Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1037.116.46ON40140118660.0
TPHA0J005106.46ON4374336461e-79
NCAS0H009006.46ON4954155525e-65
ZYRO0C07172g6.46ON4504115417e-64
TDEL0G042406.46ON4444175181e-60
KAFR0L004206.46ON4604135191e-60
NDAI0D008906.46ON5393285172e-59
SAKL0E01980g6.46ON4654185026e-58
KNAG0E009106.46ON4864384811e-54
KLTH0C10582g6.46ON4814254731e-53
CAGL0J11792g6.46ON5104404715e-53
YML043C (RRN11)6.46ON5074474689e-53
Smik_13.1066.46ON5064464681e-52
Suva_13.1176.46ON5134514574e-51
Skud_13.1056.46ON5124534522e-50
KLLA0C05852g6.46ON4824164503e-50
TBLA0B005706.46ON5174214217e-46
Kwal_56.225276.46ON4814024143e-45
ACL020W6.46ON5393114112e-44
Ecym_30496.46ON5013114075e-44
TPHA0G002707.543ON47246713.2
Suva_16.966.224ON64056695.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1037.11
         (401 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1037.11 s1037 (23974..25179) [1206 bp, 401 aa] {ON} (23974....   723   0.0  
TPHA0J00510 Chr10 complement(114098..115411) [1314 bp, 437 aa] {...   253   1e-79
NCAS0H00900 Chr8 (167875..169362) [1488 bp, 495 aa] {ON} Anc_6.4...   217   5e-65
ZYRO0C07172g Chr3 (541070..542422) [1353 bp, 450 aa] {ON} weakly...   213   7e-64
TDEL0G04240 Chr7 (770798..772132) [1335 bp, 444 aa] {ON} Anc_6.4...   204   1e-60
KAFR0L00420 Chr12 (77468..78850) [1383 bp, 460 aa] {ON} Anc_6.46...   204   1e-60
NDAI0D00890 Chr4 (203085..204704) [1620 bp, 539 aa] {ON} Anc_6.4...   203   2e-59
SAKL0E01980g Chr5 complement(150830..152227) [1398 bp, 465 aa] {...   197   6e-58
KNAG0E00910 Chr5 complement(171075..172535) [1461 bp, 486 aa] {O...   189   1e-54
KLTH0C10582g Chr3 (877398..878843) [1446 bp, 481 aa] {ON} simila...   186   1e-53
CAGL0J11792g Chr10 complement(1150752..1152284) [1533 bp, 510 aa...   186   5e-53
YML043C Chr13 complement(190244..191767) [1524 bp, 507 aa] {ON} ...   184   9e-53
Smik_13.106 Chr13 complement(183859..185379) [1521 bp, 506 aa] {...   184   1e-52
Suva_13.117 Chr13 complement(186472..188013) [1542 bp, 513 aa] {...   180   4e-51
Skud_13.105 Chr13 complement(181845..183383) [1539 bp, 512 aa] {...   178   2e-50
KLLA0C05852g Chr3 (518508..519956) [1449 bp, 482 aa] {ON} weakly...   177   3e-50
TBLA0B00570 Chr2 complement(113646..115199) [1554 bp, 517 aa] {O...   166   7e-46
Kwal_56.22527 s56 complement(168165..169610) [1446 bp, 481 aa] {...   164   3e-45
ACL020W Chr3 (326268..327887) [1620 bp, 539 aa] {ON} Non-synteni...   162   2e-44
Ecym_3049 Chr3 complement(93199..94704) [1506 bp, 501 aa] {ON} s...   161   5e-44
TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543...    32   3.2  
Suva_16.96 Chr16 complement(163766..165688) [1923 bp, 640 aa] {O...    31   5.8  

>Kpol_1037.11 s1037 (23974..25179) [1206 bp, 401 aa] {ON}
           (23974..25179) [1206 nt, 402 aa]
          Length = 401

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/401 (90%), Positives = 364/401 (90%)

Query: 1   MFEVPTIDSTKRSVVNFKKLRYQYMNHMYERNRYNKNGQGLPTPVSSENEMNASEDEVSH 60
           MFEVPTIDSTKRSVVNFKKLRYQYMNHMYERNRYNKNGQGLPTPVSSENEMNASEDEVSH
Sbjct: 1   MFEVPTIDSTKRSVVNFKKLRYQYMNHMYERNRYNKNGQGLPTPVSSENEMNASEDEVSH 60

Query: 61  KRVRKRWRRIXXXXXXXXXXXXXXXXXXXXXXXXXXKKYFSRYDKPEDSFERWASNTKHR 120
           KRVRKRWRRI                          KKYFSRYDKPEDSFERWASNTKHR
Sbjct: 61  KRVRKRWRRIVGESVSSDEEEEEEEEDEQEQEGDEEKKYFSRYDKPEDSFERWASNTKHR 120

Query: 121 KSINRKMMSYKKYNKLTKYSRKKIQVPLIRSNRKLQENFLSVIDGYELIDDNINLKENFT 180
           KSINRKMMSYKKYNKLTKYSRKKIQVPLIRSNRKLQENFLSVIDGYELIDDNINLKENFT
Sbjct: 121 KSINRKMMSYKKYNKLTKYSRKKIQVPLIRSNRKLQENFLSVIDGYELIDDNINLKENFT 180

Query: 181 MVNVKLLTDLMYESIFKENWKIAYRCFTLLIRLPKTSIRKIWNLGSMIIENLEGINKTIE 240
           MVNVKLLTDLMYESIFKENWKIAYRCFTLLIRLPKTSIRKIWNLGSMIIENLEGINKTIE
Sbjct: 181 MVNVKLLTDLMYESIFKENWKIAYRCFTLLIRLPKTSIRKIWNLGSMIIENLEGINKTIE 240

Query: 241 FLKLFNNIHSRYKKKIFNQTVNYREAPVFNDGSRNKTPIYIKTLLWKEIXXXXXXXXXXX 300
           FLKLFNNIHSRYKKKIFNQTVNYREAPVFNDGSRNKTPIYIKTLLWKEI           
Sbjct: 241 FLKLFNNIHSRYKKKIFNQTVNYREAPVFNDGSRNKTPIYIKTLLWKEITTTSTSSRTSS 300

Query: 301 NYNELIEYLSELTLIPPFMEDSEIWYIYGIVHLQRANELSMNLEHYIDNSSSSKDIANNE 360
           NYNELIEYLSELTLIPPFMEDSEIWYIYGIVHLQRANELSMNLEHYIDNSSSSKDIANNE
Sbjct: 301 NYNELIEYLSELTLIPPFMEDSEIWYIYGIVHLQRANELSMNLEHYIDNSSSSKDIANNE 360

Query: 361 VVQNIKLAQKFLKKAKELSKIEVPERQITLMIKNIEGRMIH 401
           VVQNIKLAQKFLKKAKELSKIEVPERQITLMIKNIEGRMIH
Sbjct: 361 VVQNIKLAQKFLKKAKELSKIEVPERQITLMIKNIEGRMIH 401

>TPHA0J00510 Chr10 complement(114098..115411) [1314 bp, 437 aa] {ON}
           Anc_6.46 YML043C
          Length = 437

 Score =  253 bits (646), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 159/433 (36%), Positives = 238/433 (54%), Gaps = 40/433 (9%)

Query: 1   MFEVPTIDSTKRSVVNFKKLRYQYMNHM-YERNRYNKNGQGLPTPVSSENEMNA------ 53
           MFE+P   +   +  N KKLRYQY+N +  + N  +KN   LPTPV+SEN+         
Sbjct: 1   MFELPVSSNITINAFNLKKLRYQYINDINAKHNELSKNE--LPTPVTSENDTGGEDLDGD 58

Query: 54  ------SED-EVSHKRVRKRWRRIXXXX-----XXXXXXXXXXXXXXXXXXXXXXKKYFS 101
                 SED EV+ +R  +RW+ I                               KKYF 
Sbjct: 59  SEHNLTSEDAEVAQERRIRRWKSIMGEAIDDDEDDNNHDDDVDNEFEDNGPTDEEKKYFL 118

Query: 102 RYDKPEDSFERWASNT-KHRKSINRKMMSYKKYNKLTKYSRKKIQVPLIRSNRKLQENFL 160
           RYDKP++SFE+W SN  K ++ +N+  ++Y ++ K  K   KK +V  +  N+ ++ NF 
Sbjct: 119 RYDKPQESFEKWESNNLKRQRHVNKNFITYYRFKKTRKQIDKKYKVKTMHLNKNVKNNFE 178

Query: 161 SVIDGYELIDDNINLKENFTMVN-----VKLLTDLMYESIFKENWKIAYRCFTLLIRLPK 215
            +IDG+E I+DN N+  N  + N     + LLTDLMY +IFK+ W IAY+CFT L+R+P 
Sbjct: 179 LMIDGFEPINDN-NISRNRNLQNYNKHHLSLLTDLMYSNIFKQKWDIAYKCFTFLLRIPD 237

Query: 216 TSIRKIWNLGSMIIENLEGINKTIEFLKLFNNIHSRYKKKIFNQTVNYR-EAPVFNDGSR 274
             IR++WNLGS+I++N++   K I+FL+  +N++S  K + F Q +NYR +   FN GSR
Sbjct: 238 VDIRRVWNLGSIILQNIDTT-KLIDFLQWLSNVYSN-KNRSFVQGINYRNDQTNFNGGSR 295

Query: 275 NKTPIYIKTLLWKEIXXXXXXXXXXXNYNELIEYLSELTLIPPFMEDSEIWYIYGIVHLQ 334
             TP+Y KTLLW ++             + LIE ++E+ +IPP+ ED+EIWYI+ + HL 
Sbjct: 296 RLTPLYTKTLLWHKLTLSSDSETCESEIDSLIEQIAEMVVIPPYSEDNEIWYIFALCHLV 355

Query: 335 RANELSMNLEHY---------IDNSSSSKDIANNEVVQNIKLAQKFLKKAKELSKIEVPE 385
           +A+ LS  L            +D      +I NN++   I   +K+L+KA +    + P 
Sbjct: 356 KADNLSEKLYFMSRRNPEVDEMDTYPYDTEIYNNKITICINNCKKYLRKATQDKNFDYPA 415

Query: 386 RQITLMIKNIEGR 398
           R I   +K IE R
Sbjct: 416 RTIETKLKTIETR 428

>NCAS0H00900 Chr8 (167875..169362) [1488 bp, 495 aa] {ON} Anc_6.46
           YML043C
          Length = 495

 Score =  217 bits (552), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 133/415 (32%), Positives = 226/415 (54%), Gaps = 22/415 (5%)

Query: 1   MFEVPTIDSTKRSVVNFKKLRYQYMNHMYER-NRYNKNGQGLPTP---VSSENEMNASED 56
           MF++PT  S KR + N +K+RY Y+N +  + NR +     LPTP    S  +E    ++
Sbjct: 1   MFDLPTQISNKR-IANERKIRYTYINQLSRKYNRQDAESSSLPTPENSASESHESTGEDE 59

Query: 57  EVSHKRVRKRWRR-IXXXXXXXXXXXXXXXXXXXXXXXXXXKKYFSRYDKPEDSFERWAS 115
           EV  +R+++RW+  I                          +++F  ++KP++S+E W++
Sbjct: 60  EVRRRRLKRRWKNVIGEAVSDTDEDEDGEEEREDEGPENQERRFFKTHEKPQESYEIWST 119

Query: 116 NTKHRKSINRKMMSYKKYNKLTKYSRKKIQVPLIRSNRKLQENFLSVIDGYELIDDNINL 175
           +   R  + +K +S+ K NK+ K +++++Q  L+ S++     F S+  G EL+   ++ 
Sbjct: 120 DNNKRMPLQKKFISFSKLNKIEKSTKRRMQGSLLHSSKFNNICFESISQGQELVTP-LHT 178

Query: 176 KENFTMVNVKLLTDLMYESIFKENWKIAYRCFTLLIRLPKTSIRKIWNLGSMIIENLEGI 235
            E+FT+ +++ LT+L++ ++ K  W++AY+ F L++R+PK  IR IW +G  I+      
Sbjct: 179 PESFTLKHIENLTNLLHINVMKGKWEVAYKIFALMVRIPKVDIRSIWGIGVKILSQ-RAA 237

Query: 236 NKTIEFLKLFNNIHSRYKKKIFNQTVNYREAPVFNDGSRNKTPIYIKTLLWKEI---XXX 292
             T++FL   N+++S     I  Q + +R  PVF  GS+  +  +  T LWK +      
Sbjct: 238 TTTLDFLVWMNSVYSSRINYI--QGMTHRVDPVFRSGSKTHSSKFTITWLWKSLIYCTDT 295

Query: 293 XXXXXXXXNYNE--------LIEYLSELTLIPPFMEDSEIWYIYGIVHLQRANELSMNLE 344
                   +Y          LIE +SEL LIPPFMED+E+W+IY + H+ +A++LS+N  
Sbjct: 296 DNDEDIDSDYGGFGRDKLQILIEKVSELVLIPPFMEDAEVWFIYALCHMVKADQLSLNFN 355

Query: 345 HYIDNSSSSKDIANNEVVQNIKLAQKFLKKAKELSKIEVPERQITLMIKNIEGRM 399
               N  S++DIA NEV+QNI+L + FL+ A      E PER IT  +   E R+
Sbjct: 356 LNQSN-GSARDIARNEVIQNIQLVKTFLQTAMSKGHFEYPERFITRQLNTFEERL 409

>ZYRO0C07172g Chr3 (541070..542422) [1353 bp, 450 aa] {ON} weakly
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 450

 Score =  213 bits (541), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 119/411 (28%), Positives = 220/411 (53%), Gaps = 19/411 (4%)

Query: 1   MFEVPTIDSTKRSVVNFKKLRYQYMNHM---YERNRYNKNGQG-LPTPVSSENEMNASED 56
           MFE+P + ++KR+  + +KL+YQY+N++   Y+      NGQ  LPTP +S  E + +E 
Sbjct: 1   MFELPLVITSKRTRTS-RKLKYQYINNLSKKYDGINGISNGQTELPTPENSATETSENE- 58

Query: 57  EVSHKRVRKRWRRIXXXXXXXXXXXXXXXXXXXXXXXXXXKKYFSRYDKPEDSFERWASN 116
           EV  ++ R+  +R+                          +K++ +Y+KP+ +FE+W  +
Sbjct: 59  EVGQQKRRRIRKRLKSIIGESYSDLESDEEQPVEEVDNEERKFYRKYEKPQLTFEKWQCD 118

Query: 117 TKHRKSINRKMMSYKKYNKLTKYSRKKIQVPLIRSNRKLQENFLSVIDGYELIDDNINLK 176
            + R  I R  ++Y + N++ ++  ++++  L  ++R  +  F +   GY+L D      
Sbjct: 119 PRKRTPIQRNRINYNRMNRIQRHGLRRMETSLAVASRTNKTFFHATTQGYQLFDPTYGRA 178

Query: 177 ENFTMVNVKLLTDLMYESIFKENWKIAYRCFTLLIRLPKTSIRKIWNLGSMIIENLEGIN 236
             F + ++  LT L++ ++ K  W++AY+CF LLIR+P   +R +W LG  I+   +   
Sbjct: 179 NTFQLKHIGTLTSLLHINVLKRKWELAYKCFALLIRIPGVDVRTLWGLGERILAERQP-T 237

Query: 237 KTIEFLKLFNNIHSRYKKKIFNQTVNYREAPVFNDGSRNKTPIYIKTLLWKEI------- 289
           +++EFL+  ++++S   K  F   VNYR APVF  GS+  TP Y  T LW+ +       
Sbjct: 238 RSLEFLQWMSSVYS--TKLPFADDVNYRMAPVFTKGSKTHTPKYTTTWLWECLIRYANGL 295

Query: 290 -XXXXXXXXXXXNYNELIEYLSELTLIPPFMEDSEIWYIYGIVHLQRANELSMNLEHYID 348
                       N+  L++ +SE+ L PP+M+D E+W+IY + H+ +A+ LS   +  + 
Sbjct: 296 EDLEMDSKSAAENFQSLMDRISEMVLGPPYMDDPEVWFIYALCHMVKADTLSQQFDPRL- 354

Query: 349 NSSSSKDIANNEVVQNIKLAQKFLKKAKELSKIEVPERQITLMIKNIEGRM 399
            + S++DIA+N+V+Q+I+  +  L++         P+R I   +   E R+
Sbjct: 355 -TGSARDIASNQVIQHIQNTKSHLQQCSSKGGFTFPKRYIARQLAAFEARL 404

>TDEL0G04240 Chr7 (770798..772132) [1335 bp, 444 aa] {ON} Anc_6.46
           YML043C
          Length = 444

 Score =  204 bits (518), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 123/417 (29%), Positives = 219/417 (52%), Gaps = 24/417 (5%)

Query: 1   MFEVPTIDSTKRSVVNFKKLRYQYMNHMYER-NRYNK--NGQGLPTPVSSENEMNASEDE 57
           MFE P   +T+R + N KKLRYQY+N++  + NR  +  N  GLPTP +S  E + +E+ 
Sbjct: 1   MFEQPVALTTRR-LRNAKKLRYQYVNNLSAKFNRLERITNTNGLPTPENSAAESSENEEA 59

Query: 58  VSHKRVRKRWRRIXXXXXXXXXXXXXXXX------XXXXXXXXXXKKYFSRYDKPEDSFE 111
           +  K+ R R R                                  +K+ + Y+ P++SFE
Sbjct: 60  LQRKKKRIRRRLKSAAGESYSDSESDEVDNNHDNEVVEDEEEDQERKFLNNYELPQESFE 119

Query: 112 RWASNTKHRKSINRKMMSYKKYNKLTKYSRKKIQVPLIRSNRKLQENFLSVIDGYELIDD 171
           +W  +   R  I R  +S+ KY +L +++++K+   +  ++++ +    ++ +G+E++D 
Sbjct: 120 KWQDDPSKRVPIQRSKISFTKYQRLRRHAKRKMNTSIDLASKRNKIYMDTISEGFEMVDP 179

Query: 172 NINLKENFTMVNVKLLTDLMYESIFKENWKIAYRCFTLLIRLPKTSIRKIWNLGSMIIEN 231
                + F M ++ +LT L++  + +  W  AY CF LLIR+PK  IR IW +G +I+  
Sbjct: 180 VDGKPDTFQMKHISILTTLLHLHVSRREWDAAYTCFALLIRVPKVDIRNIWGIGDLILRE 239

Query: 232 LEGINKTIEFLKLFNNIHSRYKKKIFNQTVNYREAPVFNDGSRNKTPIYIKTLLWKEIXX 291
            E I K++EFL   ++++S   +  F + VN+R  PVF  GS+   P +  T +W+ +  
Sbjct: 240 REPI-KSLEFLSWMSSVYS--SRSAFAEDVNHRTPPVFTKGSKTHVPKFATTWMWESLIQ 296

Query: 292 XXXXXXXX---------XNYNELIEYLSELTLIPPFMEDSEIWYIYGIVHLQRANELSMN 342
                                +LIE +SE+ L PP+M+ SE+W+IYG+ HL +A+ LS  
Sbjct: 297 CTKNSLETGELEQIESNDGLQDLIERISEMVLAPPYMDASEVWFIYGLCHLIKADILSNQ 356

Query: 343 LEHYIDNSSSSKDIANNEVVQNIKLAQKFLKKAKELSKIEVPERQITLMIKNIEGRM 399
            +  +  + S++DIA+N+V+Q+I+  +  L+        + P+R I   ++  E R+
Sbjct: 357 FDGRL--AGSARDIASNQVIQHIQRTKSCLQTCLSKGDFKYPKRYIERQLEEFEKRL 411

>KAFR0L00420 Chr12 (77468..78850) [1383 bp, 460 aa] {ON} Anc_6.46
           YML043C
          Length = 460

 Score =  204 bits (519), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 125/413 (30%), Positives = 224/413 (54%), Gaps = 29/413 (7%)

Query: 1   MFEVPTIDSTKRSVVNFKKLRYQYMNHMYERNRYNKNGQGLPTPVSSENEMNASEDEVSH 60
           MFE+P ++   +++ N +KLRY+Y+N    R     +  G+ TP +SE+E+         
Sbjct: 1   MFEIP-VNVNSKTLSNERKLRYRYINQFTRRFERKDDRNGMITPETSEDEL--------Q 51

Query: 61  KRVRKRWRRIXXXXXXXXXXXXXXXXXXXXXXXX----------XXKKYFSRYDKPEDSF 110
           +R ++ W  +                                    +K+F + DKP++++
Sbjct: 52  QRKKRDWLHVIGEYGSDDDERSGGQQDDEEEEEEVIDEDYNLNNEERKFFKKIDKPQETY 111

Query: 111 ERWASNTKHRKSINRKMMSYKKYNKLTKYSRKKIQVPLIRSNRKLQENFLSVIDGYELID 170
           E W S+ K +  I R +++Y +YNK+++Y  +K+   L+  + K + +F   IDG E+++
Sbjct: 112 EHWPSHRK-KTRIQRDILTYHRYNKVSRYVERKMANSLVHVSSKNRYHFKCKIDGMEIVE 170

Query: 171 DNINLKENFTMVNVKLLTDLMYESIFKENWKIAYRCFTLLIRLPKTSIRKIWNLGSMIIE 230
                  NF +  ++ LT+L+Y ++ + NW+IAY+ F +LIR+PK  IR +WN+G+ I+ 
Sbjct: 171 PLHKGATNFQLKQIETLTNLLYLNVNRGNWEIAYKIFAMLIRIPKVDIRSVWNVGNRILY 230

Query: 231 NLEGINKTIEFLKLFNNIHSRYKKKIFNQTVNYREAPVFNDGSRNKTPIYIKTLLWKEIX 290
             + + +++EFL+  ++++S   +  F Q +NYR  PVF  GS+N TP Y    LW  + 
Sbjct: 231 EKDKL-RSLEFLEWMSSVYS--TRVTFIQGINYRFDPVFRSGSKNHTPKYTLQWLWNSLL 287

Query: 291 XXXXX--XXXXXNYNELIEYLSELTLIPPFMEDSEIWYIYGIVHLQRANELSMNLEHYID 348
                       N ++LI+ ++E+ LIPPFM+D EIW+IY + H+ +A+ LS   + +  
Sbjct: 288 EYTEQLFENDDENIDKLIDKIAEMVLIPPFMDDPEIWFIYSMCHMVKADFLSSKFDTH-- 345

Query: 349 NSSSSKDIANNEVVQNIKLAQKFLKKAKELS--KIEVPERQITLMIKNIEGRM 399
           +  S +DI+ N+V+Q+I   +++L   KE S  + E  E  IT  +K  E R+
Sbjct: 346 SVGSMRDISMNQVIQHINDVKRYLNVCKEKSQGQYESNEMIITKQLKAFEVRL 398

>NDAI0D00890 Chr4 (203085..204704) [1620 bp, 539 aa] {ON} Anc_6.46
           YML043C
          Length = 539

 Score =  203 bits (517), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 117/328 (35%), Positives = 184/328 (56%), Gaps = 30/328 (9%)

Query: 97  KKYFSRYDKPEDSFERWASNTKHRKSINRKMMSYKKYNKLTKYSRKKIQVPLIRSNRKLQ 156
           +K+F +Y+KP+++FE W +N   R  IN+ M++Y K  K+ K +++KI VPL+ +++  +
Sbjct: 128 RKFFKKYEKPQETFEIWQTNNLKRVPINKSMITYTKLKKIEKQAKRKITVPLLHASKINK 187

Query: 157 ENFLSVIDGYELIDDNINLKENFTMVNVKLLTDLMYESIFKENWKIAYRCFTLLIRLPKT 216
             F ++ +G EL+   + + ENF++ +++ LT L+Y ++ +ENW IAYR FTLLIR+ K 
Sbjct: 188 LCFEAMSEGLELVTPLVTI-ENFSLQHIEKLTTLLYLNVSRENWDIAYRIFTLLIRIKKL 246

Query: 217 SIRKIWNLGSMIIENLEGINKTIEFLKLFNNIHSRYKKKIFNQTVNYREAPVFNDGSRNK 276
            IR IW +G  I+   +   KT++FL   N+++S   +  F Q +NYR  PVF  GSR  
Sbjct: 247 DIRSIWGIGVRILSE-KSPTKTLDFLNWMNSVYS--SRLNFIQGINYRMDPVFKSGSRTH 303

Query: 277 TPIYIKTLLWKEIXXXXXXXXXXXNYN-------------------------ELIEYLSE 311
           TP Y  T LWK +           N N                         +LIE +SE
Sbjct: 304 TPKYTLTWLWKSLIQYSTKKIISGNNNSNESLEDGSSSELDIDINIDRNNLLDLIEKISE 363

Query: 312 LTLIPPFMEDSEIWYIYGIVHLQRANELSMNLEHYIDNSSSSKDIANNEVVQNIKLAQKF 371
           + LIPPFMEDSE+W+IY + H+  A++LS      I N S   DI  N+V+Q+I+  + +
Sbjct: 364 MVLIPPFMEDSEVWFIYSLCHMVLADDLSSKFNPLISNGSRG-DIERNQVIQHIQKTKSY 422

Query: 372 LKKAKELSKIEVPERQITLMIKNIEGRM 399
           L+ +      E PE+ I   +   E R+
Sbjct: 423 LQTSMNKGDFEYPEKYILKQLSIYEQRL 450

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 9/58 (15%)

Query: 1  MFEVPTIDSTKRSVVNFKKLRYQYMNHMYERNRYNKNGQG--------LPTPVSSENE 50
          MFE+P I + KR+    +K+RY Y+N + ++    +N           LPTP SS  E
Sbjct: 1  MFELPIIYNNKRTATE-RKIRYTYINQLSKKYNRTQNRHNNNNNNNGILPTPESSATE 57

>SAKL0E01980g Chr5 complement(150830..152227) [1398 bp, 465 aa] {ON}
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 465

 Score =  197 bits (502), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 125/418 (29%), Positives = 227/418 (54%), Gaps = 28/418 (6%)

Query: 1   MFEVPTIDSTKRSVVNFKKLRYQYMNHM---YERNRYNKNGQGLPTPVSSE------NEM 51
           MFE+P + + K+ + + +KLRYQY+N +   +E+    K   GLPTP SS       +E+
Sbjct: 1   MFELPVVRTNKK-IRSKRKLRYQYINTLNKKHEQLNPKKQTVGLPTPESSAAETSDTDEL 59

Query: 52  NASEDEVSHKRVRKRWRRIXXXXXXXXXXXXXXXXXXXXXXXXXXKKYF-SRYDKPEDSF 110
             S+ + + +R R+    +                          +K+  ++Y KP++++
Sbjct: 60  EDSQSKRTKRRKRRLQSILGHAVSSSDEDDISEEENDNDYEECDYEKHVKNKYYKPQETY 119

Query: 111 ERWASNTKHRKSINRKMMSYKKYNKLTKYSRKKIQVPLIRSNRKLQENFLSVIDGYELID 170
           E W +  ++R  +N   M+YK+Y K+ K + +++   L  S++     F ++ +GYE  +
Sbjct: 120 ELWTTGPENRVPLNTTSMTYKQYKKIHKAAHRRVTRTLSYSSKNSAAFFSAIYNGYEPYE 179

Query: 171 DNINLKENFTMVNVKLLTDLMYESIFKENWKIAYRCFTLLIRLPKTSIRKIWNLGSMIIE 230
              +  EN+   +++ LT+L++ ++ ++NW+IAYRCF++LIRLP   IR IW +G  I++
Sbjct: 180 --TSQLENYQTTHIRNLTNLLHVNVMEQNWEIAYRCFSILIRLPGVDIRSIWGIGVRILK 237

Query: 231 NLEGINKTIEFLKLFNNIHSRYKKKIFNQTVNYREAPVFNDGSRNKTPIYIKTLLWKEIX 290
            ++   ++ EFL+  +++ S   K  FNQ  N+   PVF  GS+  TP ++ + LW+ + 
Sbjct: 238 EIDR-KRSEEFLEWMSSVFS--TKNNFNQGTNHAMDPVFRSGSKTHTPKFVTSWLWETLM 294

Query: 291 XXXXXXXXXXNYNE-----LIEYLSELTLIPPFMEDSEIWYIYGIVHLQRANELSMNLEH 345
                     N +      L E +SEL L PP+M+D +IW+IY + H+  A+ LS   + 
Sbjct: 295 GCTSKDENNGNRDVNKLQFLTEKISELVLTPPYMDDPKIWFIYALCHIVEADHLS---QQ 351

Query: 346 YIDN----SSSSKDIANNEVVQNIKLAQKFLKKAKELSKIEVPERQITLMIKNIEGRM 399
           +I+N    + S +DIA N+V+Q+I  A+ FL+  +E    + P++ I   + N E R+
Sbjct: 352 FIENEHIKNGSRRDIARNQVIQHITNAKNFLQTCQEKGGFQFPKQHIEKQLSNFENRL 409

>KNAG0E00910 Chr5 complement(171075..172535) [1461 bp, 486 aa] {ON}
           Anc_6.46 YML043C
          Length = 486

 Score =  189 bits (481), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 143/438 (32%), Positives = 219/438 (50%), Gaps = 49/438 (11%)

Query: 1   MFEVPTI---DSTKRSVVNFKKLRYQYMNHM---YERNR-YNKNGQGLPTPVSSENEMNA 53
           MFE+P +    S  +S+V  KKLRY+Y N +   Y+R + +++NGQ   TP SS  E++ 
Sbjct: 1   MFELPVLLGSFSESQSLVR-KKLRYRYRNEIKNQYKRIKIHDENGQL--TPESSHTELD- 56

Query: 54  SEDEVSHKRV-RKRWRRI-----------XXXXXXXXXXXXXXXXXXXXXXXXXXKKYFS 101
             D  S  RV R R RR+                                     +KYF 
Sbjct: 57  --DHESRSRVCRGRKRRLYDLRDREEHGFESDSSEAQDEVGDLPEKEEEEIGHEERKYFK 114

Query: 102 RYDKPEDSFERWASNTKHRK-SINRKMMSYKKYNKLTKYSRKKIQVPLIRSNRKLQENFL 160
            ++KPED +E W   T+ RK  I R+ +SY +   + + +++K++VPL+  +R     F 
Sbjct: 115 NHEKPEDLYEVWHVATERRKVPIQRQFVSYNRLQTIERRAKRKMEVPLLHVSRVRSSEFS 174

Query: 161 SVIDGYELIDDNINLKENFTMVNVKLLTDLMYESIFKENWKIAYRCFTLLIRLPKTSIRK 220
           + IDGY+++    +   +F   +++LL  L++  I  ENW +AY+ F LLIR+P+  IR 
Sbjct: 175 AEIDGYDVVSRG-DETTHFENKHIQLLVTLLHRHISTENWNLAYKVFALLIRMPRVDIRA 233

Query: 221 IWNLGSMIIENLEGINKTIEFLKLFNNIHSRYKKKIFNQTVNYREAPVFNDGSRNKTPIY 280
           +WNLG  I+   +     I+FL+  ++++S   K  F Q VN+R  P F  GSR  T  Y
Sbjct: 234 VWNLGVAILARRDSTT-AIDFLEWMHSVYS--NKHRFIQNVNHRLPPAFRSGSRTHTAQY 290

Query: 281 IKTLLWKEIXXXXXXXXXXXNYN-ELIEYL----SELTLIPPFMEDSEIWYIYGIVHLQR 335
             T LW  +               E +E L    SEL L PP+M+DSE+W+IY   +  +
Sbjct: 291 TTTWLWLSLRAATEQAQEGAPTTLEPLELLTDKTSELLLTPPYMDDSEVWFIYCSCYFVK 350

Query: 336 ANELSMNLEHYIDN-----SSSSKDIANNEVVQNIKLAQKFLKKAKELSKI--------- 381
           A+ LS N+   + +     SSS+ D+  NEVVQ+I   QK L  A+E S           
Sbjct: 351 ADILSRNIHSDLTHNVHAFSSSTMDLRRNEVVQSITRCQKTLHTAEEKSDQARHRAHAYW 410

Query: 382 EVPERQITLMIKNIEGRM 399
           E+P   I   ++ IE R+
Sbjct: 411 ELPTGYIKRQLQQIEKRL 428

>KLTH0C10582g Chr3 (877398..878843) [1446 bp, 481 aa] {ON} similar
           to uniprot|Q04712 Saccharomyces cerevisiae YML043C RRN11
           rDNA transcription factor CF component which also
           contains Rrn6p and Rrn7p which is required for rDNA
           transcription by RNA polymerase I component of rDNA
           transcription factor
          Length = 481

 Score =  186 bits (473), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 121/425 (28%), Positives = 208/425 (48%), Gaps = 32/425 (7%)

Query: 1   MFEVPTIDSTKRSVVNFKKLRYQYMNHMYERNR----YNKNGQGLPTPVSSENEMNASED 56
           MFE+P + +TKR V   +KLRYQY+N +Y+  R    +      LPTP +S  E  +  D
Sbjct: 1   MFELPLVRNTKR-VRTVRKLRYQYINTLYQEYRKVQSFANANSTLPTPENSAAEEASDGD 59

Query: 57  EVSHKRVRKRWRRI--------XXXXXXXXXXXXXXXXXXXXXXXXXXKKYFSRYDKPED 108
             S     +R RR                                   K++F+R++KP++
Sbjct: 60  HNSADATSRRRRRKRRLLSVLGHAETDTELSDMEAEEGSHEADQADSEKEFFTRHEKPQE 119

Query: 109 SFERWASNTKHRKSINRKMMSYKKYNKLTKYSRKKIQVPLIRSNRKLQENFLSVIDGYEL 168
           +FE W ++ +    +N   +SY    ++ K+++K++   +   ++    +F ++ DGYE 
Sbjct: 120 TFEVWNTDRQKAVPMNTATLSYDTCKQIEKHAQKRVSAGMAHISKNANFHFQAMKDGYET 179

Query: 169 IDDNINLKENFTMVNVKLLTDLMYESIFKENWKIAYRCFTLLIRLPKTSIRKIWNLGSMI 228
           + +     E+  +V++  L +L++ +I K  W  AYRCF+LLIRLP   IR +W  G+ I
Sbjct: 180 VAET---PESHHLVHIAQLNELLHTNIMKGKWDTAYRCFSLLIRLPGIDIRSVWGPGARI 236

Query: 229 IENL----EGINKTIEFLKLFNNIHSRYKKKIFNQTVNYREAPVFNDGSRNKTPIYIKTL 284
           +  L    +G+  + EFL   + I S   +  FNQT+N+   PVF  GS+     ++   
Sbjct: 237 LRELASNDKGLGTSEEFLGWLSGIFS--SRSNFNQTMNFLMDPVFRCGSKTHAAKFVVAW 294

Query: 285 LWKEIXXXXXXXXXXXNYNE--------LIEYLSELTLIPPFMEDSEIWYIYGIVHLQRA 336
           LW+ +           +  +        L+E LSE+ LIPP+MED E+W+I+ + HL  A
Sbjct: 295 LWELLFASCPDGTEHPSAEDASNRKLSHLLERLSEMVLIPPYMEDPEVWFIFAVCHLVSA 354

Query: 337 NELSMN-LEHYIDNSSSSKDIANNEVVQNIKLAQKFLKKAK-ELSKIEVPERQITLMIKN 394
           ++LS   +   +  S   +DI+ N+V Q+I  A   ++  + +  +   P R I   +  
Sbjct: 355 DQLSQRFISTKLRTSELERDISRNQVTQHITNAHMCIRTCEAKKEEFSFPRRIIEEQLAC 414

Query: 395 IEGRM 399
            E R+
Sbjct: 415 FEKRL 419

>CAGL0J11792g Chr10 complement(1150752..1152284) [1533 bp, 510 aa]
           {ON} similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043c RRN11 RNA polymerase I specific transcription
           initiation factor
          Length = 510

 Score =  186 bits (471), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 122/440 (27%), Positives = 223/440 (50%), Gaps = 48/440 (10%)

Query: 1   MFEVPTIDSTKRSVVNFKKLRYQYMN------HMYERNRYNKNGQGLPTPVSSENEMNAS 54
           MFEVP   + +R  V  +++RYQY+N      H   R++  +    LPTP +S  E + S
Sbjct: 1   MFEVPITYNCRRLNVE-RRVRYQYINILSRKYHAKRRSKRRRQANSLPTPENSAVENDQS 59

Query: 55  EDEV-SHKRVRKRWRRIXXXXXXXXXXXXXXXXXXXXXXXXXX-------KKYFSRYDKP 106
           E ++ S ++++++  ++                                 K ++ +Y+KP
Sbjct: 60  ESQLPSREQIKEKKMKLGEDYSDSEAETSSEGEDTTKDDNEFANDMNKFEKLFYRKYEKP 119

Query: 107 EDSFERW----ASNTKHRKSINRKMMSYKKYNKLTKYSRKKIQVPLIRSNRKLQENFLSV 162
           E SFE W    + NTK +  + +  + Y + N++ + ++K+++  ++      +  F   
Sbjct: 120 EHSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEKNVVHMPLVNKRYFDIK 179

Query: 163 IDGYELIDDNINLKENFTMVNVKLLTDLMYESIFKENWKIAYRCFTLLIRLPKTSIRKIW 222
            +GYE+++  +++ +++ + ++++LT +++ S+ + NW IAYR F+LLIR+P+  IR IW
Sbjct: 180 SEGYEVLEPLVDI-DSYLLKHIEILTQILFSSVSQGNWDIAYRTFSLLIRIPEVDIRNIW 238

Query: 223 NLGSMIIENLEGINKTIEFLKLFNNIHSRYKKKIFNQTVNYREAPVFNDGSRNKTPIYIK 282
            LG+ I+       +++EFLK  + ++S   K+ F Q+  +R+APVF  GSR  TP Y  
Sbjct: 239 GLGTRILMERGQTTRSLEFLKWMSTVYS--SKQNFVQSHCHRKAPVFRSGSRTHTPKYAL 296

Query: 283 TLLW---------------------KEIXXXXXXXXXXXNYNELIEYLSELTLIPPFMED 321
           T LW                     +E               ELI+ +SE+ L+PP+++D
Sbjct: 297 TWLWNCLIKVTELISIEEEKGVNTNEEENDNGSKQSAMDKLTELIDKISEMVLVPPYLDD 356

Query: 322 SEIWYIYGIVHLQRANELS--MNLEHYIDNSSSSKDIANNEVVQNIKLAQKFLKKAKELS 379
            EIW+IY + H+  A+ LS   N +     S S +DIA N+V Q+I   + +L+   +  
Sbjct: 357 PEIWFIYSMCHMVHADYLSGKFNCQRL---SGSRRDIARNQVTQHIHYVKTYLQNCSQKG 413

Query: 380 KIEVPERQITLMIKNIEGRM 399
             E P++ I   ++  E RM
Sbjct: 414 NFEYPKQFIQSRLEEFEKRM 433

>YML043C Chr13 complement(190244..191767) [1524 bp, 507 aa] {ON}
           RRN11Component of the core factor (CF) rDNA
           transcription factor complex; CF is required for
           transcription of 35S rRNA genes by RNA polymerase I and
           is composed of Rrn6p, Rrn7p, and Rrn11p
          Length = 507

 Score =  184 bits (468), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 130/447 (29%), Positives = 216/447 (48%), Gaps = 53/447 (11%)

Query: 1   MFEVPTIDSTKRSVVNFKKLRYQYMNHMYER-NRYNKNG---QGLPTPVSSENEMNASED 56
           MFEVP I  T R     +KL+YQY+N++  R +R +K       LPTP +S  E N  E+
Sbjct: 1   MFEVP-ITLTNRKFAQRRKLKYQYINYISRRFDRISKKSTTTDSLPTPENSAAENNDEEE 59

Query: 57  -----------EVSHKRVRKR---WRRIXXXXXXXXXXXXXXX-----------XXXXXX 91
                       V  ++ R+R   WR +                                
Sbjct: 60  GQNSEAGTYRRSVLQQKKRRRERHWRSVVGEIYSTTESETDSQEEETEEGGEHDTGIDKE 119

Query: 92  XXXXXKKYFSRYDKPEDSFERWAS-NTKHRKSINRKMMSYKKYNKLTKYSRKKIQVPLIR 150
                +K++ +Y+KPE SFE W + ++++++ IN++ M+Y  + K+ K   +K+++PL+ 
Sbjct: 120 DSDEERKFWKKYEKPEKSFEIWRTVSSQNKQPINKQKMTYHNFKKIEKIPLRKMEIPLLH 179

Query: 151 SNRKLQENFLSVIDGYELIDDNINLKENFTMVNVKLLTDLMYESIFKENWKIAYRCFTLL 210
             ++ +  F S+  G E +  + +   N+   ++  LTDL++ ++ + NW +AY+ F  L
Sbjct: 180 CTKENKLYFQSISRGLEPLKTSTSEVRNYRTRHIVTLTDLLHLNVSRHNWSLAYKIFATL 239

Query: 211 IRLPKTSIRKIWNLGSMIIENLEGINKTIEFLKLFNNIHSRYKKKIFNQTVNYRE-APVF 269
           IR+P   I+ +W +G  I++NL   +  ++FL+    I+S   K  F Q +NYR   P F
Sbjct: 240 IRIPGVQIKSLWGIGVEILDNLSNSSSGLDFLQWMCQIYS--SKSRFVQNINYRSIVPPF 297

Query: 270 NDGSRNKTPIYIKTLLWKEIXXXXXXXXXXXN------------YNELIEYLSELTLIPP 317
             GSR  T  +  T LW  +           N              ELI+ +SE  L PP
Sbjct: 298 QTGSRTHTAKFAITYLWSSLINCQKSMEPSSNIIDKPFDTENDLLQELIDKISEWVLTPP 357

Query: 318 FMEDSEIWYIYGIVHLQRANELSMNLEHYIDNSSS-----SKDIANNEVVQNIKLAQKFL 372
           FMED+E+W+IY   HL +A+ LS    +  DN ++      +DI  N+V+++I   + FL
Sbjct: 358 FMEDAEVWFIYASCHLLKADTLSRQFVN--DNKNNDLIGLDRDIKINQVIKHIHYVRTFL 415

Query: 373 KKAKELSKIEVPERQITLMIKNIEGRM 399
           K   +     VP R I   +K+ E R+
Sbjct: 416 KICLDKGGFAVPSRLIENQLKSFESRL 442

>Smik_13.106 Chr13 complement(183859..185379) [1521 bp, 506 aa] {ON}
           YML043C (REAL)
          Length = 506

 Score =  184 bits (468), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 129/446 (28%), Positives = 213/446 (47%), Gaps = 52/446 (11%)

Query: 1   MFEVPTIDSTKRSVVNFKKLRYQYMNHMYER----NRYNKNGQGLPTPVSSENEMNASED 56
           MFEVP I  T +     +KL+YQY+NH   R     + +     LPTP +S  E N  +D
Sbjct: 1   MFEVP-ITLTNKKFAQRRKLKYQYINHTSRRFEKIVKKSTTALSLPTPENSAAENNEEDD 59

Query: 57  E------------VSHKRVRKR---WRRIXXXXXXXXXXXXXXXXXXXXXXXX------- 94
                        +  +R R+R   W+ +                               
Sbjct: 60  GERNGEGGAYRRLILQQRKRRRERHWKSVVGEIYSSTETESDSQEDAEEDEECNTEGKEE 119

Query: 95  ---XXKKYFSRYDKPEDSFERWASNTKHRKS-INRKMMSYKKYNKLTKYSRKKIQVPLIR 150
                +K++ +Y+KPE+SFE W + +   KS IN++ M+Y  + K+ K S +K++VPL+ 
Sbjct: 120 DIDEERKFWKKYEKPEESFEVWRTVSSQNKSPINKQKMTYHTFKKIEKNSLRKMEVPLLH 179

Query: 151 SNRKLQENFLSVIDGYELIDDNINLKENFTMVNVKLLTDLMYESIFKENWKIAYRCFTLL 210
             ++ + +F S+  G E +  + +   N+   ++  LT+L++ ++ + NW +AY+ F  L
Sbjct: 180 CTKESKLHFQSLSKGLEPLQPSTSEVRNYRTKHIITLTNLLHLNVSRHNWSLAYKIFATL 239

Query: 211 IRLPKTSIRKIWNLGSMIIENLEGINKTIEFLKLFNNIHSRYKKKIFNQTVNYRE-APVF 269
           IR+P   I+ IW +G  I+ N   ++ +++FL+    I+S   K  F Q+ NYR   P F
Sbjct: 240 IRIPGVQIKSIWGIGVEILNNSPNLSTSLDFLQWMCQIYS--SKLRFVQSTNYRSIVPPF 297

Query: 270 NDGSRNKTPIYIKTLLWKEIXXXXXXXX----XXXNYN-------ELIEYLSELTLIPPF 318
             GSR  T  +  T LW  +                Y+       +LI+ +SE  L PPF
Sbjct: 298 QTGSRTHTSKFATTYLWSSLITCQKSMELPDINDKRYDMENDLLQDLIDRISEWVLTPPF 357

Query: 319 MEDSEIWYIYGIVHLQRANELSMNLEHYIDNSSS-----SKDIANNEVVQNIKLAQKFLK 373
           MED+E+W+IY   HL +A+ LS    +  DN +S      +DI  N+V+++I   + FL+
Sbjct: 358 MEDAEVWFIYASCHLLKADILSRQFAN--DNKTSDLIGLDRDIKINQVIKHIHYVKVFLQ 415

Query: 374 KAKELSKIEVPERQITLMIKNIEGRM 399
              +     VP R I   +K  E R+
Sbjct: 416 TCSDKGGFTVPNRLIESQLKGFESRL 441

>Suva_13.117 Chr13 complement(186472..188013) [1542 bp, 513 aa] {ON}
           YML043C (REAL)
          Length = 513

 Score =  180 bits (457), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 129/451 (28%), Positives = 212/451 (47%), Gaps = 55/451 (12%)

Query: 1   MFEVPTIDSTKRSVVNFKKLRYQYMNHMYER-NRYNKNG---QGLPTPVSSEN------- 49
           MFEVP I  T +     +KL+YQY+NH+  R +R  K       LPTP +S         
Sbjct: 1   MFEVP-ITLTNKKFAQRRKLKYQYINHISRRFDRITKKSNTTDSLPTPENSAAENNDEDY 59

Query: 50  ---------EMNASEDEVSHKRVRKR---WRRIXXXXXXXXXXXXXXXXXXXXX------ 91
                    E +A E  +  +  R+R   W+ +                           
Sbjct: 60  DDDEEERNYESDAGESSIRQQTKRRRERHWKSVIGELYSSTETESDSQEEDDQEGDQVEH 119

Query: 92  -------XXXXXKKYFSRYDKPEDSFERWASNTKHRKS-INRKMMSYKKYNKLTKYSRKK 143
                       +K++ +Y+KPE SFE W + + H KS IN++ ++Y  Y K+ K S +K
Sbjct: 120 ETRLKEEDTDEERKFWKKYEKPEKSFEVWQTVSSHNKSPINKQKITYHNYKKIEKNSLRK 179

Query: 144 IQVPLIRSNRKLQENFLSVIDGYELIDDNINLKENFTMVNVKLLTDLMYESIFKENWKIA 203
           +++PL+   ++ +  F  +  G E +    +   N+   ++  LT+L++ ++ + NW +A
Sbjct: 180 MEIPLLHCTKENKLYFQLLAKGLEPLQSPTSAARNYQTRHIITLTNLLHLNVSRHNWPLA 239

Query: 204 YRCFTLLIRLPKTSIRKIWNLGSMIIENLEGINKTIEFLKLFNNIHSRYKKKIFNQTVNY 263
           Y+ F  LIR+P   I+ IW +G  I++N   ++ +++FL+    ++S   K  F Q VNY
Sbjct: 240 YKIFATLIRIPNVQIKSIWGIGVKILDNSPNLSSSLDFLQWMCQVYS--SKSRFVQNVNY 297

Query: 264 RE-APVFNDGSRNKTPIYIKTLLWKEIXXXXXXXXXXXNYN-----------ELIEYLSE 311
           R   P F  GSR  T  +  T LW  +             +           ELI+ +SE
Sbjct: 298 RSVVPPFQTGSRTHTSKFAITYLWSCLISCQKSIESSNATDNQYDMENSRLEELIDQISE 357

Query: 312 LTLIPPFMEDSEIWYIYGIVHLQRANELS---MNLEHYIDNSSSSKDIANNEVVQNIKLA 368
             LIPPFMED+E+++IY   HL +A+ LS   +N     D    +KDI  N+V++NI   
Sbjct: 358 WVLIPPFMEDAEVYFIYASCHLLKADLLSRQFVNDNRNNDLVGLNKDIKINQVIKNIHYV 417

Query: 369 QKFLKKAKELSKIEVPERQITLMIKNIEGRM 399
           + FL+   +     +P R I   +K+ E R+
Sbjct: 418 KVFLQTCLDKGGFTIPNRLIENQLKSFESRL 448

>Skud_13.105 Chr13 complement(181845..183383) [1539 bp, 512 aa] {ON}
           YML043C (REAL)
          Length = 512

 Score =  178 bits (452), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 123/453 (27%), Positives = 214/453 (47%), Gaps = 60/453 (13%)

Query: 1   MFEVPTIDSTKRSVVNFKKLRYQYMNHMYER----NRYNKNGQGLPTPVSSE-------- 48
           MFEVP I  T +     +KL+YQY+NH+  R     +       LPTP +S         
Sbjct: 1   MFEVP-ITLTNKKFAQRRKLKYQYINHLSRRFDKVAKTTNTTDSLPTPENSAVENNDDDY 59

Query: 49  ---------NEMNASEDEVSHKRVRKR---WRRIXXXXXXXXXXXXXXXXXXXXX----- 91
                    +E +     +  +  R+R   W+ +                          
Sbjct: 60  DYDEDEEQIDEADVYRRSILQQTKRRRERHWKSVVGELYSSTETESDSQQEEIQENDGRE 119

Query: 92  ------XXXXXKKYFSRYDKPEDSFERWASNT-KHRKSINRKMMSYKKYNKLTKYSRKKI 144
                      +K++ +++KPE SFE W + + +++  INR+ M+Y K+ K+ K S +K+
Sbjct: 120 TGRKNGDTDEERKFWKKHEKPERSFEIWQTASLQNKGPINRRKMTYHKFQKIQKNSLRKV 179

Query: 145 QVPLIRSNRKLQENFLSVIDGYELIDDNINLKENFTMVNVKLLTDLMYESIFKENWKIAY 204
           Q+PL+   ++ +  F S+  G E +    +   N+   ++  LT+L++ ++ + NW +AY
Sbjct: 180 QIPLLHCTKENRLYFRSLSKGLEPLQTPTSTIRNYQTRHIITLTNLLHINVSRHNWSLAY 239

Query: 205 RCFTLLIRLPKTSIRKIWNLGSMIIENLEGINKTIEFLKLFNNIHSRYKKKIFNQTVNYR 264
           R F  LIR+P+  ++ IW  G  I++NL   + +++FL+    I+S   K  F Q +N+R
Sbjct: 240 RIFATLIRIPEVQMKSIWGFGVKILDNLPDSSSSLDFLQWMCQIYS--SKARFVQNINHR 297

Query: 265 E-APVFNDGSRNKTPIYIKTLLWKEIXXXXXXXXXXX----NYN-------ELIEYLSEL 312
              P F  GSR  T  +  T LW  +               +Y+       ELI+ +SE 
Sbjct: 298 SIVPPFQTGSRTHTAKFATTYLWASLINCQKSIEPSTINDKHYDMENDRLQELIDKISEW 357

Query: 313 TLIPPFMEDSEIWYIYGIVHLQRANELSMNLEHYIDNSSSS------KDIANNEVVQNIK 366
            L PPFMED+E+W+IY   HL +A+ LS     ++++ +        +DI  N+V+++I 
Sbjct: 358 VLTPPFMEDAEVWFIYASCHLLKADILS---RQFVNDGTKGDLIGLDRDIKINQVIKHIH 414

Query: 367 LAQKFLKKAKELSKIEVPERQITLMIKNIEGRM 399
             + FL+   +     +P R I + +KN E R+
Sbjct: 415 YVKVFLQTCLDKGGFTIPNRLIEIQLKNFELRL 447

>KLLA0C05852g Chr3 (518508..519956) [1449 bp, 482 aa] {ON} weakly
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 482

 Score =  177 bits (450), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 131/416 (31%), Positives = 205/416 (49%), Gaps = 28/416 (6%)

Query: 1   MFEVPTIDSTKRSVVNFKKLRYQYMNHM---YERNRYNKN-----------GQGLPTPVS 46
           MF++P ID + R+    +K+RYQY+N +   Y++  YN++             G+ TP +
Sbjct: 1   MFQLPVIDRSSRNRKR-RKIRYQYINSLKRKYDQLNYNQSEASVSSEADNVTNGILTPEN 59

Query: 47  SEN-EMNASEDEVSHKRVRKRWRRIXXXXXXXXXXXXXXXXXXXXXXXXXXKKYFSRYDK 105
           SE+ E  A++ E  H+R  KR  +                            +++  + K
Sbjct: 60  SESSEAEAADLEKKHRR--KRRLQSVLGNALDSSDEELDGDEDGTDENDPETQFYESHIK 117

Query: 106 PEDSFERWASNTKHRKSINRKMMSYKKYNKLTKYSRKKIQVPLIRSNRKLQENFLSVIDG 165
           P+ +FE W  NT  R  I RK ++Y    KL K + K +   L    +KL   F ++  G
Sbjct: 118 PQHTFEVWNVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKKLNMYFQALKFG 177

Query: 166 YELIDDNINLKENFTMVNVKLLTDLMYESIFKENWKIAYRCFTLLIRLPKTSIRKIWNLG 225
           +++      L +  TM ++  L  L+Y ++  +NW+IAYRCF++LIRL    +R +W++G
Sbjct: 178 FDVYP-KPQLSKQKTM-HLAHLNQLLYTNVLNQNWEIAYRCFSILIRLEDVDVRSLWSIG 235

Query: 226 SMIIENLEGINKTIEFLKLFNNIH-SRYKKKIFNQTVNYREAPVFNDGSRNKTPIYIKTL 284
           S I+ +L        +L+   ++  SR +   FNQ  NY   PVF  GSR  TP ++ T 
Sbjct: 236 SEILNSLGDTQSNEAYLEWLAHVFPSRVQ---FNQGTNYSLDPVFRCGSRTHTPTFVLTW 292

Query: 285 LWKEIXXXXXXXXXXXN---YNELIEYLSELTLIPPFMEDSEIWYIYGIVHLQRANELSM 341
           LW  +                  LI+ L E+ L PP+M+DSEIWYI+G+ HL  A+ELS 
Sbjct: 293 LWTRLFIATSGSSAVDKEKFLQSLIDRLDEMVLSPPYMDDSEIWYIFGLTHLVMASELSS 352

Query: 342 NLEHYIDNSSSSK-DIANNEVVQNIKLAQKFLKKAKELSKIEVPERQITLMIKNIE 396
                 D    S+ DIA N+V+Q+I  A+  L+  K  S  E PE  I   +  +E
Sbjct: 353 KFRQSKDILLGSRADIARNQVIQHINNAKNCLQMCKANSNYEFPENVIEHQLVQLE 408

>TBLA0B00570 Chr2 complement(113646..115199) [1554 bp, 517 aa] {ON}
           Anc_6.46 YML043C
          Length = 517

 Score =  166 bits (421), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 120/421 (28%), Positives = 201/421 (47%), Gaps = 58/421 (13%)

Query: 1   MFEVPTIDSTKRSVVNFKKLRYQYMN-------HMY---------ERNRYNKNGQGLPTP 44
           MFE P ++   + + N +K+RYQY+N        +Y         E NR ++    LPTP
Sbjct: 1   MFEAP-LNIHSKVLANERKIRYQYINTFTKRYSQLYGDTIPSSSLESNR-SRTPITLPTP 58

Query: 45  VSSENEMNASEDEVSHKRVRKRWRRIXXXXXXXXXXXXXXXXXXXXXXXXXXKKYFSRYD 104
            +S +E         H      +                              K+F+RYD
Sbjct: 59  EASAHE---------HSDSNTNYNDDSDSISNTNTLSDDEYNSDSTGTTNEETKFFNRYD 109

Query: 105 KPEDSFERWASN-----------TKHRKSINRKMMSYKKYNKLTKYSRKKIQVPLIRSNR 153
           +P++SFE W ++           +  R  INR  +S+ + N++ K++ KK++  L    +
Sbjct: 110 RPQESFEVWNTSIDTLNSKTKLKSNGRIPINRNKISFNRLNRVKKFTNKKLEARLQHCTK 169

Query: 154 KLQENFLSVIDGYELIDDNINLKENFTMVNVKLLTDLMYESIFKENWKIAYRCFTLLIRL 213
           +L+ +  ++ +GYE    +     +F  ++++ L +L+Y +I ++N+  AY  F+L+IRL
Sbjct: 170 RLKTHIKAISEGYETSYRDKQTT-SFNNIHIENLINLLYYNICEKNFNQAYHIFSLIIRL 228

Query: 214 PKTSIRKIWNLGSMIIENLEGINKTIEFLKLFNNIHSRYKKKIFNQTVNYREAPVFNDGS 273
           P   IR  WNLGS+I+     I +++ FL   ++I+S  +K  +N ++NY+ AP F   S
Sbjct: 229 PNIDIRNFWNLGSIILLKKVSIQESLNFLNWIHSIYSSNQK--YNNSINYKTAPAFTQSS 286

Query: 274 RNKTPIYIKTLLWKEIXXXXXXXXXXXNYN----------------ELIEYLSELTLIPP 317
           RN T  +  + LW  +           + N                + +E LSE+ L PP
Sbjct: 287 RNHTGKFTTSFLWMTLSLIHTKFSDLTSRNIKEIVEELNYLKKKLKKFVEKLSEMVLAPP 346

Query: 318 FMEDSEIWYIYGIVHLQRANELSMNLEHY-IDNSSSSKDIANNEVVQNIKLAQKFLKKAK 376
           F+EDSEIWYIY + HL  A  L     +  I  +S  KDI  NE++ NI+  +  L+K +
Sbjct: 347 FIEDSEIWYIYSLSHLILARMLMFETRNNDISQTSVEKDITKNEIISNIQHCKSHLQKVR 406

Query: 377 E 377
           E
Sbjct: 407 E 407

>Kwal_56.22527 s56 complement(168165..169610) [1446 bp, 481 aa] {ON}
           YML043C (RRN11) - component of rDNA transcription factor
           [contig 185] FULL
          Length = 481

 Score =  164 bits (414), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 109/402 (27%), Positives = 195/402 (48%), Gaps = 32/402 (7%)

Query: 1   MFEVPTIDSTKRSVVNFKKLRYQYMNHMYERNRYNKNGQG----LPTPVSSENEMNASED 56
           MFE+P   ++ R V   +KLRYQY+N + + +R  ++       LPTP +S  E  +  D
Sbjct: 1   MFELPLARNSNR-VRTVRKLRYQYINSLSQEHRRIQDSAAAHATLPTPENSAAEDASDGD 59

Query: 57  EVSHKRVRKRWRRIXX--------XXXXXXXXXXXXXXXXXXXXXXXXKKYFSRYDKPED 108
           + S     +R RR                                   K++FS ++KP+D
Sbjct: 60  QDSEDAGSRRRRRKRRILSVLGHIDSESELSDVDMSTESHHSELQESEKEFFSHHEKPQD 119

Query: 109 SFERWASNTKHRKSINRKMMSYKKYNKLTKYSRKKIQVPLIRSNRKLQENFLSVIDGYEL 168
           ++E W ++ +   S+    +SY +   +   +++++   +   +R  + +F S+  GYE+
Sbjct: 120 TYETWNTDRRKAVSMTTATLSYAENKLIEARAQRRVIERIGHFSRIARSHFNSIKRGYEI 179

Query: 169 IDDNINLKENFTMVNVKLLTDLMYESIFKENWKIAYRCFTLLIRLPKTSIRKIWNLGSMI 228
                 + +     ++  L +L++ ++ +  W+ A+RCF++LIRLP   IR +W LG  I
Sbjct: 180 YSRPSQVHQT---THITHLNELLHINVMEGQWETAFRCFSILIRLPGVDIRSMWGLGVRI 236

Query: 229 IENLEGINKTI----EFLKLFNNIHSRYKKKIFNQTVNYREAPVFNDGSRNKTPIYIKTL 284
           +  L   +K +    EFL   + I++   +  FN T+N+   PVF  GS+  T  ++   
Sbjct: 237 LRELSSTDKNVASSDEFLGWLSGIYT--SRSNFNHTMNFLMDPVFRTGSKKHTAKFVSAW 294

Query: 285 LWKEIXXXXXXXXXXXNYN---------ELIEYLSELTLIPPFMEDSEIWYIYGIVHLQR 335
           LW+ +             +         +L+E LSE+ LIPP+MED EIW+IY + HL  
Sbjct: 295 LWEMLFAACPDKLEERQADNGSGNRKLIQLLEKLSEMVLIPPYMEDPEIWFIYALCHLVS 354

Query: 336 ANELSMNLEH-YIDNSSSSKDIANNEVVQNIKLAQKFLKKAK 376
           A+ELS      Y +++   +DI+ N+V Q+I  A   ++  +
Sbjct: 355 ADELSQRFTFTYSESTELERDISRNQVTQHITNAHNCIRTCE 396

>ACL020W Chr3 (326268..327887) [1620 bp, 539 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YML043C (RRN11)
          Length = 539

 Score =  162 bits (411), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 104/311 (33%), Positives = 165/311 (53%), Gaps = 17/311 (5%)

Query: 97  KKYFSRYDKPEDSFERWASNTKHRKSINRKMMSYKKYNKLTKYSRKKIQVPLIRSNRKLQ 156
           K++F+RY KPE ++E WA++ K+R  I RKM+SY+ + ++  YS ++++  L  S +K  
Sbjct: 165 KQFFARYYKPEYTYELWATSPKNRVPIRRKMLSYQAFKQIENYSNQRMKATLSLSTKKAA 224

Query: 157 ENFLSVIDGYELIDDNINLKE---NFTMVNVKLLTDLMYESIFKENWKIAYRCFTLLIRL 213
                +  GYE        KE   N+  +++  L  L+Y +I  ENW  AYRCF LLIR+
Sbjct: 225 AYHEVMRLGYETCP-----KEEVTNYQKLHLNHLVGLLYSNIISENWGTAYRCFALLIRM 279

Query: 214 PKTSIRKIWNLGSMIIENLEGINKTIEFLKLFNNIHSRYKKKIFNQT-VNYREAPVFNDG 272
               +R IWNLGS I+ +L   +   +FL+    + + +   +F+Q  VN  + PVF  G
Sbjct: 280 KSVDLRSIWNLGSHILSHL-NFDMHEKFLEWMGTVFTSH--SVFSQNKVNLID-PVFRSG 335

Query: 273 SRNKTPIYIKTLLWKEIXXXXXXXXXXXNYNE--LIEYLSELTLIPPFMEDSEIWYIYGI 330
           SR  TP ++   LW  +             +   L+E +SEL L PP+M+D+EIW++Y +
Sbjct: 336 SRAHTPNFMLAWLWLVLRGATADEVLDSTRSMAWLLEKVSELVLRPPYMDDAEIWFLYAM 395

Query: 331 VHLQRANELSMNLEHY--IDNSSSSKDIANNEVVQNIKLAQKFLKKAKELSKIEVPERQI 388
            +  +A++LS  L  +  I    S  DIA  +V Q I   +  L+  +E      PER I
Sbjct: 396 CYFIQADKLSAQLASHEGIKLHGSKLDIAKTQVTQYICSVKNCLESCREKGNFTYPERII 455

Query: 389 TLMIKNIEGRM 399
              +   E R+
Sbjct: 456 QEQLLEFERRL 466

>Ecym_3049 Chr3 complement(93199..94704) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ACL020W
          Length = 501

 Score =  161 bits (407), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 99/311 (31%), Positives = 170/311 (54%), Gaps = 16/311 (5%)

Query: 97  KKYFSRYDKPEDSFERWASNTKHRKSINRKMMSYKKYNKLTKYSRKKIQVPLIRSNRKLQ 156
           K ++S+Y  PE+++E W ++  +R  I R+ MSY  +  + KY+ KK+   L  S++KL 
Sbjct: 125 KIFYSKYYVPEETYEVWTTSINNRIPIQRRSMSYHVFRTIEKYAHKKVAASLALSSKKLT 184

Query: 157 ENFLSVIDGYELID-DNINLKENFTMVNVKLLTDLMYESIFKENWKIAYRCFTLLIRLPK 215
             F  +  GYE    + I    N+  V++  L DL+Y +I + ++  AYRCF+LLIR+  
Sbjct: 185 GFFEVIRSGYETCPRERIT---NYQKVHLHHLVDLLYINILRGDFDTAYRCFSLLIRMNF 241

Query: 216 TSIRKIWNLGSMIIE--NLEGINKTIEFLKLFNNIHSRYKKKIFNQTVNYREAPVFNDGS 273
             +R +WNLGS I+E  NL+   + +E++      +S + +   NQ       PVF  GS
Sbjct: 242 VDLRSMWNLGSKILEHYNLDDQERFLEWMSTVLTSNSAFPQNSKNQL-----DPVFRSGS 296

Query: 274 RNKTPIYIKTLLWKEIXXXXXXXXXXXNY--NELIEYLSELTLIPPFMEDSEIWYIYGIV 331
           R   P ++ + LW  +            +  N L++ +SEL L PP+M+D+E+W+IY + 
Sbjct: 297 RTHIPNFVLSWLWLVLENAVKERVFSSGHDINWLLDKISELVLRPPYMDDAEVWFIYAMC 356

Query: 332 HLQRANELSMNL--EHYIDNSSSSK-DIANNEVVQNIKLAQKFLKKAKELSKIEVPERQI 388
           +  +A++LS+ L  E  ++    S+ DIA N+V++NI   +  L+  +E    + P+R I
Sbjct: 357 YFIKADKLSLQLKQEGSLNGLKGSQLDIARNQVIENIHHVKNHLRICEEKGGFQYPKRVI 416

Query: 389 TLMIKNIEGRM 399
              +   E R+
Sbjct: 417 EAQLVEFEKRL 427

>TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543
           YPR186C
          Length = 472

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 28/46 (60%)

Query: 97  KKYFSRYDKPEDSFERWASNTKHRKSINRKMMSYKKYNKLTKYSRK 142
           KKYF  YD    SF R ++ T+H++SI+  + ++      +K+SRK
Sbjct: 75  KKYFCEYDGCNKSFARPSTLTEHQQSIHLGIKNHSCDVCGSKFSRK 120

>Suva_16.96 Chr16 complement(163766..165688) [1923 bp, 640 aa] {ON}
           YPL210C (REAL)
          Length = 640

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 27/56 (48%)

Query: 207 FTLLIRLPKTSIRKIWNLGSMIIENLEGINKTIEFLKLFNNIHSRYKKKIFNQTVN 262
           F LL+R         +NL +   E    I + I FL+LFNN   R +  I ++T N
Sbjct: 285 FNLLLRELNAERLNTFNLQTFTYEQWSNIQRNILFLRLFNNGKIRSQDSILSKTAN 340

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,955,312
Number of extensions: 1824622
Number of successful extensions: 8656
Number of sequences better than 10.0: 62
Number of HSP's gapped: 8829
Number of HSP's successfully gapped: 72
Length of query: 401
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 289
Effective length of database: 40,638,807
Effective search space: 11744615223
Effective search space used: 11744615223
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)