMYGVNNGYYQAGKIPSAN---QNLPPLGNFSPPSNGAVP 488
                           MY       Q    P +    QNLPPLG+FS   NG  P
Sbjct: 615 ---NNGSIVTSQEENFMYANGFNQQQPHLTPHSEIQAQNLPPLGSFSTQPNGVFP 666

 Score = 50.1 bits (118), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 41/62 (66%)

Query: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTF 188
           A++Y+ ++K +F ++P IY HFL+I++ ++ +      V  +V+ LF+  P+L++ F  F
Sbjct: 548 AISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLLEDFKKF 607

Query: 189 LP 190
           LP
Sbjct: 608 LP 609

 Score = 42.4 bits (98), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 38/58 (65%), Gaps = 2/58 (3%)

Query: 357 KPADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQN 414
           +P +V+   A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V A+V+ LF +
Sbjct: 300 RPLNVK--DALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHD 355

 Score = 34.7 bits (78), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 30/72 (41%), Gaps = 2/72 (2%)

Query: 28  LPSFSNINPEXXXXXXXXXXXXXXXXXXXXXXXXXXXGVKLENSSSLSRPNLPKT--STT 85
           LPS S++N E                           G+   N+S +SR N   T  S  
Sbjct: 79  LPSISDLNVESNVMVNQHQQLQHPSISPSQNMTSMNTGIMNSNTSGISRHNSNPTPKSNP 138

Query: 86  LSVASFDNPLPP 97
           L V+SFDNPLPP
Sbjct: 139 LKVSSFDNPLPP 150

>Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL004W
            (REAL)
          Length = 1566

 Score = 1138 bits (2944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/1015 (57%), Positives = 727/1015 (71%), Gaps = 35/1015 (3%)

Query: 453  MYGVNNGYYQAGKIPSANQNLPPLGNFSPPSNGAVPGRPEEFSTEAQH----HMMALPSM 508
            +Y  ++ Y  +       QNLPP+G+FSPP+NG+      E   + QH    H+M LPSM
Sbjct: 552  LYPASSYYGHSNNRGIPQQNLPPIGSFSPPTNGSTV---HENYQDQQHMQPPHLMPLPSM 608

Query: 509  LQAPTEHAQLHAQQHIAPMTNEAIPISDLRSQIIDNNHVHNYTPIELAXXXXXXXXXXXX 568
            +Q    H      Q IA   NE +P+SDLR+ + +      Y P  +             
Sbjct: 609  VQ----HGANIVHQGIA---NENLPLSDLRTSLTEQ-----YAPSNIQQQQQQHPQSISP 656

Query: 569  XXXXXXXXXXLEAAYATEGIVRPEIDLDXXXXXXXXXXXXXXXXXXXXVEEANFFDKAKK 628
                      +  +   +  VRPEIDLD                     EE  FF+KAK+
Sbjct: 657  ----------IANSQYGDVPVRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKR 706

Query: 629  FIGNKQVYVEFLKILNLYSQDILSLDDLIEKVDYYLGSNKELFDWFKNFVGFQDKPKHIE 688
            +IGNK +Y EFLKILNLYSQDIL LDDL+EKVD+YLGSNKELF WFKNFVG+Q++ K IE
Sbjct: 707  YIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQERTKFIE 766

Query: 689  NVVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSG 748
            N+VHEKH+LDLDLCEA GPSYK+LPK+DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSG
Sbjct: 767  NIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSG 826

Query: 749  FIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKQAFKLPIG 808
            FIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQ LETI +KI NMTE EK  FKLP G
Sbjct: 827  FIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKVNFKLPPG 886

Query: 809  LGHTSTTIYQKVIRKVYDKERGFEIIDALHEYPSVAVPVVLKRLKQKDKEWRRAQREWNK 868
            LGHTS TIY+KVIRKVYDKERGFEIIDALHE+P+V  PVVLKRLKQKD+EWRRAQREWNK
Sbjct: 887  LGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNK 946

Query: 869  VWRELEQKVFFKSLDHLGLTFKQSDKKLLTTKQLLAEISSIKVDQTNKRIHWLTPKPKSQ 928
            VWRELEQKVFFKSLDHLGLTFKQ+DKKLLTTKQL++EISSIKVDQTNK+IHWLTPKPKSQ
Sbjct: 947  VWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQ 1006

Query: 929  LDYEVKDKRVLFDILRLADVFINHTSSYSNPDKERLRDFLQSYIGLFFSIPIREIKDAVE 988
            LD++  DK +  DIL LAD FI+HT++YSNPDKERL+D L+ +I LFFSI + EI+++++
Sbjct: 1007 LDFDFPDKNIFCDILYLADSFISHTTAYSNPDKERLKDLLKYFISLFFSISLEEIEESLQ 1066

Query: 989  AAIDNGKQLDENEQXXXXXXXXXRPRDVEICLSDILNRSRYQRLKHSLDSSE--ASLGAV 1046
             A                     R    E+ L DIL+RSRYQ+LK S D       L   
Sbjct: 1067 -AYKQSVSESSGSDDGGSSVSRKRSYQQEMTLLDILHRSRYQKLKRSKDEDGKVPQLSEA 1125

Query: 1047 SPGQNEQDDMDEMIRQEAKKPWLLGSLVEEANSQGLIQNRKIYNMFANVNMYVFMRNLIT 1106
               ++   + +E+I +EAK PWL G+LVEEANSQG+IQNR I+N+FAN N+Y+F R+  T
Sbjct: 1126 PDEESNIIEEEELINEEAKNPWLTGNLVEEANSQGMIQNRGIFNLFANTNIYIFFRHWTT 1185

Query: 1107 IYDRLHEVKDINDVVTKEINGRKVVQFAKDLNLISAQLKNMGLDFSGGDSYTQLLLLSKR 1166
            IY+RL E+K +N+ VTKEIN R  V FAKDL+L+S QL  MGLDF G D+Y Q+L LS+R
Sbjct: 1186 IYERLLEIKQMNEKVTKEINTRSTVTFAKDLDLLSNQLSEMGLDFIGEDAYKQVLKLSRR 1245

Query: 1167 LIEGDLEHQWFEESLRQAYRNRAFKLYTIDKVIQSLVKHAHAIMTDSKSSDVMALFEKDR 1226
            LI GDLEHQWFEESLRQAY NRAFKLYTIDKV QSLVKHAH +MTD+K++++MALF KDR
Sbjct: 1246 LINGDLEHQWFEESLRQAYNNRAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDR 1305

Query: 1227 ISSSTTSKDQILYRLQTRSHMSTTEHMFRIEYNTKKSSISIQYIALDDLTLEEPKTLEDK 1286
              ++T++K QI+YRLQ RSHMS TE+MFRIE++ +   +SIQYIALDDLTL+EPK  EDK
Sbjct: 1306 NVTTTSAKGQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKEDEDK 1365

Query: 1287 WKYYITSYSLSHPTEGIPQEEIKIPFLDKVIESEQVHMEDEDDNPKYSPEGVSKSNLMIK 1346
            WKYY+TSY+L HPTEG+  E++KIPFL+++IE  Q  ++ +D + K+SPEG+S S L IK
Sbjct: 1366 WKYYVTSYALPHPTEGVLHEKLKIPFLERLIEFGQ-DIDGKDVDEKFSPEGISVSTLKIK 1424

Query: 1347 IDPETYRLEVEPGSFDIFSRKSVNKFPVDVFSESYKVKKQTRRNRCKNFLNGKHGWKRQL 1406
            I P TY+L++E GS+D+F+RKS NK+P     +++K     ++     FL+     +  L
Sbjct: 1425 IQPTTYKLDIENGSYDVFTRKSANKYPTVANDDTHKEVVVQKKELISRFLDCAVHLRNDL 1484

Query: 1407 SSDAISKIEQKFNDLKNGTFQQRSRSATSETTSVPLNASDSTQKEQESTGTSETS 1461
            +      +++KF  LK+ T +        +T      A+ + Q++QE+  +S+ S
Sbjct: 1485 NESQKISMQEKFESLKDTTAKLNVDGQVVDTKIE--EATKTKQEQQENLASSDAS 1537

 Score =  186 bits (471), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 84/99 (84%), Positives = 92/99 (92%)

Query: 121 YRPLNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPN 180
           YRPLNVKDAL+YLEQVK QF+SRPDIYN FLDIMKDFKSQ+IDTPGVIERVSTLFRGYP 
Sbjct: 229 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 288

Query: 181 LIQGFNTFLPQGYTIECSSNPDDPIKVTTPLGSQIVTNS 219
           LIQGFNTFLPQGY IECS+NPDDPI+VTTP+G+  V N+
Sbjct: 289 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNN 327

 Score =  114 bits (286), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 72/101 (71%), Gaps = 7/101 (6%)

Query: 318 VLQVSNTNTGISSPSSTIPAGTVPGTTVANNIQGTT---QIEKPADVEFSQAVSYVNKIK 374
           VL +S T+TG+ S    I    +P       IQ       ++K  DVEFSQA+SYVNKIK
Sbjct: 377 VLPLSATSTGLPS----IQQSEIPVHHQIPQIQPLAVQEDVKKNVDVEFSQAISYVNKIK 432

Query: 375 NRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNA 415
            RFADQPDIYKHFLEILQTYQREQKPI+EVYAQVT LFQNA
Sbjct: 433 TRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNA 473

 Score = 53.9 bits (128), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 41/62 (66%)

Query: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTF 188
           A++Y+ ++K +F  +PDIY HFL+I++ ++ +      V  +V+ LF+  P+L++ F  F
Sbjct: 424 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 483

Query: 189 LP 190
           LP
Sbjct: 484 LP 485

 Score = 37.7 bits (86), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 32/48 (66%)

Query: 366 AVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQ 413
           A+SY+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 237 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 284

>Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL004W
            (REAL)
          Length = 1561

 Score = 1130 bits (2923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/1018 (57%), Positives = 733/1018 (72%), Gaps = 46/1018 (4%)

Query: 453  MYGVNNGYYQA--GKIPSANQNLPPLGNFSPPSNGAVPGRPEEFSTEAQH----HMMALP 506
            +Y  +N Y  +  G IP   QNLPP+G+FSPP+NG+      E   + QH    H+M LP
Sbjct: 545  LYPASNYYSHSTNGGIPQ--QNLPPIGSFSPPTNGSTT---HEGFQDQQHMQPPHLMPLP 599

Query: 507  SMLQ-APTEHAQLHAQQHIAPMTNEAIPISDLRSQIIDNNHVHNYTPIELAXXXXXXXXX 565
            SM+Q  P    Q         + NE IP+SDLR+ + D     N+               
Sbjct: 600  SMVQQGPNMVHQ--------GIVNENIPLSDLRTSLTDQYAPSNFQ-------------- 637

Query: 566  XXXXXXXXXXXXXLEAAYATEGIVRPEIDLDXXXXXXXXXXXXXXXXXXXXVEEANFFDK 625
                         +++ Y  +  VRPEIDLD                     EE  FF+K
Sbjct: 638  -QQQQQQPSISPIIDSQYG-DVPVRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEK 695

Query: 626  AKKFIGNKQVYVEFLKILNLYSQDILSLDDLIEKVDYYLGSNKELFDWFKNFVGFQDKPK 685
            AK++IGNK +Y EFLKILNLYSQDIL LDDL+EKVD+YLGSNKELF WFKNFVG+Q+K K
Sbjct: 696  AKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEKIK 755

Query: 686  HIENVVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASE 745
             IENVVHEKH+LDLDLCEA GPSYK+LPK+DTFMPCSGRD+MCWEVLNDEWVGHPVWASE
Sbjct: 756  SIENVVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASE 815

Query: 746  DSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKQAFKL 805
            DSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQ LETI +KI NMTE EK  FKL
Sbjct: 816  DSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKL 875

Query: 806  PIGLGHTSTTIYQKVIRKVYDKERGFEIIDALHEYPSVAVPVVLKRLKQKDKEWRRAQRE 865
            P GLGHTS TIY+KVIRKVYDKERGFEIIDALHE+P+V  PVVLKRLKQKD+EWRRAQRE
Sbjct: 876  PPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQRE 935

Query: 866  WNKVWRELEQKVFFKSLDHLGLTFKQSDKKLLTTKQLLAEISSIKVDQTNKRIHWLTPKP 925
            WNKVWRELEQKV+FKSLDHLGLTFKQ+DKKLLTTKQL++EISSIKVDQTNK+IHWLTPKP
Sbjct: 936  WNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKP 995

Query: 926  KSQLDYEVKDKRVLFDILRLADVFINHTSSYSNPDKERLRDFLQSYIGLFFSIPIREIKD 985
            KSQLD++  DK + +DIL LAD FI HT++YSNPDKERL+D L  +I LFFSIP+ +I++
Sbjct: 996  KSQLDFDFPDKDIFYDILYLADSFIAHTTAYSNPDKERLKDLLNYFISLFFSIPLEKIEE 1055

Query: 986  AVEAAIDNGKQLDENEQXXXXXXXXXRPRDVEICLSDILNRSRYQRLKHSLDSSEASLGA 1045
            A+++   N                  RP   E+ L DIL+RS+YQ+LK S D        
Sbjct: 1056 ALQSYKQNLSDS-SGSDDGDSSTPRKRPYQQEMSLLDILHRSKYQKLKRSNDEDGKVPQL 1114

Query: 1046 VSP--GQNEQDDMDEMIRQEAKKPWLLGSLVEEANSQGLIQNRKIYNMFANVNMYVFMRN 1103
              P   ++   + +E+I +EAK PWL G+LVEEANSQG+IQNR I+N+FAN N+Y+F R+
Sbjct: 1115 SEPLDEESNAIEEEELINEEAKNPWLTGNLVEEANSQGIIQNRNIFNLFANSNIYIFFRH 1174

Query: 1104 LITIYDRLHEVKDINDVVTKEINGRKVVQFAKDLNLISAQLKNMGLDFSGGDSYTQLLLL 1163
              TIY+RL E+K +N+ VTKEI+ R +V FAKDL+L+S+QL  MGLDF+G D+Y Q+L L
Sbjct: 1175 WTTIYERLLEIKQMNEKVTKEISKRSMVTFAKDLDLLSSQLSEMGLDFNGEDAYKQVLKL 1234

Query: 1164 SKRLIEGDLEHQWFEESLRQAYRNRAFKLYTIDKVIQSLVKHAHAIMTDSKSSDVMALFE 1223
            S+RLI G+LEHQWFEE LRQAY N+AFKLYTIDKVIQ LVKHAH +MTD+K++++MALF 
Sbjct: 1235 SRRLINGELEHQWFEEGLRQAYNNKAFKLYTIDKVIQLLVKHAHTLMTDAKTAEIMALFV 1294

Query: 1224 KDRISSSTTSKDQILYRLQTRSHMSTTEHMFRIEYNTKKSSISIQYIALDDLTLEEPKTL 1283
            KDR +S+T++KDQI+YRLQ RS+MS TE+MFR+E++ +   +S+QYIALDDLTL+EP+  
Sbjct: 1295 KDRNASTTSAKDQIIYRLQARSYMSNTENMFRMEFDRRNLHVSVQYIALDDLTLKEPRAD 1354

Query: 1284 EDKWKYYITSYSLSHPTEGIPQEEIKIPFLDKVIESEQVHMEDEDDNPKYSPEGVSKSNL 1343
            EDKWKYY+TSY+L HPTEGI  E++KIPFL+++IE  Q   +  + + K+SPEG+S S L
Sbjct: 1355 EDKWKYYVTSYALPHPTEGISHEKLKIPFLERLIEYGQ-DTDGREVDEKFSPEGLSVSTL 1413

Query: 1344 MIKIDPETYRLEVEPGSFDIFSRKSVNKFPVDVFSESYKVKKQTRRNRCKNFLNGKHGWK 1403
             IKI P TY+L +E GS+D+F+RK+ NK+P     + +K     +      FL+     +
Sbjct: 1414 KIKIQPVTYKLHIESGSYDVFTRKAANKYPTVANDDIHKEMVVKKTGLISKFLDNAIRLR 1473

Query: 1404 RQLSSDAISKIEQKFNDLKNGTFQQRSRSATSETTSVPLN--ASDSTQKEQESTGTSE 1459
              L+      +++K + LK  T    +++   +  +V  N  A ++ +++QE+  TS+
Sbjct: 1474 NDLNETKKLSMQEKLDSLKGAT----TKADVDDKITVAKNEKAIEAKEEQQENLPTSD 1527

 Score =  187 bits (476), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 85/99 (85%), Positives = 92/99 (92%)

Query: 121 YRPLNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPN 180
           YRPLNVKDAL+YLEQVK QFNSRPDIYN FLDIMKDFKSQ+IDTPGVIERVSTLFRGYP 
Sbjct: 67  YRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 126

Query: 181 LIQGFNTFLPQGYTIECSSNPDDPIKVTTPLGSQIVTNS 219
           LIQGFNTFLPQGY IECS+NPDDPI+VTTP+G+  V N+
Sbjct: 127 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNN 165

 Score =  112 bits (279), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 53/61 (86%), Positives = 57/61 (93%)

Query: 355 IEKPADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQN 414
           ++K  DVEFSQA+SYVNKIK RFADQPDIYKHFLEILQTYQREQKPI+EVYAQVT LFQN
Sbjct: 248 VKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQN 307

Query: 415 A 415
           A
Sbjct: 308 A 308

 Score = 53.9 bits (128), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 41/62 (66%)

Query: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTF 188
           A++Y+ ++K +F  +PDIY HFL+I++ ++ +      V  +V+ LF+  P+L++ F  F
Sbjct: 259 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 318

Query: 189 LP 190
           LP
Sbjct: 319 LP 320

 Score = 36.6 bits (83), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 44/91 (48%), Gaps = 7/91 (7%)

Query: 330 SPSSTIPAGTVPGTTVANNIQGTTQIEKPAD-------VEFSQAVSYVNKIKNRFADQPD 382
           +P++  PA     + V  + +     E   D       +    A+SY+ ++K +F  +PD
Sbjct: 32  APAAVQPADAAEVSNVYADTKDEINAENTNDEDPDYRPLNVKDALSYLEQVKFQFNSRPD 91

Query: 383 IYKHFLEILQTYQREQKPISEVYAQVTVLFQ 413
           IY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 92  IYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 122

>Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON}
            similar to Ashbya gossypii ACL004W
          Length = 1474

 Score = 1123 bits (2906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 592/1013 (58%), Positives = 729/1013 (71%), Gaps = 67/1013 (6%)

Query: 472  NLPPLGNFSPPSNGAVPGRPEEFSTEAQHHMMALPSMLQAPTEHAQLHAQQHIAP--MTN 529
            NLPPLG+FS P +               HH M LP ++QAP  +       HI    M+N
Sbjct: 488  NLPPLGSFSTPGD---------------HHPMNLP-LVQAPNMNLNQGHPAHIITQGMSN 531

Query: 530  EAIPISDLRSQIIDNNHVHNYTPIELAXXXXXXXXXXXXXXXXXXXXXXLEAAYATEGIV 589
            + IPISDLR+    +     Y P E +                       +     E   
Sbjct: 532  QKIPISDLRTTADTS-----YRPAEYSQG---------------------QDTQYMETNA 565

Query: 590  RPEIDLDXXXXXXXXXXXXXXXXXXXXVEEANFFDKAKKFIGNKQVYVEFLKILNLYSQD 649
            RPEIDLD                    VEEA+FFDKAKK+IGNKQ+Y EFLKILNLYSQD
Sbjct: 566  RPEIDLDPSLVPVIPEPIKPLEDELNLVEEASFFDKAKKYIGNKQIYTEFLKILNLYSQD 625

Query: 650  ILSLDDLIEKVDYYLGSNKELFDWFKNFVGFQDKPKHIENVVHEKHKLDLDLCEACGPSY 709
            +L  + L+EKV +YL    ELFDWFK+FVG+Q+KPKHIEN+VHEKH+LDLDLCEACGPSY
Sbjct: 626  LLDKERLVEKVGHYLSGCPELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSY 685

Query: 710  KKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERH 769
            K+LPK DTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIEEERH
Sbjct: 686  KRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERH 745

Query: 770  EYDFYIESNLRTIQTLETIASKIANMTEEEKQAFKLPIGLGHTSTTIYQKVIRKVYDKER 829
            EYDFYIE+NLRTIQTLETIA+KIANMT EEK  FKLP GLGHTS TIY+KVIRKVYDK+R
Sbjct: 746  EYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLPPGLGHTSVTIYKKVIRKVYDKDR 805

Query: 830  GFEIIDALHEYPSVAVPVVLKRLKQKDKEWRRAQREWNKVWRELEQKVFFKSLDHLGLTF 889
            G+EIIDALHEYP++ VP+VLKRLKQKD+EWRRAQREWNKVWRELEQKVFFKSLDHLGLTF
Sbjct: 806  GYEIIDALHEYPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTF 865

Query: 890  KQSDKKLLTTKQLLAEISSIKVDQTNKRIHWLTPKPKSQLDYEVKDKRVLFDILRLADVF 949
            KQ+DKKLLT KQL++EISSIKVDQ NKRIH LTPK KSQLD++  D  V +DIL LA VF
Sbjct: 866  KQADKKLLTAKQLISEISSIKVDQNNKRIHPLTPKAKSQLDHDFTDPEVFYDILNLAIVF 925

Query: 950  INHTSSYSNPDKERLRDFLQSYIGLFFSIPIREIKDAV---EAAIDNGKQLDENE----- 1001
            + + ++YS PDKERL+DF + +I LF S P+ +I+ A+   +AA  +       E     
Sbjct: 926  LENNNTYSAPDKERLKDFFKGFISLFCSYPVPQIEKALAKRDAASSSQSSNSNTETYSEK 985

Query: 1002 QXXXXXXXXXRPR---DVEICLSDILNRSRYQRLKHSLDSSEASLGAVSPGQNEQDDMDE 1058
            Q         + R   D +  L D+L R++ Q+   +    ++S+ A         + +E
Sbjct: 986  QQEDGDMKLPKKRNREDSDRLLRDVLFRNKQQKGGRNSPRGDSSISAEK---ESDMEEEE 1042

Query: 1059 MIRQEAKKPWLLGSLVEEANSQGLIQNRKIYNMFANVNMYVFMRNLITIYDRLHEVKDIN 1118
            +IRQEAK PWLLGS+V+EA++ G ++NRK +N+FAN N+YVF R+L TIY+RL EVK +N
Sbjct: 1043 IIRQEAKNPWLLGSIVDEADNHGHVENRKTFNLFANTNIYVFFRHLATIYERLVEVKKMN 1102

Query: 1119 DVVTKEINGRKVVQFAKDLNLISAQLKNMGLDFSGGDSYTQLLLLSKRLIEGDLEHQWFE 1178
            D VTKEI  RKVVQFAKDLNLIS QL +MGLDF G D+Y +LL LS+ LI GDLEHQWFE
Sbjct: 1103 DEVTKEIANRKVVQFAKDLNLISTQLTDMGLDFKGEDAYEKLLQLSRSLIAGDLEHQWFE 1162

Query: 1179 ESLRQAYRNRAFKLYTIDKVIQSLVKHAHAIMTDSKSSDVMALFEKDRISSSTTSKDQIL 1238
            ESLRQAY+N+AFK+YT+DKVIQ+LVKHAHAI+TD+K+ ++M LFEKDR S ST++KDQIL
Sbjct: 1163 ESLRQAYKNKAFKIYTVDKVIQALVKHAHAIITDNKTVEIMMLFEKDRTSLSTSTKDQIL 1222

Query: 1239 YRLQTRSHMSTTEHMFRIEYNTKKSSISIQYIALDDLTLEEPKTLEDKWKYYITSYSLSH 1298
            YRLQ RS+MS  E+MFRIEYN   + + IQ++A+DDLTLEEPK+L+DKW+YY+TSYSLSH
Sbjct: 1223 YRLQVRSNMSNIENMFRIEYNRLTAHVCIQFVAVDDLTLEEPKSLKDKWQYYLTSYSLSH 1282

Query: 1299 PTEGIPQEEIKIPFLDKVIESEQVHMEDEDDNPKYSPEGVSKSNLMIKIDPETYRLEVEP 1358
            PTEGI  + ++ PFL+K+IESE+  +ED+D+  KYSPEGV+ SNL +KIDP TY +EVE 
Sbjct: 1283 PTEGISHDNLRSPFLEKIIESEEDIIEDKDE--KYSPEGVATSNLKVKIDPITYSMEVEF 1340

Query: 1359 GSFDIFSRKSVNKFPVDVFSESYKVKKQTRRNRCKNFLNGKHGWKRQLSSDAISKIEQKF 1418
            GS DIFSRK+VNKFPV V  +  K K    +   + FLN   GWK+ LS+  I+++E++ 
Sbjct: 1341 GSHDIFSRKAVNKFPVRV--DIRKKKSSELKLELERFLNSNSGWKKDLSAKQIAEVEKRL 1398

Query: 1419 NDLK-NGTFQQRS-RSATSETTSVP---LNASDSTQKEQESTGTSETSQPALQ 1466
              +K NG  ++ S  SA + T++V    L   D  + + EST  S +     Q
Sbjct: 1399 EFVKLNGNLEEYSDDSAVASTSAVSGSDLAKEDIARSQSESTVVSASMATCAQ 1451

 Score =  192 bits (489), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 93/141 (65%), Positives = 102/141 (72%), Gaps = 9/141 (6%)

Query: 82  TSTTLSVASFDNPLPPAPAAHLXXXXXXXXXXXXA---------DGSYYRPLNVKDALTY 132
            S   S++S DNPLP                             DGS YRPLNVKDAL+Y
Sbjct: 112 VSNGFSMSSLDNPLPQQEFQEQSQHQQQQHHHHQLDQLQSPAHQDGSSYRPLNVKDALSY 171

Query: 133 LEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTFLPQG 192
           LEQVK QFNSRPD+YNHFLDIMKDFKSQ+IDTPGVIERVSTLF+GYP LIQGFNTFLPQG
Sbjct: 172 LEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTFLPQG 231

Query: 193 YTIECSSNPDDPIKVTTPLGS 213
           Y IECSS+P+DPIKVTTP G+
Sbjct: 232 YNIECSSDPNDPIKVTTPFGT 252

 Score =  113 bits (283), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 58/66 (87%)

Query: 350 QGTTQIEKPADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVT 409
           Q  T  +K  DVEFS A+SYVNKIK RFADQPDIYKHFLEILQTYQREQKPI+EVYAQVT
Sbjct: 341 QFGTGGKKTGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVT 400

Query: 410 VLFQNA 415
           VLFQNA
Sbjct: 401 VLFQNA 406

 Score = 53.9 bits (128), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 40/62 (64%)

Query: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTF 188
           A++Y+ ++K +F  +PDIY HFL+I++ ++ +      V  +V+ LF+  P+L+  F  F
Sbjct: 357 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 416

Query: 189 LP 190
           LP
Sbjct: 417 LP 418

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 32/49 (65%)

Query: 366 AVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQN 414
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LFQ 
Sbjct: 168 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQG 216

 Score = 32.7 bits (73), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 34/70 (48%), Gaps = 3/70 (4%)

Query: 124 LNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQ 183
           LN+ +  ++ ++ K ++     IY  FL I+  +    +D   ++E+V     G P L  
Sbjct: 590 LNLVEEASFFDKAK-KYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFD 648

Query: 184 GFNTFLPQGY 193
            F +F+  GY
Sbjct: 649 WFKSFV--GY 656

>Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL004W
            (REAL)
          Length = 1555

 Score = 1118 bits (2892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 573/980 (58%), Positives = 706/980 (72%), Gaps = 36/980 (3%)

Query: 453  MYGVNNGYYQAGKIPSANQNLPPLGNFSPPSNGAVPGRPEEFSTEAQH----HMMALPSM 508
            +Y  ++ Y  +       QNLPP+G+FSPP+NG+      +   + QH    H++ LPSM
Sbjct: 539  LYPASSYYNHSTNRGVPQQNLPPIGSFSPPTNGSTV---HDNYQDQQHMQPPHLVPLPSM 595

Query: 509  LQAPTEHAQLHAQQHIAPMTNEAIPISDLRSQIIDNNHVHNYTPIELAXXXXXXXXXXXX 568
            +Q    H      Q IA   NE +PISDLR+ + D      Y P                
Sbjct: 596  VQ----HGPNMVHQGIA---NENLPISDLRTSLTDQ-----YAPSTFQQQQQNPPSISPI 643

Query: 569  XXXXXXXXXXLEAAYATEGIVRPEIDLDXXXXXXXXXXXXXXXXXXXXVEEANFFDKAKK 628
                       +  Y  +  VRPEIDLD                     EE  FF+KAK+
Sbjct: 644  T----------DLQYG-DVPVRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKR 692

Query: 629  FIGNKQVYVEFLKILNLYSQDILSLDDLIEKVDYYLGSNKELFDWFKNFVGFQDKPKHIE 688
            +IGNK +Y EFLKILNLYSQDIL LDDL+EKVD+YLGSNKELF WFKNFVG+Q+K K IE
Sbjct: 693  YIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEKTKCIE 752

Query: 689  NVVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSG 748
            N+VHEKH+LDLDLCEA GPSYK+LPK+DTFMPCSGRD+MCWE+LNDEWVGHPVWASEDSG
Sbjct: 753  NIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEILNDEWVGHPVWASEDSG 812

Query: 749  FIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKQAFKLPIG 808
            FIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQ LETI +KI NMTE EK  FKLP G
Sbjct: 813  FIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTESEKSDFKLPPG 872

Query: 809  LGHTSTTIYQKVIRKVYDKERGFEIIDALHEYPSVAVPVVLKRLKQKDKEWRRAQREWNK 868
            LGHTS TIY+KVIRKVYDKERGFEIIDALHE+P+V  PVVLKRLKQKD+EWRRAQREWNK
Sbjct: 873  LGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNK 932

Query: 869  VWRELEQKVFFKSLDHLGLTFKQSDKKLLTTKQLLAEISSIKVDQTNKRIHWLTPKPKSQ 928
            VWRELEQKVFFKSLDHLGLTFKQ+DKKLLTTKQL++EI+SIKVDQTNK+IHWLTPKPKSQ
Sbjct: 933  VWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEINSIKVDQTNKKIHWLTPKPKSQ 992

Query: 929  LDYEVKDKRVLFDILRLADVFINHTSSYSNPDKERLRDFLQSYIGLFFSIPIREIKDAVE 988
            LD++  DK + +DIL LAD FI+HT++YSNPDKERL+D L+ +I LFFSIP+ +I+ A++
Sbjct: 993  LDFDFPDKDIFYDILYLADSFISHTTAYSNPDKERLKDLLKYFISLFFSIPLEKIEKALQ 1052

Query: 989  AAIDNGKQLDENEQXXXXXXXXXRPRDVEICLSDILNRSRYQRLKHSLDSSEASLGAVSP 1048
               +N  +               RP   E+ L DIL+R+RYQ+LK S D  E  +  +S 
Sbjct: 1053 FHKENVSES-SGSDDGGSSTSRKRPYQQEMSLLDILHRNRYQKLKRSND-EEGKIPQLSE 1110

Query: 1049 ---GQNEQDDMDEMIRQEAKKPWLLGSLVEEANSQGLIQNRKIYNMFANVNMYVFMRNLI 1105
                ++   + +E+I +EA+ PWL G+LVEEANSQG+IQNR I+N+FAN N+Y+F R+  
Sbjct: 1111 PLDEESNTIEEEELISEEARNPWLTGNLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWT 1170

Query: 1106 TIYDRLHEVKDINDVVTKEINGRKVVQFAKDLNLISAQLKNMGLDFSGGDSYTQLLLLSK 1165
            TIY+RL E+K +N  +TKE+N R  V FAKDL+L+S QL  MGLDF G D+Y Q+L LS+
Sbjct: 1171 TIYERLLEIKQMNGKITKEVNTRSTVTFAKDLDLLSNQLPEMGLDFIGEDAYKQVLRLSR 1230

Query: 1166 RLIEGDLEHQWFEESLRQAYRNRAFKLYTIDKVIQSLVKHAHAIMTDSKSSDVMALFEKD 1225
            RLI GDLEHQWFEESLRQAY N+AFKLYTIDKV QSLVKHAH +M D K++++MALF KD
Sbjct: 1231 RLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMADVKTAEIMALFVKD 1290

Query: 1226 RISSSTTSKDQILYRLQTRSHMSTTEHMFRIEYNTKKSSISIQYIALDDLTLEEPKTLED 1285
            R + +T++KDQI+YRLQ RS+MS  E+MFRIE N +   +S+QYIALDDLTL+EPK  ED
Sbjct: 1291 RNAFTTSAKDQIIYRLQVRSYMSNIENMFRIELNKRSLHVSVQYIALDDLTLKEPKADED 1350

Query: 1286 KWKYYITSYSLSHPTEGIPQEEIKIPFLDKVIESEQVHMEDEDDNPKYSPEGVSKSNLMI 1345
            KWKYY+TSY L HPTEGI  E++KIPFL+++IE  Q   +  + + ++SPEG+S S L I
Sbjct: 1351 KWKYYVTSYGLPHPTEGISHEKLKIPFLERLIEFGQ-DTDGREVDEEFSPEGISLSTLRI 1409

Query: 1346 KIDPETYRLEVEPGSFDIFSRKSVNKFPVDVFSESYKVKKQTRRNRCKNFLNGKHGWKRQ 1405
            KI P TY+L +E GS+D+F+RK+VNK+P     + +K     +      FL      +  
Sbjct: 1410 KIQPITYKLHIENGSYDVFTRKAVNKYPTIANDDVHKEMVVQKTALISRFLENAIRSRND 1469

Query: 1406 LSSDAISKIEQKFNDLKNGT 1425
            L+    S +++K   LK  T
Sbjct: 1470 LNEATKSGMQEKLALLKGVT 1489

 Score =  186 bits (471), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 84/99 (84%), Positives = 92/99 (92%)

Query: 121 YRPLNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPN 180
           YRPLNVKDAL+YLEQVK QF+SRPDIYN FLDIMKDFKSQ+IDTPGVIERVSTLFRGYP 
Sbjct: 224 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 283

Query: 181 LIQGFNTFLPQGYTIECSSNPDDPIKVTTPLGSQIVTNS 219
           LIQGFNTFLPQGY IECS+NPDDPI+VTTP+G+  V N+
Sbjct: 284 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNN 322

 Score =  110 bits (276), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 56/60 (93%)

Query: 356 EKPADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNA 415
           +K  DVEFSQA+SYVNKIK RFADQPDIYKHFLEILQTYQREQKPI+EVYAQVT LFQNA
Sbjct: 409 KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNA 468

 Score = 53.9 bits (128), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 41/62 (66%)

Query: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTF 188
           A++Y+ ++K +F  +PDIY HFL+I++ ++ +      V  +V+ LF+  P+L++ F  F
Sbjct: 419 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 478

Query: 189 LP 190
           LP
Sbjct: 479 LP 480

 Score = 37.7 bits (86), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 32/48 (66%)

Query: 366 AVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQ 413
           A+SY+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 232 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 279

>KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} similar to
            uniprot|Q75CF0 Ashbya gossypii ACL004W ACL004Wp and
            weakly similar to YOL004W uniprot|P22579 Saccharomyces
            cerevisiae YOL004W SIN3 DNA binding protein involved in
            transcriptional regulation
          Length = 1519

 Score = 1107 bits (2864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 565/977 (57%), Positives = 703/977 (71%), Gaps = 63/977 (6%)

Query: 459  GYYQAGKIPSANQNLPPLGNFSPPSNGAVPGRPEEFSTEAQHHMMALPSMLQAPTEHAQL 518
            G+Y    +     NLPPLGNFS     +    P E S     HM  LPSM Q    H   
Sbjct: 559  GFYPQSGVLMQPTNLPPLGNFSASGQAS----PAENS-----HM--LPSMHQ----HI-- 601

Query: 519  HAQQHIAP-------MTNEAIPISDLRSQIIDNNHVHNYTPIELAXXXXXXXXXXXXXXX 571
             A  H+ P       M+N+ IP+S++RS +   N  +N                      
Sbjct: 602  -AGGHVIPQHVVTQGMSNQDIPVSEMRSTM---NGTYNQV---------------EYIQG 642

Query: 572  XXXXXXXLEAA-YATEGIVRPEIDLDXXXXXXXXXXXXXXXXXXXXVEEANFFDKAKKFI 630
                   LE   Y    + RPEIDLD                     +E  FF++ K+FI
Sbjct: 643  APGYPQPLEGVQYMEAPMARPEIDLDPSLVPVVPEPIQPPEDAIALGDEVTFFERVKRFI 702

Query: 631  GNKQVYVEFLKILNLYSQDILSLDDLIEKVDYYLGSNKELFDWFKNFVGFQDKPKHIENV 690
            GNKQVY EFLKILNLYSQD+L+  +L+ KV++YL S+KELFDWFK+FVG+Q+KPKHIEN+
Sbjct: 703  GNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFDWFKSFVGYQEKPKHIENI 762

Query: 691  VHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFI 750
            VHEKH+LDLDLCEACGPSYKKLPK DTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFI
Sbjct: 763  VHEKHRLDLDLCEACGPSYKKLPKDDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFI 822

Query: 751  AHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKQAFKLPIGLG 810
            AHRKNQYE+TLFK+EEERHEYDFYIESNLRTIQTLETIA+KIANMT EEK  FKLP GLG
Sbjct: 823  AHRKNQYEDTLFKVEEERHEYDFYIESNLRTIQTLETIANKIANMTNEEKNNFKLPPGLG 882

Query: 811  HTSTTIYQKVIRKVYDKERGFEIIDALHEYPSVAVPVVLKRLKQKDKEWRRAQREWNKVW 870
            HTS TIY+KV+RKVYDK+RGFEIIDALHE+P+V VP+VLKRLKQKD+EWRRAQREWNKVW
Sbjct: 883  HTSLTIYKKVVRKVYDKDRGFEIIDALHEHPAVTVPIVLKRLKQKDEEWRRAQREWNKVW 942

Query: 871  RELEQKVFFKSLDHLGLTFKQSDKKLLTTKQLLAEISSIKVDQTNKRIHWLTPKPKSQLD 930
            RELEQKV++KSLDHLGLTFKQ+DKKLLTTKQLL+EISSIKVDQTNKRIH LTPKPKSQLD
Sbjct: 943  RELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHPLTPKPKSQLD 1002

Query: 931  YEVKDKRVLFDILRLADVFINHTSSYSNPDKERLRDFLQSYIGLFFSIPIREIKDAV--E 988
            +E+ D+ VL+DIL L   F+   +SYSN DK +L  F +++I LFFS PI+++ +AV   
Sbjct: 1003 FEINDREVLYDILDLVFTFVKTNASYSNSDKIKLDHFFKAFISLFFSYPIKDVNEAVSER 1062

Query: 989  AAI---DNGKQLDENEQXXXXXXXXXRPRDVEICLSDILNRSRYQRLKHSLDSSEASLGA 1045
            ++I   +NG++ D N+             +    + DIL R++  +  +S ++  +S   
Sbjct: 1063 SSITDQENGEE-DSNKSDSEKSNKRTLSDEDSYLMKDILRRTKNAKTSNSEENQNSS--- 1118

Query: 1046 VSPGQNEQDDMDEMIRQEAKKPWLLGSLVEEANSQGLIQNRKIYNMFANVNMYVFMRNLI 1105
             S   NE+D+  E++ +EA KPWLLGSL++EAN+ G++ +R I+N+F N  +YVF R+L 
Sbjct: 1119 -SVKSNEEDET-ELLAKEAAKPWLLGSLIDEANNSGIVSDRHIFNLFTNTTIYVFFRHLN 1176

Query: 1106 TIYDRLHEVKDINDVVTKEINGRKVVQFAKDLNLISAQLKNMGLDFSGGDSYTQLLLLSK 1165
            T+Y+RL EVK I+  VT EI  RK+VQFA DLNLIS QL +MGL F    +Y +LL LSK
Sbjct: 1177 TLYERLLEVKKIDAEVTDEIKNRKIVQFASDLNLISTQLADMGLAFKDTKAYGELLRLSK 1236

Query: 1166 RLIEGDLEHQWFEESLRQAYRNRAFKLYTIDKVIQSLVKHAHAIMTDSKSSDVMALFEKD 1225
            RLI GDL+HQWFEESLRQAY+N+AFK+YTIDKV+QSLVKHAH+I+TD K++ VM LFE+D
Sbjct: 1237 RLITGDLDHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHSIITDPKNAMVMVLFEQD 1296

Query: 1226 RISSSTTSKDQILYRLQTRSHMSTTEHMFRIEYNTKKSSISIQYIALDDLTLEEPKTLED 1285
            R+   TT+KDQILYRL+ R+ M  +E+MFRIEYNT  S +SIQY+A+DDLTL+EP+ +++
Sbjct: 1297 RLKRDTTAKDQILYRLKVRNTMGESENMFRIEYNTDSSHVSIQYVAVDDLTLKEPQNMKE 1356

Query: 1286 KWKYYITSYSLSHPTEGIPQEEIKIPFLDKVIESEQVHMEDEDDNPKYSPEGVSKSNLMI 1345
            KW YY+TSYSLSHPTEGI QE+I  PFL K+IE E  +++DE+ N K+SPEGVS+S L +
Sbjct: 1357 KWDYYVTSYSLSHPTEGITQEDISQPFLGKIIEKEAEYLDDEEQNDKFSPEGVSQSKLKV 1416

Query: 1346 KIDPETYRLEVEPGSFDIFSRKSVNKFPVDVFSESYKVKKQTRRNRCKNFLNGKHGWKRQ 1405
             I PETY L  E GS D+F+RKSVNKFP      S   +  ++ ++   FLN   GWK+ 
Sbjct: 1417 NIHPETYELTFECGSTDVFTRKSVNKFP-----SSQSTQPASKMDK---FLNSSKGWKKN 1468

Query: 1406 LSSDAISKIEQKFNDLK 1422
            LS++ I + E K   LK
Sbjct: 1469 LSTEIIGRAESKMKILK 1485

 Score =  182 bits (462), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 80/98 (81%), Positives = 91/98 (92%)

Query: 116 ADGSYYRPLNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLF 175
           A  S YRPLNVKDAL+YLEQVK QF+SRPD+YNHFLDIMKDFKSQ+IDTPGVI+RV+TLF
Sbjct: 196 AQYSSYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLF 255

Query: 176 RGYPNLIQGFNTFLPQGYTIECSSNPDDPIKVTTPLGS 213
           +G+PNLIQGFNTFLP GY IECS+NP+DPIKVTTP G+
Sbjct: 256 QGFPNLIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGT 293

 Score =  105 bits (263), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 53/59 (89%)

Query: 356 EKPADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQN 414
           +K  +VEFS A+SYVNKIK RFADQPDIYK FLEILQTYQREQKPI EVYAQVT+LFQN
Sbjct: 420 QKTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQN 478

 Score = 50.1 bits (118), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 39/62 (62%)

Query: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTF 188
           A++Y+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ LF+  P+L+  F  F
Sbjct: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNNPDLLDDFKKF 489

Query: 189 LP 190
           LP
Sbjct: 490 LP 491

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 33/48 (68%)

Query: 366 AVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQ 413
           A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +VT LFQ
Sbjct: 209 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQ 256

>Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] {ON}
            YOL004W (SIN3) - DNA binding protein involved in
            transcriptional regulation [contig 185] FULL
          Length = 1541

 Score = 1102 bits (2849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/974 (56%), Positives = 698/974 (71%), Gaps = 65/974 (6%)

Query: 471  QNLPPLGNFSPPSNGAVPGRPEEFSTEAQHHMMAL--PSMLQAPTEHAQLHAQQHIAPMT 528
            QNLPPLGNFSPP NG           EAQ ++ A+  P++   P + +Q H       MT
Sbjct: 578  QNLPPLGNFSPPINGR--------DNEAQVNLPAVQPPALDFPPQQQSQSHRHVVAQGMT 629

Query: 529  NEAIPISDLRSQIIDNNHVHNYTPIELAXXXXXXXXXXXXXXXXXXXXXXLEAAYATEGI 588
            N ++P+SD+R  +        + P  L                        +     E  
Sbjct: 630  NNSLPVSDMRGPVDGG-----FAPQPLYS----------------------QDVQYMEPT 662

Query: 589  VRPEIDLDXXXXXXXXXXXXXXXXXXXXVEEANFFDKAKKFIGNKQVYVEFLKILNLYSQ 648
             RPEIDLD                    +EE +FFDKAKK++GNKQVY EFLKILNL+SQ
Sbjct: 663  SRPEIDLDPSLVPVIPEPIRPLENDSTLIEETSFFDKAKKYMGNKQVYTEFLKILNLFSQ 722

Query: 649  DILSLDDLIEKVDYYLGSNKELFDWFKNFVGFQDKPKHIENVVHEKHKLDLDLCEACGPS 708
            D++  D+L++KV++YLG N ELFDWFK+FV + ++PKHIENVVHEKH+LDLDLCEAC PS
Sbjct: 723  DLIDTDELVDKVEHYLGGNSELFDWFKSFVNYVERPKHIENVVHEKHRLDLDLCEACCPS 782

Query: 709  YKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEER 768
            YKKLPK DTFMPC GRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEER
Sbjct: 783  YKKLPKADTFMPCCGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEER 842

Query: 769  HEYDFYIESNLRTIQTLETIASKIANMTEEEKQAFKLPIGLGHTSTTIYQKVIRKVYDKE 828
            HEYD+YIE+NLRTIQ LETIA+KI+NMT EEK+ FKLP GLGHTSTTIY+KVIRKVYDK+
Sbjct: 843  HEYDYYIEANLRTIQLLETIANKISNMTVEEKKTFKLPPGLGHTSTTIYKKVIRKVYDKD 902

Query: 829  RGFEIIDALHEYPSVAVPVVLKRLKQKDKEWRRAQREWNKVWRELEQKVFFKSLDHLGLT 888
            RGFEIIDALHE P+V+VP+VL+RLKQKD+EWRRAQREWNKVWRELEQKVF+KSLDHLGLT
Sbjct: 903  RGFEIIDALHENPAVSVPIVLRRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLT 962

Query: 889  FKQSDKKLLTTKQLLAEISSIKVDQTNKRIHWLTPKPKSQLDYEVKDKRVLFDILRLADV 948
            FKQ+DKKLLT KQL++EISSIK+DQ NKRI+  T KPKSQLD+++ DK VLFDIL L D 
Sbjct: 963  FKQADKKLLTAKQLISEISSIKIDQANKRIYPFTSKPKSQLDFDISDKGVLFDILNLVDT 1022

Query: 949  FINHTSSYSNPDKERLRDFLQSYIGLFFSIPIREIKD-AVEAAIDNGKQLDENEQXXXXX 1007
            FI+H+++YSNPDKE+L  F + ++ +FFSIP+ ++ + + E  ++NG             
Sbjct: 1023 FIDHSTTYSNPDKEKLSAFFRGFLSIFFSIPLTDLDNPSEEHKVENGD------------ 1070

Query: 1008 XXXXRPRDVEICLSDILNRSRY-------QRLKHSLDSSEASLGAVSPGQNEQDDMDEMI 1060
                R RD +    D+L            Q+   S    + +    SP      + +E +
Sbjct: 1071 STRKRSRDDDQFFRDLLKSKHKQAKKKTSQQEDESTSDDQDTAAKTSPDL----EYEEAV 1126

Query: 1061 RQEAKKPWLLGSLVEEANSQGLIQNRKIYNMFANVNMYVFMRNLITIYDRLHEVKDINDV 1120
            R +AKKPWLLG++++EAN+ G + NRK YNMFAN N+YVF R+L T+Y RL E K+IN+ 
Sbjct: 1127 RLDAKKPWLLGNILDEANNHGFVSNRKTYNMFANTNIYVFFRHLTTMYQRLSEAKNINEE 1186

Query: 1121 VTKEINGRKVVQFAKDLNLISAQLKNMGLDFSGGDSYTQLLLLSKRLIEGDLEHQWFEES 1180
            VTKEIN RKVVQFAKDLNL S QL +MGLDF G D+Y QLL L KRLI+ D+EHQWFEES
Sbjct: 1187 VTKEINSRKVVQFAKDLNLASTQLSDMGLDFKGADAYEQLLALCKRLIQSDIEHQWFEES 1246

Query: 1181 LRQAYRNRAFKLYTIDKVIQSLVKHAHAIMTDSKSSDVMALFEKDRISSSTTSKDQILYR 1240
            LRQAY+N+AFK+YT+DKVIQSLVKHAH+I+TD+K++++M LFEKDR + +T++++QILYR
Sbjct: 1247 LRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKTAEIMILFEKDRKAPTTSTREQILYR 1306

Query: 1241 LQTRSHMSTTEHMFRIEYNTKKSSISIQYIALDDLTLEEPKTLEDKWKYYITSYSLSHPT 1300
            LQ RS M  TE+MFRIE N+  + +SIQ++A+DDLTL +P +L+D+W+YY+TSYSLSHPT
Sbjct: 1307 LQVRSCMGLTENMFRIELNSTSAHVSIQFVAVDDLTLNQPNSLKDQWQYYLTSYSLSHPT 1366

Query: 1301 EGIPQEEIKIPFLDKVIESEQVHMEDEDDNPKYSPEGVSKSNLMIKIDPETYRLEVEPGS 1360
            EG+P EEIK PFL+K +  +    ED +    YSP G S S L I+I+PE+Y L++EP S
Sbjct: 1367 EGVPHEEIKAPFLEKTLRDDGDSDEDSE---WYSPGGQSVSQLRIQINPESYALQIEPNS 1423

Query: 1361 FDIFSRKSVNKFPVDVFSESYKVKKQTRRNRCKNFLNGKHGWKRQLSSDAISKIEQKFND 1420
             D+F+R +VNK P  +   S +  K T +    + +N +HGWK+ L +++I K E   N 
Sbjct: 1424 KDLFTRSTVNKHPTKIGEASGRDAK-TMQKSLADMVNSEHGWKKGLQNESIGKAESIINF 1482

Query: 1421 LKNGTFQQRSRSAT 1434
            +K   F +++ + +
Sbjct: 1483 VKARGFLEKATTVS 1496

 Score =  166 bits (419), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 94/139 (67%), Gaps = 10/139 (7%)

Query: 83  STTLSVASFDNPLPPAPAAHLXXXXXXXXXXXX--------ADGSYYRPLNVKDALTYLE 134
           S   SVAS +NPLP                              + YRPLN KDAL+YLE
Sbjct: 203 SKGFSVASLNNPLPMQQQQQQQQQQQQQQQLLQQGVLPLEHVQDASYRPLNFKDALSYLE 262

Query: 135 QVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTFLPQGYT 194
           QVK QFN+RPD+YNHFLDIMKD+KSQ+IDT GVIER+STLF+GYP LIQG NTFLPQGY 
Sbjct: 263 QVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPVLIQGLNTFLPQGYK 322

Query: 195 IECSSNPDDP--IKVTTPL 211
           IEC+SNP DP  IKVTTP 
Sbjct: 323 IECTSNPHDPHSIKVTTPF 341

 Score =  107 bits (267), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 50/57 (87%), Positives = 51/57 (89%)

Query: 359 ADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNA 415
            DVEFS A+SYVNKIK RFADQPDIYKHFLEILQTYQREQKPI EVY QVT LFQNA
Sbjct: 438 GDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQNA 494

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 41/62 (66%)

Query: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTF 188
           A++Y+ ++K +F  +PDIY HFL+I++ ++ +      V  +V++LF+  P+L+  F  F
Sbjct: 445 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQNAPDLLDDFKKF 504

Query: 189 LP 190
           LP
Sbjct: 505 LP 506

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 35/54 (64%)

Query: 361 VEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQN 414
           + F  A+SY+ ++K +F ++PD+Y HFL+I++ Y+ +      V  +++ LF+ 
Sbjct: 252 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKG 305

>KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1433

 Score = 1100 bits (2844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 568/1034 (54%), Positives = 728/1034 (70%), Gaps = 91/1034 (8%)

Query: 454  YGVNNGYYQAGKIPSANQNLPPLGNFSPPSNGAVPGRPEEFSTEAQHHMMALPSMLQAPT 513
            +G    +YQ  +     QNLPPLG+FSPP NG                 + LP++     
Sbjct: 453  FGNTVPFYQTQQ--GRPQNLPPLGSFSPPING-----------RENDPQLNLPAVQPPAM 499

Query: 514  EHAQL---HAQQHIAP--MTNEAIPISDLRSQIIDNNHVHNYTPIELAXXXXXXXXXXXX 568
            E A     H   H+ P  +    +P+SDLR  +  N     + P  L             
Sbjct: 500  EFASQQVPHHPSHVVPQVIPGGTLPLSDLRGAMDGN-----FAPQPLQS----------- 543

Query: 569  XXXXXXXXXXLEAAYATEGIVRPEIDLDXXXXXXXXXXXXXXXXXXXXVEEANFFDKAKK 628
                       +     E   RPEIDLD                    +EE +FFD+AKK
Sbjct: 544  -----------QDVQFIEPTSRPEIDLDPSLVPVIPEPIKPLENDLTLIEETSFFDRAKK 592

Query: 629  FIGNKQVYVEFLKILNLYSQDILSLDDLIEKVDYYLGSNKELFDWFKNFVGFQDKPKHIE 688
            ++GNKQVY EFLKILNL+SQD++  ++L++KV++YLG + ELFDWFK+FV + +KPKHIE
Sbjct: 593  YMGNKQVYTEFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFDWFKSFVNYVEKPKHIE 652

Query: 689  NVVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSG 748
            NV+HEKH+LDLDLCEAC PSYKKLPK DTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSG
Sbjct: 653  NVIHEKHRLDLDLCEACFPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSG 712

Query: 749  FIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKQAFKLPIG 808
            FIAHRKNQYEETLFKIEEERHEYD+YIE+NLRTIQ LETIA+KI+NMT EEKQAFKLP G
Sbjct: 713  FIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTPEEKQAFKLPPG 772

Query: 809  LGHTSTTIYQKVIRKVYDKERGFEIIDALHEYPSVAVPVVLKRLKQKDKEWRRAQREWNK 868
            LGHTS TIY+KVIRKVYDK+RGFEIIDALHE P+V+VP++LKRLKQKD+EWRRAQREWNK
Sbjct: 773  LGHTSMTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIILKRLKQKDEEWRRAQREWNK 832

Query: 869  VWRELEQKVFFKSLDHLGLTFKQSDKKLLTTKQLLAEISSIKVDQTNKRIHWLTPKPKSQ 928
            VWRELEQKVF+KSLDHLGLTFKQ+DKKLLT KQL++EISSIKVDQTNKRI+  TPKPKSQ
Sbjct: 833  VWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQTNKRIYPFTPKPKSQ 892

Query: 929  LDYEVKDKRVLFDILRLADVFINHTSSYSNPDKERLRDFLQSYIGLFFSIPIREIKDAVE 988
            LDY++KDK VLFDIL L + FI+H+S+YSNPDKE+L  F + ++ +FFSI  +EI+++  
Sbjct: 893  LDYDLKDKGVLFDILCLVNNFIDHSSTYSNPDKEKLAAFFKGFLSVFFSISYQEIENSTP 952

Query: 989  A---AIDNG---KQLDENEQXXXXXXXXXRPRDVEICLSDILNRSRYQRLKHSLDSSE-- 1040
            A   A+ N    K+L E+EQ                 L ++L RS+++  K    S+E  
Sbjct: 953  ADSDAVSNSNPRKRLWESEQP----------------LKELL-RSKHKHHKKRDTSAEDD 995

Query: 1041 -ASLGAVSPGQNEQDDMD-EMIRQEAKKPWLLGSLVEEANSQGLIQNRKIYNMFANVNMY 1098
              S    SP ++ Q+  D E+IRQEAKKPWLLG++++EAN  G + NRKI+N+FAN N+Y
Sbjct: 996  SISDDQNSPEKSPQEIEDEEVIRQEAKKPWLLGNILDEANDHGYVSNRKIFNLFANTNVY 1055

Query: 1099 VFMRNLITIYDRLHEVKDINDVVTKEINGRKVVQFAKDLNLISAQLKNMGLDFSGGDSYT 1158
            VF R+L T+Y RL EVK++N+ VT+EIN R VVQFAKDLNL+S QL +MGLDF G D+Y 
Sbjct: 1056 VFFRHLTTMYQRLSEVKNMNEEVTREINSRNVVQFAKDLNLVSTQLSDMGLDFKGKDAYD 1115

Query: 1159 QLLLLSKRLIEGDLEHQWFEESLRQAYRNRAFKLYTIDKVIQSLVKHAHAIMTDSKSSDV 1218
            QLL L KRLI  D++HQWFEESLRQAY+N+AFK+YT+DKVIQSLVKHAH+I+TD+KS+++
Sbjct: 1116 QLLTLCKRLIRNDMDHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKSAEI 1175

Query: 1219 MALFEKDRISSSTTSKDQILYRLQTRSHMSTTEHMFRIEYNTKKSSISIQYIALDDLTLE 1278
            M LFEKDR  ++T++K+QILYRLQ RS+M  TE+MFR+E N     + IQY+A+DDLTL+
Sbjct: 1176 MILFEKDRRCTATSTKEQILYRLQVRSYMGLTENMFRVEINKDSCHVCIQYVAIDDLTLK 1235

Query: 1279 EPKTLEDKWKYYITSYSLSHPTEGIPQEEIKIPFLDKVIESEQVHMEDEDDNPKYSPEGV 1338
            EP++L+D+W YY+TSY+LSHPTEGIP EEIK+PFL+K ++ ++   E ++ + + SP G 
Sbjct: 1236 EPESLKDRWHYYLTSYALSHPTEGIPHEEIKVPFLEKTLQDDE---EADEGSEERSPSGH 1292

Query: 1339 SKSNLMIKIDPETYRLEVEPGSFDIFSRKSVNKFPVDVFSESYKVKKQTRRNRCKNFLNG 1398
            S SNL I+++PE+Y L++EPGS DIF+R +VN+F     + S    K+ +R    + L+G
Sbjct: 1293 SLSNLRIQVNPESYELQIEPGSKDIFTRFAVNRFLNSSENNSNTDLKEEKRKTLMSQLDG 1352

Query: 1399 KHGWKRQLSSDAISKIEQKFNDL----------KNGTFQQRSR------SATSETTSVPL 1442
              GWK+ +S + + K     N +          KN    Q +R      S   E +S+  
Sbjct: 1353 SRGWKKGMSQELVDKTLTALNYVRLHGKHESLNKNPALVQGTRDPRHESSVAKEASSLES 1412

Query: 1443 NASDSTQKEQESTG 1456
            +A D+  K  E+T 
Sbjct: 1413 HADDTELKAGETTA 1426

 Score =  166 bits (419), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 94/136 (69%), Gaps = 7/136 (5%)

Query: 83  STTLSVASFDNPLPPAPAAHLXXXXXXXXXXXXADGSY-----YRPLNVKDALTYLEQVK 137
           S   SVAS +NPLP                       +     YRPLN KDAL+YLEQVK
Sbjct: 99  SKGFSVASLNNPLPAQQQMLHSQQQQQLLQQGVLPLEHVQDPSYRPLNFKDALSYLEQVK 158

Query: 138 LQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTFLPQGYTIEC 197
            QFN+RPD+YNHFLDIMKD+KSQ+IDT GVIER+STLF+GYP LIQG NTFLPQGY IEC
Sbjct: 159 FQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPILIQGLNTFLPQGYKIEC 218

Query: 198 SSNPDDP--IKVTTPL 211
           + NP+DP  IKVTTP 
Sbjct: 219 TLNPNDPHSIKVTTPF 234

 Score =  107 bits (266), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 50/57 (87%), Positives = 52/57 (91%)

Query: 359 ADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNA 415
            DVEFS A+SYVNKIK RFADQP+IYKHFLEILQTYQREQKPI EVYAQVT LFQNA
Sbjct: 332 GDVEFSHAISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQNA 388

 Score = 52.8 bits (125), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 41/62 (66%)

Query: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTF 188
           A++Y+ ++K +F  +P+IY HFL+I++ ++ +      V  +V++LF+  P+L+  F  F
Sbjct: 339 AISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQNAPDLLDDFKKF 398

Query: 189 LP 190
           LP
Sbjct: 399 LP 400

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 35/53 (66%)

Query: 361 VEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQ 413
           + F  A+SY+ ++K +F ++PD+Y HFL+I++ Y+ +      V  +++ LF+
Sbjct: 145 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFK 197

>CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa]
            {ON} weakly similar to uniprot|P22579 Saccharomyces
            cerevisiae YOL004w SIN3 transcription regulatory protein
          Length = 937

 Score =  337 bits (864), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 237/771 (30%), Positives = 374/771 (48%), Gaps = 90/771 (11%)

Query: 620  ANFFDKAKKFIGNKQVYVEFLKILNLYSQDILSLDDLIEKVDYYLGSNKELFDWFKNFVG 679
            A F    +  + ++ +Y EFLK++NL++Q ++ L+   ++   + GS+  L   F N + 
Sbjct: 204  AEFLIYFRNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHNGLKTAFGNIMS 263

Query: 680  -FQDKPKHIENVVHEKHKLDL-DLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWV 737
             ++D  + ++  +      D+ D     GPSYK+L   +T   C GRD +C EVLNDEWV
Sbjct: 264  EYKDIHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDRLCHEVLNDEWV 323

Query: 738  GHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTE 797
            GHPVWASE+ GFIAH+KNQYEETLFK+EEERHEYDF++ S          +   I   TE
Sbjct: 324  GHPVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFFLLS----------VEHLIVKFTE 373

Query: 798  EEKQAFKLPIGLGH-------------TSTTIYQKVIRKVYDKERGFEIIDALHEYPSVA 844
             EK + +L    G              +  +I +KVIR++Y  E G  +IDA+   P   
Sbjct: 374  YEK-SLQLSKDDGRRRNRVSSPKEPMISLNSITEKVIRRLYGIEHGNILIDAIKTNPEKV 432

Query: 845  VPVVLKRLKQKDKEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQSDKKLLTTKQLLA 904
            VP +LK  K+K ++W  A+ EWNK WRE+EQK ++KSLDHLGL FK ++K+ L  KQLL 
Sbjct: 433  VPTILKTAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNAEKRFLNDKQLLL 492

Query: 905  EISSIKVDQTNKRIHWLTPKPKSQLDYEVKDKRVLFDILRLADVFINHTSSYSNPDKERL 964
            E  S K D+  K  H+       +  YE  DK VL+D+  +    +   SS S   K   
Sbjct: 493  EYKSEKQDKLLKE-HY----DNYEYKYEFFDKSVLYDVKDIILCGLRSNSSTSESQKNLY 547

Query: 965  RDFLQSYIGLFFSIPIREIKDAVEAAIDNGKQLDENEQXXXXXXXXXRPRDVEICLSDIL 1024
                ++    FF +   E                             +  D + C +  +
Sbjct: 548  CQIFEA----FFDLLFEE-------------------------SSFTKHLDFQFCHNPAI 578

Query: 1025 NRSRYQRLKHSLDSSEASLGAVSPGQNEQDDMDEMIRQEAKKPWLLGS-LVEEANSQGLI 1083
            +                     S  Q  +DD++ M  +   +   LG     +   +   
Sbjct: 579  S---------------------SNSQISEDDVEAMFMKGILEEKGLGRWFSNDTELKKEF 617

Query: 1084 QNRKIYNMFANVNMYVFMRNLITIYDRLHEVKDINDVVTKEING--RKVVQFAKDLNLIS 1141
             NR+  N+F ++N+      + T+Y+R ++VK     + K++    R+    AK L L+ 
Sbjct: 618  SNRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTKKRRPSLLAKSLKLLP 677

Query: 1142 AQLKNMGLDFSGGDSYTQLLLLSKRLIEGDLEHQWFEESLRQAYRNRAFKLYTIDKVIQS 1201
             QL + GL+    D Y  +   SK+ + G+L+HQWFEESLR  + N+A+KLYTID+VI++
Sbjct: 678  MQLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIRN 737

Query: 1202 LVKHAHAIMTDSKSSDVMALFEKDRISSSTTSKDQILYRLQTRSHMSTTEHMFRIEYNTK 1261
            ++     I        ++ L   +    +TT   Q+ YR + R  M     MFR+E    
Sbjct: 738  ILGVITTISQTPSLLQILDLLVDNMKKLTTTKLQQLTYRTKVRMLMDGVGDMFRLEIVRD 797

Query: 1262 KSSISIQYIALDDLTLEEPKTLEDKWKYYITSYSLSHPTEGIPQEEIKIPFLDKVIESEQ 1321
             ++I  QYI +DDL   +    + +   Y   Y  +  T+ +  + +  P+    +    
Sbjct: 798  SNAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYSLNL---- 853

Query: 1322 VHMEDEDDNPKYSPEGVSKSNLMIKIDPETYRLEVEPGSFDIFSRKSVNKF 1372
              ++ E+ N  +    + K +L + I+P  Y +++ PGS DI S   + K 
Sbjct: 854  --LKREEQNIPFMNGNIYKPHLSVNINPLDYVVDIAPGSIDICSSTHITKL 902

>Kpol_1064.53 s1064 (95468..96937) [1470 bp, 489 aa] {ON}
           (95468..96937) [1470 nt, 490 aa]
          Length = 489

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 39/69 (56%), Gaps = 3/69 (4%)

Query: 629 FIGNKQVYVEFLKILNLYSQDILSLDDLIEKVDYYLGSNKELFDWFKNFVGFQ---DKPK 685
           + G K +Y ++LK+LN   QD  ++ D +E  D     + ++ ++  N + +Q   ++ K
Sbjct: 80  YTGLKNMYQDYLKVLNQLKQDKAAVRDEVEASDDKPEESSDVLEYIVNELPYQQPTERKK 139

Query: 686 HIENVVHEK 694
           +I+N +H K
Sbjct: 140 YIDNFIHSK 148

>CAGL0I08415g Chr9 (820773..824699) [3927 bp, 1308 aa] {ON} some
           similarities with uniprot|Q06211 Saccharomyces
           cerevisiae YPR164w KIM3 drug resistance
          Length = 1308

 Score = 35.0 bits (79), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 50/100 (50%), Gaps = 12/100 (12%)

Query: 124 LNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQ 183
           L++++ LT +E++++  N + DI    LD   D K++ +         S L+ G    ++
Sbjct: 764 LDIQNDLT-IEEIEVFENLKNDI---ILDCYFDIKTKKM--------YSLLYNGIQVSVE 811

Query: 184 GFNTFLPQGYTIECSSNPDDPIKVTTPLGSQIVTNSSIAK 223
           G +T+ P+ YTI  + NP+      + L   ++ N  I +
Sbjct: 812 GISTYYPKNYTIRHTRNPNKQFLFLSKLNRMLIVNFDIGE 851

>KLLA0C12771g Chr3 (1081988..1085017) [3030 bp, 1009 aa] {ON} similar
            to uniprot|P35729 Saccharomyces cerevisiae YKL057C NUP120
            Subunit of the Nup84p subcomplex of the nuclear pore
            complex (NPC) required for even distribution of NPCs
            around the nuclear envelope involved in establishment of
            a normal nucleocytoplasmic concentration gradient of the
            GTPase Gsp1p
          Length = 1009

 Score = 33.5 bits (75), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 22/31 (70%)

Query: 1395 FLNGKHGWKRQLSSDAISKIEQKFNDLKNGT 1425
            FLN  HG+   ++S+ ++KI +KF D+ NG+
Sbjct: 501  FLNILHGFSTTITSETLNKISEKFLDMVNGS 531

>KLLA0C06336g Chr3 (561371..562930) [1560 bp, 519 aa] {ON} highly
            similar to uniprot|P32340 Saccharomyces cerevisiae
            YML120C NDI1 NADH:ubiquinone oxidoreductase transfers
            electrons from NADH to ubiquinone in the respiratory
            chain but does not pump protons in contrast to the higher
            eukaryotic multisubunit respiratory complex I which is
            absent in S. cerevisiae
          Length = 519

 Score = 33.1 bits (74), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 41/92 (44%), Gaps = 8/92 (8%)

Query: 1263 SSISIQYIALDDLTLEEPKTLEDKWKYYITSYSLSHPTEGIPQEEIKIPFLDKVIESEQV 1322
            S++S  Y     L L +  T E K+ Y +T+      T GIP  E    FL ++  S Q+
Sbjct: 151  STVSQLYQPEKHLGLSQEDTAEIKYDYLLTAVGAEPNTFGIPGVEQYGNFLKEIPHSLQI 210

Query: 1323 HMEDEDDNPKYSPEGVSKSNLMIKIDPETYRL 1354
                     K     + K+NL+ K DPE  RL
Sbjct: 211  R--------KRFLANIEKANLLPKGDPERKRL 234

>KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363
            YCR084C
          Length = 655

 Score = 33.1 bits (74), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 48/96 (50%), Gaps = 7/96 (7%)

Query: 1046 VSPGQNEQDDMDEMIRQEAKKPWLLGSLVEEANSQGLIQNRKIYNMFANVNMYVFMRNLI 1105
            ++  QN+ +D+ E IRQE        S+ +EANS  L QN+K Y+   N ++    +   
Sbjct: 5    IAASQNKLNDLLEAIRQE------FASVSQEANSYRL-QNQKDYDYKINQHLAEMQQIRN 57

Query: 1106 TIYDRLHEVKDINDVVTKEINGRKVVQFAKDLNLIS 1141
            T+Y+     + + D   +EIN  KV    +D  + S
Sbjct: 58   TVYELELSHRKMKDTYQEEINRLKVELSQRDHQIAS 93

>Suva_8.261 Chr8 (472765..475035) [2271 bp, 756 aa] {ON} YOR208W
           (REAL)
          Length = 756

 Score = 33.1 bits (74), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 38/64 (59%), Gaps = 4/64 (6%)

Query: 617 VEEANF-FDKA-KKFIGNKQVYVEFLKILNLYSQDILSLDDLIEKVDYYLGSNKELFDWF 674
           V+ +N+ F+K  K ++G+++ YVEF+K++  Y  D+   +D   K+   L +   L + F
Sbjct: 117 VKRSNYPFEKLLKNYLGSEEKYVEFIKVIKAY--DVFIFNDSFSKISTCLKTTFCLIEKF 174

Query: 675 KNFV 678
           + F+
Sbjct: 175 QKFI 178

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 140,002,577
Number of extensions: 6219902
Number of successful extensions: 20287
Number of sequences better than 10.0: 95
Number of HSP's gapped: 20917
Number of HSP's successfully gapped: 190
Length of query: 1496
Length of database: 53,481,399
Length adjustment: 123
Effective length of query: 1373
Effective length of database: 39,377,481
Effective search space: 54065281413
Effective search space used: 54065281413
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 72 (32.3 bits)