Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1037.216.30ON1201206211e-84
TDEL0G043906.30ON1221205872e-79
KAFR0A051106.30ON1221205821e-78
ZYRO0C07502g6.30ON1221205794e-78
NDAI0C026706.30ON1221205785e-78
NCAS0D021206.30ON1221205785e-78
Suva_15.1696.30ON1221205715e-77
Skud_15.1576.30ON1221205715e-77
Smik_15.1656.30ON1201205672e-76
YOL005C (RPB11)6.30ON1201205672e-76
KNAG0F029106.30ON1221205682e-76
CAGL0E02453g6.30ON1201205647e-76
TPHA0J004106.30ON1201205603e-75
TBLA0E031506.30ON1181185551e-74
SAKL0E01562g6.30ON1221205552e-74
ACL005C6.30ON1221205333e-71
KLTH0C10934g6.30ON1221205291e-70
Kwal_56.224726.30ON1221205265e-70
KLLA0C06160g6.30ON1211185082e-67
TPHA0B029202.163ON1301061366e-11
CAGL0L03872g2.163ON137921306e-10
TBLA0B012902.163ON102861191e-08
Kpol_165.22.163ON128921201e-08
KAFR0B045702.163ON131901174e-08
KNAG0I020602.163ON134901141e-07
Ecym_54232.163ON127901122e-07
YNL113W (RPC19)2.163ON1421021132e-07
Smik_14.2142.163ON1421021123e-07
ZYRO0B09878g2.163ON130901104e-07
Skud_14.2182.163ON1561041099e-07
AFL220C2.163ON135901071e-06
Suva_14.2252.163ON1421041071e-06
TDEL0F011802.163ON129901062e-06
NCAS0G025502.163ON150901044e-06
SAKL0E10692g2.163ON131901034e-06
NDAI0F027502.163ON149691029e-06
KLTH0D09350g2.163ON146711002e-05
KLLA0F23760g2.163ON12788982e-05
Kwal_26.84732.163ON15071958e-05
Kwal_23.58927.257ON67859652.0
NCAS0D022805.9ON80850642.9
KNAG0B026007.353ON279101624.2
YHL030W (ECM29)4.15ON186863616.9
NCAS0C058604.15ON1868113609.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1037.21
         (120 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1037.21 s1037 complement(44216..44578) [363 bp, 120 aa] {ON...   243   1e-84
TDEL0G04390 Chr7 complement(794577..794945) [369 bp, 122 aa] {ON...   230   2e-79
KAFR0A05110 Chr1 complement(1014087..1014455) [369 bp, 122 aa] {...   228   1e-78
ZYRO0C07502g Chr3 complement(567967..568335) [369 bp, 122 aa] {O...   227   4e-78
NDAI0C02670 Chr3 (621282..621650) [369 bp, 122 aa] {ON} Anc_6.30...   227   5e-78
NCAS0D02120 Chr4 complement(393640..394008) [369 bp, 122 aa] {ON...   227   5e-78
Suva_15.169 Chr15 complement(289702..290070) [369 bp, 122 aa] {O...   224   5e-77
Skud_15.157 Chr15 complement(275429..275797) [369 bp, 122 aa] {O...   224   5e-77
Smik_15.165 Chr15 complement(283099..283461) [363 bp, 120 aa] {O...   223   2e-76
YOL005C Chr15 complement(315813..316175) [363 bp, 120 aa] {ON}  ...   223   2e-76
KNAG0F02910 Chr6 complement(551617..551985) [369 bp, 122 aa] {ON...   223   2e-76
CAGL0E02453g Chr5 complement(233352..233714) [363 bp, 120 aa] {O...   221   7e-76
TPHA0J00410 Chr10 (95837..96199) [363 bp, 120 aa] {ON} Anc_6.30 ...   220   3e-75
TBLA0E03150 Chr5 complement(788457..788813) [357 bp, 118 aa] {ON...   218   1e-74
SAKL0E01562g Chr5 (120177..120545) [369 bp, 122 aa] {ON} highly ...   218   2e-74
ACL005C Chr3 complement(346569..346937) [369 bp, 122 aa] {ON} Sy...   209   3e-71
KLTH0C10934g Chr3 complement(900683..901051) [369 bp, 122 aa] {O...   208   1e-70
Kwal_56.22472 s56 (144443..144811) [369 bp, 122 aa] {ON} YOL005C...   207   5e-70
KLLA0C06160g Chr3 complement(543239..543604) [366 bp, 121 aa] {O...   200   2e-67
TPHA0B02920 Chr2 (666060..666452) [393 bp, 130 aa] {ON} Anc_2.16...    57   6e-11
CAGL0L03872g Chr12 complement(447274..447687) [414 bp, 137 aa] {...    55   6e-10
TBLA0B01290 Chr2 (274238..274546) [309 bp, 102 aa] {ON} Anc_2.16...    50   1e-08
Kpol_165.2 s165 complement(2511..2897) [387 bp, 128 aa] {ON} com...    51   1e-08
KAFR0B04570 Chr2 complement(949880..950275) [396 bp, 131 aa] {ON...    50   4e-08
KNAG0I02060 Chr9 complement(401412..401816) [405 bp, 134 aa] {ON...    49   1e-07
Ecym_5423 Chr5 complement(871715..872098) [384 bp, 127 aa] {ON} ...    48   2e-07
YNL113W Chr14 (412771..413199) [429 bp, 142 aa] {ON}  RPC19RNA p...    48   2e-07
Smik_14.214 Chr14 (392413..392841) [429 bp, 142 aa] {ON} YNL113W...    48   3e-07
ZYRO0B09878g Chr2 complement(771644..772036) [393 bp, 130 aa] {O...    47   4e-07
Skud_14.218 Chr14 (402879..403349) [471 bp, 156 aa] {ON} YNL113W...    47   9e-07
AFL220C Chr6 complement(25281..25688) [408 bp, 135 aa] {ON} Synt...    46   1e-06
Suva_14.225 Chr14 (409562..409990) [429 bp, 142 aa] {ON} YNL113W...    46   1e-06
TDEL0F01180 Chr6 (211106..211495) [390 bp, 129 aa] {ON} Anc_2.16...    45   2e-06
NCAS0G02550 Chr7 (456827..457279) [453 bp, 150 aa] {ON} Anc_2.16...    45   4e-06
SAKL0E10692g Chr5 complement(891637..892032) [396 bp, 131 aa] {O...    44   4e-06
NDAI0F02750 Chr6 complement(673843..674292) [450 bp, 149 aa] {ON...    44   9e-06
KLTH0D09350g Chr4 complement(776115..776555) [441 bp, 146 aa] {O...    43   2e-05
KLLA0F23760g Chr6 complement(2218555..2218938) [384 bp, 127 aa] ...    42   2e-05
Kwal_26.8473 s26 complement(800017..800469) [453 bp, 150 aa] {ON...    41   8e-05
Kwal_23.5892 s23 (1358818..1360854) [2037 bp, 678 aa] {ON} YIL06...    30   2.0  
NCAS0D02280 Chr4 complement(427826..430252) [2427 bp, 808 aa] {O...    29   2.9  
KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 ...    28   4.2  
YHL030W Chr8 (40084..45690) [5607 bp, 1868 aa] {ON}  ECM29Scaffo...    28   6.9  
NCAS0C05860 Chr3 complement(1204693..1210299) [5607 bp, 1868 aa]...    28   9.1  

>Kpol_1037.21 s1037 complement(44216..44578) [363 bp, 120 aa] {ON}
           complement(44216..44578) [363 nt, 121 aa]
          Length = 120

 Score =  243 bits (621), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 120/120 (100%), Positives = 120/120 (100%)

Query: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60
           MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA
Sbjct: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF
Sbjct: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120

>TDEL0G04390 Chr7 complement(794577..794945) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  230 bits (587), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 110/120 (91%), Positives = 116/120 (96%)

Query: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60
           MNAPD+FELFLLGEGESKL IEPDTKAPNAVVITFEKEDHTLGNLIRSELLND+KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHPLFARFK+RIQTVE YDPKDALKNACN IINKL +LKTNFETEWNLQTLASD+N+
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY 120

>KAFR0A05110 Chr1 complement(1014087..1014455) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  228 bits (582), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 117/120 (97%)

Query: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60
           MNAPD+FELFLLGEGESKL I+PDTK+PNAVVITFEKEDHTLGNLIR+ELLND+KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHP FARFKLR+QT+E YDPK+ALKNACN+IINKLGILKTNFETEWNLQTLASDENF
Sbjct: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120

>ZYRO0C07502g Chr3 complement(567967..568335) [369 bp, 122 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 122

 Score =  227 bits (579), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 116/120 (96%)

Query: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60
           MNAPD+FELFLLGEGESKL ++PDTKAPNA+V+TFEKEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHPLFARFK+RIQT+E YDPKDALKNACN IINKLG+LKTNFETEWNLQTLASD+NF
Sbjct: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDDNF 120

>NDAI0C02670 Chr3 (621282..621650) [369 bp, 122 aa] {ON} Anc_6.30
           YOL005C
          Length = 122

 Score =  227 bits (578), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 111/120 (92%), Positives = 114/120 (95%)

Query: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60
           MNAPD+FELFLLGEGESKL I+PDTKAPNAVVITF+KEDHTLGNLIRSELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHP FA FKLRIQTVE YDPK ALKNACNNIINKLGILKTNFETEWNLQTLASDENF
Sbjct: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120

>NCAS0D02120 Chr4 complement(393640..394008) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  227 bits (578), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 115/120 (95%)

Query: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60
           MNAPD+FELFLLGEGESKL I+PDTKAPNAVVITFEKEDHTLGNLIRSELLNDS+VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHP FARFKLRIQTVE YDPKDALKNACN+II+KLG+LK NFETEWNLQTLA+DEN 
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADENM 120

>Suva_15.169 Chr15 complement(289702..290070) [369 bp, 122 aa] {ON}
           YOL005C (REAL)
          Length = 122

 Score =  224 bits (571), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 113/120 (94%)

Query: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60
           MNAPD+FELFLLGEGESKL IEPDTKAPNAVVITFEKEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHP FARFKLRIQT E YDPKDALKNACN+IINKLG LKTNFETEWNLQTLA+D+ F
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

>Skud_15.157 Chr15 complement(275429..275797) [369 bp, 122 aa] {ON}
           YOL005C (REAL)
          Length = 122

 Score =  224 bits (571), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 113/120 (94%)

Query: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60
           MNAPD+FELFLLGEGESKL IEPDTKAPNAVVITFEKEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHP FARFKLRIQT E YDPKDALKNACN+IINKLG LKTNFETEWNLQTLA+D+ F
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

>Smik_15.165 Chr15 complement(283099..283461) [363 bp, 120 aa] {ON}
           YOL005C (REAL)
          Length = 120

 Score =  223 bits (567), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 113/120 (94%)

Query: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60
           MNAPD+FELFLLGEGESKL I+PDTKAPNAVVITFEKEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHP FARFKLRIQT E YDPKDALKNACN+IINKLG LKTNFETEWNLQTLA+D+ F
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLATDDAF 120

>YOL005C Chr15 complement(315813..316175) [363 bp, 120 aa] {ON}
           RPB11RNA polymerase II subunit B12.5; part of central
           core; similar to Rpc19p and bacterial alpha subunit
          Length = 120

 Score =  223 bits (567), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 113/120 (94%)

Query: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60
           MNAPD+FELFLLGEGESKL I+PDTKAPNAVVITFEKEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHP FARFKLRIQT E YDPKDALKNACN+IINKLG LKTNFETEWNLQTLA+D+ F
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

>KNAG0F02910 Chr6 complement(551617..551985) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  223 bits (568), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 114/120 (95%)

Query: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60
           MNAPD+FELFLLG+GESKL I+PDTK+PNA+VITF KEDHTLGNLIR+ELLNDSKVLFAA
Sbjct: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHP FARFKLRIQTVE YDPKDALKNACN IINKLGILKTNFETEWNLQTLA+D+ F
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDDTF 120

>CAGL0E02453g Chr5 complement(233352..233714) [363 bp, 120 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005c RPB11 DNA-directed RNA polymerase II
          Length = 120

 Score =  221 bits (564), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 105/120 (87%), Positives = 115/120 (95%)

Query: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60
           MNAPD+FELFLLGEGESKL I+PDTKAPNAVVITFEKEDHTLGNLIR+ELLND+KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDNKVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHP FARFKLRIQTVE YDPKDAL+NAC++IINKLG LK+NFETEWNLQTLA+D+ F
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALRNACSSIINKLGALKSNFETEWNLQTLAADDAF 120

>TPHA0J00410 Chr10 (95837..96199) [363 bp, 120 aa] {ON} Anc_6.30
           YOL005C
          Length = 120

 Score =  220 bits (560), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 113/120 (94%)

Query: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60
           MNAPD+FELFLL EG+SKL IE DTKA NAVVITFEKEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHPLFARFKLRIQT ENYDPKDALK ACNNIINKLGILKTNF+TEWNLQTLASD+NF
Sbjct: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDNF 120

>TBLA0E03150 Chr5 complement(788457..788813) [357 bp, 118 aa] {ON}
           Anc_6.30 YOL005C
          Length = 118

 Score =  218 bits (555), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 111/118 (94%)

Query: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60
           MNAPD+FE FLLGEGESKL IEPDTKAPN VVITFEKEDHTLGNLI+SELL+D KVLFAA
Sbjct: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDE 118
           YKVEHPLFARFK+RIQTVE YDPKDAL+ ACN+II KLGILKTNFETEWNLQTLASD+
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118

>SAKL0E01562g Chr5 (120177..120545) [369 bp, 122 aa] {ON} highly
           similar to uniprot|P38902 Saccharomyces cerevisiae
           YOL005C
          Length = 122

 Score =  218 bits (555), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 103/120 (85%), Positives = 113/120 (94%)

Query: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60
           MNAPD+FELFLL EGESKLNIEPDTKAPNAV+ITFEKEDHTLGNLIR+ELL D +VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHPLFARFK+RIQTVE YDPKDALKNACNNII KL  L++NFETEW+LQTLAS+EN+
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY 120

>ACL005C Chr3 complement(346569..346937) [369 bp, 122 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL005C
           (RPB11)
          Length = 122

 Score =  209 bits (533), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 98/120 (81%), Positives = 110/120 (91%)

Query: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60
           MNAPD+FELFLL EGESKL IEPDTKA NAV+ITFEKEDHTLGN+IR+ELL D +VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHPLFARF++RIQT E YDPK+ALKNACN+IINKL  LK+NFETEWNLQTLAS++ F
Sbjct: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASEDQF 120

>KLTH0C10934g Chr3 complement(900683..901051) [369 bp, 122 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 122

 Score =  208 bits (529), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 98/120 (81%), Positives = 110/120 (91%)

Query: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60
           MNAPD+FELFLL EGE+KL I+PDTKAPNAV++TFEKEDHTL NLIR ELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRGELLEDKGVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHPLFA+FKLRIQTVE YDPKDALKNACN II+KLG L++NFETEWNLQTLAS++N+
Sbjct: 61  YKVEHPLFAQFKLRIQTVEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120

>Kwal_56.22472 s56 (144443..144811) [369 bp, 122 aa] {ON} YOL005C
           (RPB11) - RNA polymerase II subunit, homologous to S.
           pombe Rpb11p subunit [contig 185] FULL
          Length = 122

 Score =  207 bits (526), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 110/120 (91%)

Query: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60
           MNAPD+FELFLL EGE+KL I+PDTKAPNAV++TFEKEDHTL NLIR+ELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHPLFA+FK+RIQT E YDPKDALKNACN II+KLG L++NFETEWNLQTLAS++N+
Sbjct: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120

>KLLA0C06160g Chr3 complement(543239..543604) [366 bp, 121 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 121

 Score =  200 bits (508), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 93/118 (78%), Positives = 108/118 (91%)

Query: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60
           MNAPD+FELFLL EGESKL +E DTKA +A+++TFEKEDHTLGNLIR+ELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60

Query: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDE 118
           YKVEHPLFA+FK+RIQTVE YDPKDALKNACN+IINKL  L++NFETEWNLQTLA+++
Sbjct: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLATED 118

>TPHA0B02920 Chr2 (666060..666452) [393 bp, 130 aa] {ON} Anc_2.163
           YNL113W
          Length = 130

 Score = 57.0 bits (136), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 56/106 (52%), Gaps = 2/106 (1%)

Query: 2   NAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDSKVLFA 59
           + P+  E+ +    E K+ I P+  +P+    +F+  +EDHTLGN +R  ++ + +V F 
Sbjct: 18  SVPEVDEVDVNAVDEDKIKILPNATSPDGTSASFQISEEDHTLGNALRHIIMKNPEVEFC 77

Query: 60  AYKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNF 105
            Y + HP      LRIQT  N    +AL+    ++++   +++  F
Sbjct: 78  GYSIPHPSETLLNLRIQTYGNTTAVEALQKGLKDLMDMCDVVEEKF 123

>CAGL0L03872g Chr12 complement(447274..447687) [414 bp, 137 aa] {ON}
           similar to uniprot|P28000 Saccharomyces cerevisiae
           YNL113w RPC19 DNA-directed RNA polymerase I III
          Length = 137

 Score = 54.7 bits (130), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 49/92 (53%), Gaps = 2/92 (2%)

Query: 16  ESKLNIEPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDSKVLFAAYKVEHPLFARFKL 73
           ++K+ + P   + +    +F+  +EDHTLGN +R  ++ + +V F  Y + HP      L
Sbjct: 40  KTKIKLLPQATSEDGTCASFQIAQEDHTLGNALRYIIMKNPEVEFCGYSIPHPSEELLNL 99

Query: 74  RIQTVENYDPKDALKNACNNIINKLGILKTNF 105
           RIQT  N    DAL+   +++I+    +K  F
Sbjct: 100 RIQTYGNITAVDALQKGLDDLIDLCDAVKDKF 131

>TBLA0B01290 Chr2 (274238..274546) [309 bp, 102 aa] {ON} Anc_2.163
           YNL113W
          Length = 102

 Score = 50.4 bits (119), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 40/86 (46%)

Query: 20  NIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAAYKVEHPLFARFKLRIQTVE 79
            + P T   +A       EDHTLGN +R  L+ +  V F  Y + HP      LR+QT  
Sbjct: 10  QLPPVTPDGSAASFQIRDEDHTLGNALRYLLMRNPAVEFCGYSIPHPSEPFLNLRVQTYG 69

Query: 80  NYDPKDALKNACNNIINKLGILKTNF 105
           +    DAL     ++++   +++  F
Sbjct: 70  DITASDALAQGLQDLMDLCDVVEDTF 95

>Kpol_165.2 s165 complement(2511..2897) [387 bp, 128 aa] {ON}
           complement(2511..2897) [387 nt, 129 aa]
          Length = 128

 Score = 50.8 bits (120), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 47/92 (51%), Gaps = 2/92 (2%)

Query: 16  ESKLNIEPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDSKVLFAAYKVEHPLFARFKL 73
           E K+ I P   + +    +F+   EDHTLGN +R  ++ + +V F  Y + HP      L
Sbjct: 30  EDKIKILPQATSEDGTCASFQIMDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENLLNL 89

Query: 74  RIQTVENYDPKDALKNACNNIINKLGILKTNF 105
           RIQT  +    +AL+    ++++   +++  F
Sbjct: 90  RIQTYGSTTAVEALQKGLGDLMDMCDVVEEKF 121

>KAFR0B04570 Chr2 complement(949880..950275) [396 bp, 131 aa] {ON}
           Anc_2.163 YNL113W
          Length = 131

 Score = 49.7 bits (117), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 46/90 (51%), Gaps = 2/90 (2%)

Query: 18  KLNIEPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDSKVLFAAYKVEHPLFARFKLRI 75
           K+ I P   + +    +F+  +EDHTLGN +R  ++ + +V F  Y + HP      +RI
Sbjct: 35  KIKILPQATSEDGTSASFQIVEEDHTLGNALRYIIMKNPQVEFCGYSIPHPSENLLNIRI 94

Query: 76  QTVENYDPKDALKNACNNIINKLGILKTNF 105
           QT       DALK    ++++   +++  F
Sbjct: 95  QTYGEITAVDALKKGLADLMDLCDVVEETF 124

>KNAG0I02060 Chr9 complement(401412..401816) [405 bp, 134 aa] {ON}
           Anc_2.163 YNL113W
          Length = 134

 Score = 48.5 bits (114), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 44/90 (48%), Gaps = 2/90 (2%)

Query: 18  KLNIEPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDSKVLFAAYKVEHPLFARFKLRI 75
           K+ I P+    +    +F+   EDHTLGN +R  ++ + +V F  Y + HP      +RI
Sbjct: 38  KVKILPEATTEDGTCASFQILNEDHTLGNALRYVIMKNPEVEFCGYSIPHPSENWLNVRI 97

Query: 76  QTVENYDPKDALKNACNNIINKLGILKTNF 105
           QT       DA K    ++++   +++  F
Sbjct: 98  QTYGKITAVDAFKKGLGDLMDMCDVVEDVF 127

>Ecym_5423 Chr5 complement(871715..872098) [384 bp, 127 aa] {ON}
           similar to Ashbya gossypii AFL220C
          Length = 127

 Score = 47.8 bits (112), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 45/90 (50%), Gaps = 2/90 (2%)

Query: 18  KLNIEPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDSKVLFAAYKVEHPLFARFKLRI 75
           K+ + P+  + +    +F+   EDHTLGN +R  ++ + +V F  Y + HP      LRI
Sbjct: 31  KIRLLPEAASEDGTCASFQISDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSETVLNLRI 90

Query: 76  QTVENYDPKDALKNACNNIINKLGILKTNF 105
           QT       +AL     ++++   +++  F
Sbjct: 91  QTYGKMTAVEALHKGLKDLMDLCDVVEDKF 120

>YNL113W Chr14 (412771..413199) [429 bp, 142 aa] {ON}  RPC19RNA
           polymerase subunit AC19, common to RNA polymerases I and
           III
          Length = 142

 Score = 48.1 bits (113), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 51/102 (50%), Gaps = 8/102 (7%)

Query: 4   PDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAAYKV 63
           PD+ ++ LL +  S    E  T A   +V    +EDHTLGN +R  ++ +  V F  Y +
Sbjct: 42  PDREKIKLLTQATS----EDGTSASFQIV----EEDHTLGNALRYVIMKNPDVEFCGYSI 93

Query: 64  EHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNF 105
            HP      +RIQT       DAL+    ++++   ++++ F
Sbjct: 94  PHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKF 135

>Smik_14.214 Chr14 (392413..392841) [429 bp, 142 aa] {ON} YNL113W
           (REAL)
          Length = 142

 Score = 47.8 bits (112), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 51/102 (50%), Gaps = 8/102 (7%)

Query: 4   PDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAAYKV 63
           PD+ ++ LL +  S    E  T A   +V    +EDHTLGN +R  ++ +  V F  Y +
Sbjct: 42  PDREKIKLLTQATS----EDGTSASFQIV----EEDHTLGNALRYIIMKNPDVEFCGYSI 93

Query: 64  EHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNF 105
            HP      +RIQT       DAL+    ++++   ++++ F
Sbjct: 94  PHPSENLLNIRIQTYGESTAVDALQKGLKDLMDLCDVVESKF 135

>ZYRO0B09878g Chr2 complement(771644..772036) [393 bp, 130 aa] {ON}
           highly similar to uniprot|Q755Q7 Ashbya gossypii AFL220C
           AFL220Cp and similar to YNL113W uniprot|P28000
           Saccharomyces cerevisiae YNL113W RPC19 RNA polymerase
           subunit common to RNA polymerases I and III
          Length = 130

 Score = 47.0 bits (110), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 2/90 (2%)

Query: 18  KLNIEPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDSKVLFAAYKVEHPLFARFKLRI 75
           K+ I P   + +    +F+  +EDHTLGN +R  ++ +  V F  Y + HP      +R+
Sbjct: 34  KIKILPQATSEDGTCASFQIAEEDHTLGNALRYMIMKNPDVEFCGYSIPHPSENLLNIRV 93

Query: 76  QTVENYDPKDALKNACNNIINKLGILKTNF 105
           QT  N    D L     ++++    ++  F
Sbjct: 94  QTYGNVTAVDVLHKGLQDLMDLCDAVEDKF 123

>Skud_14.218 Chr14 (402879..403349) [471 bp, 156 aa] {ON} YNL113W
           (REAL)
          Length = 156

 Score = 46.6 bits (109), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 51/104 (49%), Gaps = 8/104 (7%)

Query: 2   NAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAAY 61
           + PD+ ++ LL +  S    E  T A   +V    +EDHTLGN +R  ++ +  V F  Y
Sbjct: 54  DEPDREKIKLLTQATS----EDGTNASFQIV----EEDHTLGNALRYIIMKNPDVEFCGY 105

Query: 62  KVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNF 105
            + HP      +RIQT       DAL+    ++++   +++  F
Sbjct: 106 SIPHPSENLLNIRIQTYGEITAVDALQKGLKDLMDLCDVVEAKF 149

>AFL220C Chr6 complement(25281..25688) [408 bp, 135 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL113W
           (RPC19)
          Length = 135

 Score = 45.8 bits (107), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 2/90 (2%)

Query: 18  KLNIEPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDSKVLFAAYKVEHPLFARFKLRI 75
           K+ + P   + +     F+   EDHTLGN +R  ++ + +V F  Y + HP      +RI
Sbjct: 39  KIRLLPQATSEDGTCAFFQITDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENFLNIRI 98

Query: 76  QTVENYDPKDALKNACNNIINKLGILKTNF 105
           QT       DAL     ++++   +++  F
Sbjct: 99  QTYGKVTAVDALHKGLQDLMDMCDVVEDKF 128

>Suva_14.225 Chr14 (409562..409990) [429 bp, 142 aa] {ON} YNL113W
           (REAL)
          Length = 142

 Score = 45.8 bits (107), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 53/104 (50%), Gaps = 8/104 (7%)

Query: 2   NAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAAY 61
           + PD+ ++ LL +  S    E  T A   +V    +EDHTLGN +R  ++ + +V F  Y
Sbjct: 40  DEPDREKIKLLTQATS----EDGTSASFQIV----EEDHTLGNALRYIIMKNPEVEFCGY 91

Query: 62  KVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNF 105
            + HP      +RIQT       +AL+    ++++   ++++ F
Sbjct: 92  SIPHPSENLLNVRIQTYGAITAVEALQKGLKDLMDLCDVVESKF 135

>TDEL0F01180 Chr6 (211106..211495) [390 bp, 129 aa] {ON} Anc_2.163
           YNL113W
          Length = 129

 Score = 45.4 bits (106), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 2/90 (2%)

Query: 18  KLNIEPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDSKVLFAAYKVEHPLFARFKLRI 75
           K+ + P   + +    +F+  +EDHTLGN +R  ++ +  V F  Y + HP      LRI
Sbjct: 33  KIKLLPQASSEDGTCASFQIAEEDHTLGNALRYVIMKNKDVEFCGYSIPHPSENLLNLRI 92

Query: 76  QTVENYDPKDALKNACNNIINKLGILKTNF 105
           QT       D L+    ++++    ++  F
Sbjct: 93  QTYGATTAVDVLQKGLTDLMDLCDAVEDRF 122

>NCAS0G02550 Chr7 (456827..457279) [453 bp, 150 aa] {ON} Anc_2.163
           YNL113W
          Length = 150

 Score = 44.7 bits (104), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 45/90 (50%), Gaps = 2/90 (2%)

Query: 18  KLNIEPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDSKVLFAAYKVEHPLFARFKLRI 75
           K+ I P+  + +    +F+   EDHTLGN +R  ++ +  V F  Y + HP      +RI
Sbjct: 54  KVKILPEGASEDGTCASFQIVDEDHTLGNALRYIIMKNPNVEFCGYSIPHPSENFLNVRI 113

Query: 76  QTVENYDPKDALKNACNNIINKLGILKTNF 105
           QT  +    +A +    ++++   +++  F
Sbjct: 114 QTYGDITAVEAFQKGLQDLMDLCDVVEDKF 143

>SAKL0E10692g Chr5 complement(891637..892032) [396 bp, 131 aa] {ON}
           highly similar to uniprot|P28000 Saccharomyces
           cerevisiae YNL113W RPC19 RNA polymerase subunit common
           to RNA polymerases I and III
          Length = 131

 Score = 44.3 bits (103), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 45/90 (50%), Gaps = 2/90 (2%)

Query: 18  KLNIEPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDSKVLFAAYKVEHPLFARFKLRI 75
           K+ + P   + +    +F+  +EDHTLGN +R  ++ + +V F  Y + HP      +RI
Sbjct: 35  KIKLLPQATSDDGTSASFQISEEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENLLNVRI 94

Query: 76  QTVENYDPKDALKNACNNIINKLGILKTNF 105
           QT       +AL+    ++++    ++  F
Sbjct: 95  QTYGKITAVEALQKGLQDLMDMCDAVEDKF 124

>NDAI0F02750 Chr6 complement(673843..674292) [450 bp, 149 aa] {ON}
           Anc_2.163 YNL113W
          Length = 149

 Score = 43.9 bits (102), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 36/69 (52%)

Query: 37  KEDHTLGNLIRSELLNDSKVLFAAYKVEHPLFARFKLRIQTVENYDPKDALKNACNNIIN 96
           +EDHTLGN +R  ++ + +V F  Y + HP      +RIQT       +AL     ++++
Sbjct: 74  QEDHTLGNALRYIIMKNPQVEFCGYSIPHPSEEFLNIRIQTYGEITAVEALHKGLQDLMD 133

Query: 97  KLGILKTNF 105
              +++  F
Sbjct: 134 LCDVVEEKF 142

>KLTH0D09350g Chr4 complement(776115..776555) [441 bp, 146 aa] {ON}
           some similarities with uniprot|P28000 Saccharomyces
           cerevisiae YNL113W RPC19 RNA polymerase subunit common
           to RNA polymerases I and III
          Length = 146

 Score = 43.1 bits (100), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 35/71 (49%)

Query: 35  FEKEDHTLGNLIRSELLNDSKVLFAAYKVEHPLFARFKLRIQTVENYDPKDALKNACNNI 94
             +EDHTLGN +R  ++ +  V F  Y + HP      LRIQT   +   + L+    ++
Sbjct: 69  ISEEDHTLGNALRYIIMKNPDVEFCGYSIPHPSETLLNLRIQTYGKFTAVEVLQKGLQDL 128

Query: 95  INKLGILKTNF 105
           ++    ++  F
Sbjct: 129 MDLCDAVEDKF 139

>KLLA0F23760g Chr6 complement(2218555..2218938) [384 bp, 127 aa]
           {ON} similar to uniprot|P28000 Saccharomyces cerevisiae
           YNL113W RPC19 RNA polymerase subunit common to RNA
           polymerases I and III
          Length = 127

 Score = 42.4 bits (98), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 40/88 (45%)

Query: 18  KLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAAYKVEHPLFARFKLRIQT 77
           KL  E  ++   +       EDHTLGN +R  ++ + +V F  Y + HP      +RIQT
Sbjct: 33  KLLTEATSEDGTSASFRITDEDHTLGNTLRYMIMKNPEVEFCGYSIPHPSENFLHIRIQT 92

Query: 78  VENYDPKDALKNACNNIINKLGILKTNF 105
                  +AL     ++++    ++  F
Sbjct: 93  YGKITAVEALHKGLGDLMDMCDAVEDRF 120

>Kwal_26.8473 s26 complement(800017..800469) [453 bp, 150 aa] {ON}
           YNL113W (RPC19) - subunit common to RNA polymerases I
           (A) and III (C) [contig 61] FULL
          Length = 150

 Score = 41.2 bits (95), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 35/71 (49%)

Query: 35  FEKEDHTLGNLIRSELLNDSKVLFAAYKVEHPLFARFKLRIQTVENYDPKDALKNACNNI 94
             +EDHTLGN +R  ++ +  V F  Y + HP      LRIQT   +   + L+    ++
Sbjct: 73  ISEEDHTLGNSLRYIIMKNPDVEFCGYSIPHPSENLLNLRIQTYGKHTALEVLQKGLQDL 132

Query: 95  INKLGILKTNF 105
           ++    ++  F
Sbjct: 133 MDLCDAVEDKF 143

>Kwal_23.5892 s23 (1358818..1360854) [2037 bp, 678 aa] {ON} YIL067C
           - Hypothetical ORF [contig 11] FULL
          Length = 678

 Score = 29.6 bits (65), Expect = 2.0,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 29/59 (49%)

Query: 41  TLGNLIRSELLNDSKVLFAAYKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLG 99
           T G+L+R E  N  K    AY  EHP    +++   T ++++  DA     N+I   +G
Sbjct: 547 TRGSLLRGEAGNSWKPPVLAYNQEHPHLLNWQVTNSTEKSFEKLDAYSLLINDIERYVG 605

>NCAS0D02280 Chr4 complement(427826..430252) [2427 bp, 808 aa] {ON}
           Anc_5.9 YMR309C
          Length = 808

 Score = 29.3 bits (64), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 71  FKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
            +  + +  +Y P D  K + N+I+N + IL  NF T + +  LA+   F
Sbjct: 305 MRFDVSSTLSYQPIDQWKASFNDIVNLMTILDNNFST-YQVSELAAPAEF 353

>KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 bp,
           279 aa] {ON} Anc_7.353 YLR199C
          Length = 279

 Score = 28.5 bits (62), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 44/101 (43%), Gaps = 7/101 (6%)

Query: 20  NIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAAYKVEHPLFARFKLRIQTVE 79
           + +PD K  N +  T      T G L+ S  LN+S V  AA ++       +  R     
Sbjct: 49  DCDPDHKIMNPLFNTSHTHAMTRGELVTSLQLNESVVSQAATELSQ----HWDYRENFPN 104

Query: 80  NYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
            +DP    +    +I+ +L I++ N     N   ++ DENF
Sbjct: 105 EFDPASDTREDTKSIVLRLPIVELN---GMNTLLISVDENF 142

>YHL030W Chr8 (40084..45690) [5607 bp, 1868 aa] {ON}  ECM29Scaffold
           protein that assists in association of the proteasome
           core particle with the regulatory particle; degraded by
           the mature proteasome after assembly; contains HEAT-like
           repeats
          Length = 1868

 Score = 28.1 bits (61), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 5/63 (7%)

Query: 11  LLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRS--ELLND---SKVLFAAYKVEH 65
           L  EG  KL + P T A N  ++  + +  TLG++++   EL++D    + LF + K + 
Sbjct: 397 LHAEGWPKLQLGPQTPAFNTAILQRQLQYETLGDILKRDFELVSDLSYIEFLFESLKNDL 456

Query: 66  PLF 68
           P F
Sbjct: 457 PQF 459

>NCAS0C05860 Chr3 complement(1204693..1210299) [5607 bp, 1868 aa]
           {ON} Anc_4.15 YHL030W
          Length = 1868

 Score = 27.7 bits (60), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 53/113 (46%), Gaps = 6/113 (5%)

Query: 11  LLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSE--LLNDSKVLFAAYKVEHPLF 68
           L  EG  KL +   T A N  ++    +  TLG+++  E  L+ D   +   +       
Sbjct: 391 LHAEGWPKLQLGESTPAFNTTILQRRLQYETLGDILMKEFSLVEDLSFIEFLFDSLQGDL 450

Query: 69  ARFKLRIQ-TVENYDPKDALKNACNNIINKL-GILKTNFETEWNLQTLASDEN 119
           + F+  IQ  + +  P   L+   ++  +KL GILK     ++NLQ  +SD+N
Sbjct: 451 SEFRASIQEALISLTPH--LRKLPSSSKDKLKGILKNLLSDDFNLQEASSDQN 501

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.135    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,723,672
Number of extensions: 547482
Number of successful extensions: 1606
Number of sequences better than 10.0: 54
Number of HSP's gapped: 1605
Number of HSP's successfully gapped: 54
Length of query: 120
Length of database: 53,481,399
Length adjustment: 89
Effective length of query: 31
Effective length of database: 43,276,125
Effective search space: 1341559875
Effective search space used: 1341559875
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)