Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1036.698.324ON93693647610.0
TPHA0C008108.324ON93793938290.0
NCAS0C032608.324ON98395636130.0
Suva_10.2228.324ON94394036060.0
SAKL0H15532g8.324ON94194336010.0
NDAI0G025808.324ON95895735880.0
Skud_12.1988.324ON94394335660.0
YLR129W (DIP2)8.324ON94394335620.0
Smik_12.1928.324ON94394335550.0
TDEL0F045008.324ON93894034990.0
ZYRO0F10406g8.324ON93893934990.0
TBLA0A039508.324ON93691334900.0
KAFR0H022608.324ON93894334530.0
KLTH0G12276g8.324ON93793934490.0
KNAG0G024508.324ON94294134270.0
Kwal_56.239208.324ON93794034130.0
CAGL0M04279g8.324ON94094333790.0
Ecym_42558.324ON93793933470.0
AGL196C8.324ON93594033140.0
KLLA0D16390g8.324ON93694330310.0
TDEL0B020108.435ON8056373631e-34
NCAS0C027108.435ON8155933391e-31
ZYRO0A09636g8.435ON8086333336e-31
Ecym_41348.435ON8106463328e-31
KNAG0A025108.435ON8496083311e-30
Skud_12.2858.435ON8176533301e-30
NDAI0E034408.435ON8576563283e-30
YLR222C (UTP13)8.435ON8175893264e-30
CAGL0C00737g8.435ON8166363264e-30
Suva_10.3168.435ON8185903256e-30
Smik_12.2798.435ON8175963166e-29
Kwal_27.115858.435ON8236303086e-28
KAFR0H017508.435ON7835953069e-28
TBLA0I025708.435ON8486992989e-27
SAKL0H12760g8.435ON8411992721e-23
AGR180W8.435ON8062392659e-23
KLTH0E10120g8.435ON8262032641e-22
Kpol_1031.498.435ON7602042561e-21
KLLA0F13244g8.435ON8142382532e-21
KNAG0A037008.544ON8172952523e-21
TPHA0L010808.435ON8352022505e-21
NCAS0D047806.363ON6213152415e-20
AEL246C8.544ON8152942416e-20
KLLA0F10263g6.363ON6822762408e-20
KAFR0E031808.544ON8142952391e-19
Ecym_25236.363ON6462792371e-19
SAKL0F15972g7.534ON4702992341e-19
AGL234W6.363ON6292792343e-19
TPHA0M020006.363ON6994262353e-19
CAGL0C03608g6.363ON6433332334e-19
SAKL0H09988g8.544ON7493362335e-19
Ecym_70388.544ON8001882301e-18
TBLA0F042406.363ON7273372291e-18
ZYRO0A12980g8.544ON8242552292e-18
Skud_3.1566.363ON7132882273e-18
YCR084C (TUP1)6.363ON7132882273e-18
TBLA0H036208.544ON8123202264e-18
CAGL0M05335g8.544ON8062972264e-18
ZYRO0D01122g7.534ON4663122224e-18
Kpol_1013.377.534ON4682742216e-18
TDEL0A077806.363ON6572852236e-18
SAKL0A00660g6.363ON6603602237e-18
Kpol_1028.236.363ON7442832237e-18
Smik_2.3388.544ON8002952238e-18
Smik_3.1836.363ON7092832221e-17
KNAG0D002506.363ON6553862211e-17
NDAI0C054908.544ON8593082221e-17
Suva_3.1216.363ON7002632211e-17
TDEL0B030208.544ON8312952212e-17
AEL269C7.534ON4553152162e-17
NDAI0K023506.363ON7932212192e-17
Kpol_1024.428.544ON8432162183e-17
YBR198C (TAF5)8.544ON7982162175e-17
Skud_2.3248.544ON8022952166e-17
NCAS0A055206.363ON6713482157e-17
CAGL0E00561g6.363ON8363002159e-17
TPHA0L016908.544ON8322192141e-16
Kwal_23.64296.363ON7502822131e-16
NCAS0B022008.544ON8222842131e-16
KLTH0A07282g6.363ON7252842122e-16
Suva_4.4528.544ON8002162112e-16
KLLA0E23453g8.544ON8261892095e-16
KLTH0E12606g8.544ON7552162077e-16
KAFR0A005102.431ON3192331998e-16
Kwal_27.120538.544ON7552962061e-15
TPHA0I018808.544ON10342572061e-15
KLTH0D04466g2.431ON3192111981e-15
ZYRO0D17292g6.363ON7182862042e-15
KLTH0A00880g7.534ON4712452002e-15
TBLA0F005206.363ON6632982022e-15
AFL118W6.239ON8323072023e-15
Ecym_28087.534ON4653131984e-15
Kpol_487.71.399ON3032721935e-15
KAFR0C047406.363ON6652601996e-15
Kwal_23.53517.534ON4742451941e-14
TDEL0H003707.534ON4652511931e-14
SAKL0A03872g6.239ON8783121962e-14
NCAS0A042702.431ON3182301892e-14
NCAS0F018502.431ON3182301882e-14
ZYRO0E04620g1.399ON3032311882e-14
Suva_14.3421.399ON3032711863e-14
Skud_14.3211.399ON3032711864e-14
Kpol_1048.598.544ON8502171924e-14
TBLA0A060606.239ON8882871925e-14
Smik_14.3221.399ON3032711855e-14
YNL006W (LST8)1.399ON3032711855e-14
KNAG0F018406.239ON9113041916e-14
TPHA0G023802.431ON3182301847e-14
Suva_13.2952.431ON3192301839e-14
Skud_13.2752.431ON3192301839e-14
Smik_13.3052.431ON3192301839e-14
YMR116C (ASC1)2.431ON3192301839e-14
KLTH0H03608g6.239ON8753041891e-13
AFR199C2.431ON3342021831e-13
Kpol_297.72.431ON3181391812e-13
KNAG0E023102.431ON3192311812e-13
TDEL0B059701.399ON3032311802e-13
SAKL0D08756g1.399ON3032311793e-13
NDAI0H027102.431ON3182301784e-13
CAGL0L03201g1.247ON5792451834e-13
Ecym_55015.631ON3272381794e-13
TPHA0G016108.672ON4141441814e-13
KNAG0F038707.534ON4652371824e-13
CAGL0H03729g1.399ON3032951766e-13
YCR072C (RSA4)6.340ON5154261816e-13
KAFR0A069906.239ON8852871818e-13
ZYRO0D08206g6.340ON5152921799e-13
ADL082C7.231ON5692791791e-12
TDEL0E054806.239ON8813041801e-12
Smik_7.1356.239ON8873111801e-12
AER263C6.340ON5134301781e-12
KLLA0F21406g1.247ON7051201791e-12
YGL137W (SEC27)6.239ON8893111791e-12
Suva_7.1276.239ON8913041792e-12
KAFR0H031401.399ON3032311732e-12
KNAG0C062405.631ON3552501742e-12
ZYRO0D16742g7.231ON6082761772e-12
Skud_7.1356.239ON8973041782e-12
KAFR0A033801.247ON6661731772e-12
ZYRO0E07392g6.239ON8973041782e-12
TDEL0H021307.231ON5842771762e-12
TBLA0B091002.431ON3171401723e-12
SAKL0E03960g2.431ON3202071723e-12
KNAG0H016901.399ON3032521713e-12
KLLA0B01958g6.239ON8903091763e-12
Kpol_1070.117.231ON6661591763e-12
KNAG0C014101.247ON6531751754e-12
KAFR0L013907.322ON12061591764e-12
TPHA0J025406.239ON8663031764e-12
Ecym_43437.231ON5832821744e-12
Ecym_60982.431ON3182021704e-12
SAKL0F08404g7.231ON6431821754e-12
KAFR0B003707.534ON4612481734e-12
Kpol_1028.416.340ON5121451735e-12
Suva_11.2681.247ON6452961745e-12
NDAI0G038303.25ON5102081735e-12
KNAG0B016101.247ON6742571745e-12
TPHA0C011507.231ON6871561745e-12
CAGL0I03718g7.322ON12011591755e-12
KAFR0F043506.340ON5151421736e-12
TPHA0M018306.340ON5151451736e-12
Kpol_1016.111.247ON6691241746e-12
Smik_3.1726.340ON5154261736e-12
TPHA0I032407.534ON4772801727e-12
Kpol_1055.644.275ON9382631747e-12
KLLA0E07085g3.25ON4522141717e-12
Kpol_1014.193.25ON4522501718e-12
ZYRO0F07282g8.672ON4271551708e-12
NDAI0B051901.247ON6682151729e-12
TBLA0F022307.322ON12161891739e-12
KNAG0D016907.231ON6542861721e-11
TDEL0A075506.340ON5151451711e-11
NCAS0A151707.534ON4742501701e-11
TDEL0A020702.431ON3191431671e-11
KLTH0A06380g6.325ON9155881721e-11
TPHA0P014903.25ON4592561701e-11
AEL314W1.247ON7151171711e-11
NDAI0A020907.322ON12001591721e-11
Ecym_80727.322ON12011591721e-11
Ecym_12931.399ON3032311661e-11
Suva_6.1871.247ON7141251711e-11
KNAG0B027207.322ON12041721721e-11
ZYRO0F11110g7.322ON12011581711e-11
NCAS0A139407.322ON12051841711e-11
ZYRO0G20152g2.431ON3192341661e-11
Skud_9.1237.231ON6391591701e-11
Ecym_24986.340ON5421421691e-11
ZYRO0C03124g3.25ON4452081682e-11
Skud_3.1456.340ON5154261692e-11
Suva_9.1547.231ON6381591692e-11
TBLA0D041307.231ON5741161692e-11
KLTH0E15576g1.247ON7231211702e-11
YIL046W (MET30)7.231ON6401591692e-11
TPHA0D045007.322ON12081721702e-11
NCAS0A134307.231ON6082931692e-11
Kwal_23.57697.231ON6272811692e-11
CAGL0G04345g1.247ON7111181692e-11
KNAG0J016808.672ON3981531662e-11
TPHA0B011201.247ON7191231692e-11
Suva_14.223.25ON4692081673e-11
TDEL0C022407.322ON12011841693e-11
Kwal_23.63246.340ON5142731673e-11
KLLA0D04840g1.399ON3032551633e-11
Kwal_23.62406.325ON9136481683e-11
NDAI0A026107.231ON7671591683e-11
NDAI0I008806.239ON8883041683e-11
KAFR0I018807.231ON5912831674e-11
KLLA0C08547g6.340ON5152861664e-11
CAGL0J03476g6.340ON5171451664e-11
Skud_14.223.25ON4672081664e-11
ZYRO0D03828g1.247ON7261231674e-11
Ecym_80901.247ON7161161674e-11
KLTH0H12122g1.399ON3032311624e-11
NDAI0I003506.340ON5152931664e-11
CAGL0H08932g6.239ON9023001674e-11
Ecym_24018.672ON4261551654e-11
Smik_10.1261.247ON7121261665e-11
TBLA0F041306.340ON5142901655e-11
SAKL0G15994g4.275ON9442891665e-11
KLTH0A06754g6.340ON5142931646e-11
Kpol_2001.657.322ON12061671666e-11
KLTH0A04114g7.231ON6582811656e-11
NCAS0G036001.399ON3272381616e-11
NCAS0B078401.247ON5892041647e-11
KNAG0H001802.663ON3893321627e-11
TPHA0O007101.399ON3042861608e-11
KAFR0I010504.106ON8422371658e-11
CAGL0M08646g5.631ON3372411608e-11
CAGL0M04081g3.25ON4552071628e-11
TBLA0E007607.534ON3841591618e-11
KLLA0E12277g2.431ON3262181609e-11
TDEL0A004403.25ON4512081629e-11
Skud_4.1097.322ON12011591641e-10
KNAG0I028406.340ON5192871621e-10
CAGL0L00781g7.231ON6731621631e-10
KLTH0D11132g8.672ON4371531621e-10
YDL145C (COP1)7.322ON12011841641e-10
Smik_6.3488.672ON4512321621e-10
SAKL0H06666g8.672ON4412261611e-10
Smik_11.2981.247ON6622391631e-10
Smik_4.907.322ON12011591641e-10
KNAG0G01080na 1ON7463841631e-10
Suva_3.1096.340ON5153411621e-10
AAL009C1.399ON3032311581e-10
Suva_4.997.322ON12011591631e-10
SAKL0A01276g6.340ON5151451621e-10
YPL151C (PRP46)8.672ON4512541611e-10
Smik_9.1447.231ON6302891621e-10
SAKL0F10648g7.322ON12031591631e-10
NDAI0C026001.399ON3032321571e-10
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1036.69
         (936 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...  1838   0.0  
TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {O...  1479   0.0  
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...  1396   0.0  
Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129...  1393   0.0  
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...  1391   0.0  
NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {O...  1386   0.0  
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...  1378   0.0  
YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}  DIP2Nucle...  1376   0.0  
Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129...  1373   0.0  
TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.3...  1352   0.0  
ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} simila...  1352   0.0  
TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.3...  1348   0.0  
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...  1334   0.0  
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...  1333   0.0  
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...  1324   0.0  
Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129...  1319   0.0  
CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highl...  1306   0.0  
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...  1293   0.0  
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...  1281   0.0  
KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} simi...  1172   0.0  
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...   144   1e-34
NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {O...   135   1e-31
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...   132   6e-31
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...   132   8e-31
KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {O...   132   1e-30
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...   131   1e-30
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...   130   3e-30
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...   130   4e-30
CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON...   130   4e-30
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...   129   6e-30
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...   126   6e-29
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...   123   6e-28
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...   122   9e-28
TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.7...   119   9e-27
SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]...   109   1e-23
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...   106   9e-23
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...   106   1e-22
Kpol_1031.49 s1031 (132811..133005,133055..133063,133288..133320...   103   1e-21
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...   102   2e-21
KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {O...   101   3e-21
TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8....   100   5e-21
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     97   5e-20
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    97   6e-20
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...    97   8e-20
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    97   1e-19
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    96   1e-19
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    95   1e-19
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    95   3e-19
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...    95   3e-19
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...    94   4e-19
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    94   5e-19
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    93   1e-18
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    93   1e-18
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    93   2e-18
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    92   3e-18
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    92   3e-18
TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.5...    92   4e-18
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    92   4e-18
ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON...    90   4e-18
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    90   6e-18
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    91   6e-18
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    91   7e-18
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    91   7e-18
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    91   8e-18
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    90   1e-17
KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363...    90   1e-17
NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON}             90   1e-17
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    90   1e-17
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    90   2e-17
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    88   2e-17
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    89   2e-17
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    89   3e-17
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    88   5e-17
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    88   6e-17
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    87   7e-17
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    87   9e-17
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    87   1e-16
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    87   1e-16
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    87   1e-16
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    86   2e-16
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    86   2e-16
KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} simi...    85   5e-16
KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} simi...    84   7e-16
KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {O...    81   8e-16
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    84   1e-15
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    84   1e-15
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    81   1e-15
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    83   2e-15
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    82   2e-15
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    82   2e-15
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    82   3e-15
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    81   4e-15
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    79   5e-15
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    81   6e-15
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    79   1e-14
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    79   1e-14
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    80   2e-14
NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa...    77   2e-14
NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 ...    77   2e-14
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...    77   2e-14
Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W...    76   3e-14
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...    76   4e-14
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    79   4e-14
TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 8...    79   5e-14
Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...    76   5e-14
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...    76   5e-14
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    78   6e-14
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    75   7e-14
Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960...    75   9e-14
Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960...    75   9e-14
Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960...    75   9e-14
YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,...    75   9e-14
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    77   1e-13
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    75   1e-13
Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON...    74   2e-13
KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa...    74   2e-13
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....    74   2e-13
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...    74   3e-13
NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 ...    73   4e-13
CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa] ...    75   4e-13
Ecym_5501 Chr5 (1021675..1022658) [984 bp, 327 aa] {ON} similar ...    74   4e-13
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    74   4e-13
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    75   4e-13
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...    72   6e-13
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    74   6e-13
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    74   8e-13
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    74   9e-13
ADL082C Chr4 complement(538945..540654) [1710 bp, 569 aa] {ON} S...    74   1e-12
TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657) [...    74   1e-12
Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa...    74   1e-12
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    73   1e-12
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    74   1e-12
YGL137W Chr7 (249869..249886,250087..252738) [2670 bp, 889 aa] {...    74   1e-12
Suva_7.127 Chr7 (246249..246659,246660..248924) [2676 bp, 891 aa...    74   2e-12
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...    71   2e-12
KNAG0C06240 Chr3 complement(1212466..1213533) [1068 bp, 355 aa] ...    72   2e-12
ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]...    73   2e-12
Skud_7.135 Chr7 (254246..254263,254479..257154) [2694 bp, 897 aa...    73   2e-12
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    73   2e-12
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    73   2e-12
TDEL0H02130 Chr8 (362711..364465) [1755 bp, 584 aa] {ON} Anc_7.2...    72   2e-12
TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [...    71   3e-12
SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963...    71   3e-12
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    70   3e-12
KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 ...    72   3e-12
Kpol_1070.11 s1070 (30012..32012) [2001 bp, 666 aa] {ON} (30012....    72   3e-12
KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.2...    72   4e-12
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    72   4e-12
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    72   4e-12
Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar t...    72   4e-12
Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa] ...    70   4e-12
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    72   4e-12
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    71   4e-12
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    71   5e-12
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    72   5e-12
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      71   5e-12
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    72   5e-12
TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.2...    72   5e-12
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    72   5e-12
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    71   6e-12
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    71   6e-12
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    72   6e-12
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    71   6e-12
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    71   7e-12
Kpol_1055.64 s1055 (170524..173340) [2817 bp, 938 aa] {ON} (1705...    72   7e-12
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    70   7e-12
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    70   8e-12
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    70   8e-12
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    71   9e-12
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    71   9e-12
KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.2...    71   1e-11
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    70   1e-11
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    70   1e-11
TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa...    69   1e-11
KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {...    71   1e-11
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    70   1e-11
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    70   1e-11
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    71   1e-11
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    71   1e-11
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...    69   1e-11
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    70   1e-11
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    71   1e-11
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    70   1e-11
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    70   1e-11
ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408) ...    69   1e-11
Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W ...    70   1e-11
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    70   1e-11
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    69   2e-11
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    70   2e-11
Suva_9.154 Chr9 (257284..259200) [1917 bp, 638 aa] {ON} YIL046W ...    70   2e-11
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    70   2e-11
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    70   2e-11
YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box...    70   2e-11
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    70   2e-11
NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa] ...    70   2e-11
Kwal_23.5769 s23 complement(1311598..1313481) [1884 bp, 627 aa] ...    70   2e-11
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    70   2e-11
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    69   2e-11
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    70   2e-11
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    69   3e-11
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    70   3e-11
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    69   3e-11
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...    67   3e-11
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    69   3e-11
NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231     69   3e-11
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    69   3e-11
KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.2...    69   4e-11
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    69   4e-11
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    69   4e-11
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    69   4e-11
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    69   4e-11
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    69   4e-11
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...    67   4e-11
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       69   4e-11
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    69   4e-11
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    68   4e-11
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    69   5e-11
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    68   5e-11
SAKL0G15994g Chr7 complement(1374780..1377614) [2835 bp, 944 aa]...    69   5e-11
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    68   6e-11
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    69   6e-11
KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {...    68   6e-11
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...    67   6e-11
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    68   7e-11
KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}...    67   7e-11
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    66   8e-11
KAFR0I01050 Chr9 complement(205792..208320) [2529 bp, 842 aa] {O...    68   8e-11
CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} simil...    66   8e-11
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    67   8e-11
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               67   8e-11
KLLA0E12277g Chr5 (1086778..1087329,1087730..1088158) [981 bp, 3...    66   9e-11
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    67   9e-11
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    68   1e-10
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    67   1e-10
CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar...    67   1e-10
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    67   1e-10
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    68   1e-10
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    67   1e-10
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    67   1e-10
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    67   1e-10
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    68   1e-10
KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W      67   1e-10
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    67   1e-10
AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON} Sy...    65   1e-10
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    67   1e-10
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    67   1e-10
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    67   1e-10
Smik_9.144 Chr9 (242718..244610) [1893 bp, 630 aa] {ON} YIL046W ...    67   1e-10
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    67   1e-10
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}      65   1e-10
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     67   2e-10
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    65   2e-10
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    67   2e-10
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    67   2e-10
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    66   2e-10
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    67   2e-10
KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} simi...    67   2e-10
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    66   2e-10
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    67   2e-10
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    66   2e-10
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    66   3e-10
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    65   3e-10
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    65   3e-10
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    65   3e-10
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    66   4e-10
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    66   4e-10
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...    64   4e-10
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    65   4e-10
CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {...    65   4e-10
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    65   5e-10
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    65   5e-10
KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.3...    65   5e-10
TPHA0B02080 Chr2 (477775..480600) [2826 bp, 941 aa] {ON} Anc_4.2...    65   6e-10
Suva_2.117 Chr2 (203652..206174) [2523 bp, 840 aa] {ON} YBL008W ...    65   6e-10
Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON} (1259...    65   6e-10
KLTH0F16764g Chr6 complement(1358483..1359478) [996 bp, 331 aa] ...    64   6e-10
TPHA0A03680 Chr1 complement(804355..806004) [1650 bp, 549 aa] {O...    64   8e-10
KLTH0D14960g Chr4 complement(1223765..1226584) [2820 bp, 939 aa]...    65   8e-10
NCAS0C05310 Chr3 complement(1079501..1080550) [1050 bp, 349 aa] ...    64   8e-10
Kpol_1032.61 s1032 (141357..143825) [2469 bp, 822 aa] {ON} (1413...    65   9e-10
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    64   9e-10
TDEL0F00270 Chr6 complement(40832..42949) [2118 bp, 705 aa] {ON}...    64   1e-09
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    64   1e-09
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    64   1e-09
NDAI0A03310 Chr1 (750920..753373) [2454 bp, 817 aa] {ON} Anc_4.106     64   1e-09
NCAS0I01170 Chr9 complement(210377..212017) [1641 bp, 546 aa] {O...    64   1e-09
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    64   1e-09
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    64   1e-09
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    64   1e-09
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    64   2e-09
Skud_2.103 Chr2 (193155..195677) [2523 bp, 840 aa] {ON} YBL008W ...    64   2e-09
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    64   2e-09
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    62   2e-09
KNAG0C02890 Chr3 (571926..574418) [2493 bp, 830 aa] {ON} Anc_4.1...    64   2e-09
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    63   2e-09
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    63   2e-09
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    63   2e-09
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    63   2e-09
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    62   2e-09
KLLA0D07546g Chr4 complement(647984..649927) [1944 bp, 647 aa] {...    63   3e-09
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      62   3e-09
Smik_12.495 Chr12 complement(873068..875887) [2820 bp, 939 aa] {...    63   3e-09
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    62   4e-09
Kwal_23.4118 s23 (579251..582070) [2820 bp, 939 aa] {ON} YLR409C...    63   4e-09
Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar t...    62   4e-09
TBLA0A09610 Chr1 (2369818..2370978) [1161 bp, 386 aa] {ON} Anc_5...    61   5e-09
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    62   5e-09
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    62   5e-09
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    62   5e-09
Smik_2.112 Chr2 (202544..205069) [2526 bp, 841 aa] {ON} YBL008W ...    62   6e-09
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    62   6e-09
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    62   6e-09
Kpol_1002.74 s1002 complement(195739..198756) [3018 bp, 1005 aa]...    62   6e-09
CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highl...    62   7e-09
KAFR0H00550 Chr8 (97619..98683) [1065 bp, 354 aa] {ON} Anc_5.631...    60   7e-09
KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {O...    61   8e-09
KLLA0A04928g Chr1 (439349..441934) [2586 bp, 861 aa] {ON} simila...    62   8e-09
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    62   8e-09
YLR409C Chr12 complement(934414..937233) [2820 bp, 939 aa] {ON} ...    61   9e-09
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    61   9e-09
KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} simila...    60   9e-09
NCAS0A03470 Chr1 (684361..686811) [2451 bp, 816 aa] {ON} Anc_4.106     61   1e-08
KNAG0A03450 Chr1 (439716..440648) [933 bp, 310 aa] {ON} Anc_8.58...    60   1e-08
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    60   1e-08
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    60   1e-08
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    61   1e-08
NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.5...    61   1e-08
Smik_2.315 Chr2 (568572..569519) [948 bp, 315 aa] {ON} YBR175W (...    60   1e-08
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    59   1e-08
NCAS0B01910 Chr2 (312479..313456) [978 bp, 325 aa] {ON} Anc_8.585      60   1e-08
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    61   1e-08
Skud_12.493 Chr12 complement(874622..877441) [2820 bp, 939 aa] {...    61   1e-08
YBL008W Chr2 (209653..212175) [2523 bp, 840 aa] {ON}  HIR1Subuni...    61   1e-08
Ecym_3619 Chr3 (1183531..1185666) [2136 bp, 711 aa] {ON} similar...    61   1e-08
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    59   1e-08
ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {...    60   1e-08
ZYRO0G03586g Chr7 (285054..287969) [2916 bp, 971 aa] {ON} simila...    61   1e-08
TPHA0K00780 Chr11 (163003..164088) [1086 bp, 361 aa] {ON} Anc_7....    60   1e-08
KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {...    61   1e-08
ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {...    60   1e-08
AER081C Chr5 complement(785301..788372) [3072 bp, 1023 aa] {ON} ...    61   2e-08
AGL024W Chr7 (667533..669803) [2271 bp, 756 aa] {ON} Syntenic ho...    60   2e-08
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    60   2e-08
NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}...    60   2e-08
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    60   2e-08
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    60   2e-08
Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON} (69674....    60   2e-08
SAKL0G19668g Chr7 (1695030..1696214) [1185 bp, 394 aa] {ON} simi...    59   2e-08
Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W (...    59   2e-08
ZYRO0B12980g Chr2 complement(1045283..1048102) [2820 bp, 939 aa]...    60   2e-08
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    60   2e-08
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    60   2e-08
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    60   2e-08
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    59   2e-08
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    60   2e-08
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     59   2e-08
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    59   2e-08
TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {...    59   3e-08
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    60   3e-08
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    60   3e-08
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    59   3e-08
YBR175W Chr2 (582408..583355) [948 bp, 315 aa] {ON}  SWD3Essenti...    59   3e-08
ZYRO0G10054g Chr7 (802784..805312) [2529 bp, 842 aa] {ON} simila...    60   3e-08
NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {O...    60   3e-08
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    60   3e-08
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    59   3e-08
SAKL0B07458g Chr2 (642864..644393) [1530 bp, 509 aa] {ON} simila...    59   3e-08
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    59   3e-08
Ecym_3243 Chr3 (460611..463448) [2838 bp, 945 aa] {ON} similar t...    59   4e-08
CAGL0M06193g Chr13 (643917..644867) [951 bp, 316 aa] {ON} simila...    58   4e-08
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     59   4e-08
NCAS0A09610 Chr1 complement(1920171..1922258) [2088 bp, 695 aa] ...    59   4e-08
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    58   4e-08
TBLA0C02090 Chr3 complement(495831..498683) [2853 bp, 950 aa] {O...    59   5e-08
Suva_10.525 Chr10 complement(900164..902983) [2820 bp, 939 aa] {...    59   5e-08
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    59   5e-08
TBLA0C04110 Chr3 complement(994729..997278) [2550 bp, 849 aa] {O...    59   5e-08
KLLA0E18899g Chr5 (1680775..1683747) [2973 bp, 990 aa] {ON} simi...    59   5e-08
TPHA0F00550 Chr6 complement(127250..129736) [2487 bp, 828 aa] {O...    59   5e-08
SAKL0A10406g Chr1 (910452..912587) [2136 bp, 711 aa] {ON} simila...    59   5e-08
TDEL0A05290 Chr1 complement(933493..934452) [960 bp, 319 aa] {ON...    57   6e-08
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    58   6e-08
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    59   6e-08
TPHA0G02840 Chr7 (604491..605033) [543 bp, 180 aa] {ON} Anc_2.43...    55   6e-08
KLLA0B02827g Chr2 (254447..257275) [2829 bp, 942 aa] {ON} highly...    59   6e-08
YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box ...    59   7e-08
NDAI0J02410 Chr10 complement(586395..589244) [2850 bp, 949 aa] {...    59   7e-08
ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON} S...    58   7e-08
KAFR0A05800 Chr1 (1177423..1180245) [2823 bp, 940 aa] {ON} Anc_4...    59   7e-08
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    58   7e-08
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    58   7e-08
TPHA0I01690 Chr9 (377629..378651) [1023 bp, 340 aa] {ON} Anc_8.5...    57   7e-08
NCAS0J01110 Chr10 (189535..191322) [1788 bp, 595 aa] {ON}              58   7e-08
TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {O...    58   8e-08
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    58   8e-08
Kpol_1054.60 s1054 (148854..151013) [2160 bp, 719 aa] {ON} (1488...    58   9e-08
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       58   9e-08
Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON} (1008...    58   9e-08
KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly...    58   1e-07
TBLA0A01870 Chr1 (455007..458021) [3015 bp, 1004 aa] {ON} Anc_6....    58   1e-07
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    57   1e-07
Ecym_7301 Chr7 (634995..637349) [2355 bp, 784 aa] {ON} similar t...    58   1e-07
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    57   1e-07
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    58   1e-07
Ecym_6169 Chr6 complement(314473..316128) [1656 bp, 551 aa] {ON}...    58   1e-07
TDEL0A04970 Chr1 complement(877816..878817) [1002 bp, 333 aa] {O...    57   1e-07
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    57   1e-07
TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.6...    58   1e-07
KLLA0E24487g Chr5 complement(2175775..2176758) [984 bp, 327 aa] ...    56   1e-07
Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {...    57   1e-07
KLTH0C00616g Chr3 complement(62501..63724) [1224 bp, 407 aa] {ON...    57   1e-07
TDEL0E00950 Chr5 (197384..200206) [2823 bp, 940 aa] {ON} Anc_4.2...    57   1e-07
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    57   1e-07
CAGL0E02805g Chr5 complement(265374..267896) [2523 bp, 840 aa] {...    57   1e-07
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    57   2e-07
Smik_2.243 Chr2 (432627..434252) [1626 bp, 541 aa] {ON} YBR103W ...    57   2e-07
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    57   2e-07
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    57   2e-07
KAFR0A00600 Chr1 (108157..110841) [2685 bp, 894 aa] {ON} Anc_2.4...    57   2e-07
AGR207C Chr7 complement(1146704..1147666) [963 bp, 320 aa] {ON} ...    56   2e-07
TPHA0G02570 Chr7 (531221..532261) [1041 bp, 346 aa] {ON} Anc_2.3...    56   2e-07
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    57   2e-07
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    57   2e-07
TDEL0C04860 Chr3 (881043..882584) [1542 bp, 513 aa] {ON} Anc_3.3...    57   2e-07
TPHA0G02030 Chr7 (417868..418911) [1044 bp, 347 aa] {ON} Anc_2.3...    56   2e-07
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    57   2e-07
KNAG0B06260 Chr2 complement(1228060..1230876) [2817 bp, 938 aa] ...    57   2e-07
Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa] ...    55   2e-07
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    57   2e-07
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      56   3e-07
NCAS0J01650 Chr10 complement(294247..297069) [2823 bp, 940 aa] {...    57   3e-07
KNAG0G00130 Chr7 complement(8702..10888) [2187 bp, 728 aa] {ON} ...    57   3e-07
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    56   3e-07
ZYRO0C15994g Chr3 (1255015..1256529) [1515 bp, 504 aa] {ON} simi...    56   3e-07
Skud_16.96 Chr16 complement(172716..175757) [3042 bp, 1013 aa] {...    57   3e-07
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    56   3e-07
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    56   3e-07
CAGL0M09845g Chr13 (975007..977817) [2811 bp, 936 aa] {ON} highl...    56   3e-07
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    56   4e-07
Ecym_7078 Chr7 complement(156495..157436) [942 bp, 313 aa] {ON} ...    55   4e-07
Suva_7.278 Chr7 complement(482297..483559) [1263 bp, 420 aa] {ON...    55   4e-07
KLTH0D04950g Chr4 complement(449060..451402) [2343 bp, 780 aa] {...    56   4e-07
TBLA0B09730 Chr2 (2309400..2310938) [1539 bp, 512 aa] {ON} Anc_2...    55   4e-07
KAFR0B06670 Chr2 (1390238..1393234) [2997 bp, 998 aa] {ON} Anc_6...    56   4e-07
Kwal_27.11126 s27 (651113..654103) [2991 bp, 996 aa] {ON} YPL183...    56   4e-07
TDEL0F02410 Chr6 complement(447058..449568) [2511 bp, 836 aa] {O...    55   5e-07
Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON...    55   5e-07
Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON...    55   5e-07
NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663     55   5e-07
YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}  ...    55   6e-07
SAKL0A05412g Chr1 complement(489032..492025) [2994 bp, 997 aa] {...    55   6e-07
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    55   6e-07
SAKL0G01760g Chr7 (147664..148656) [993 bp, 330 aa] {ON} highly ...    54   6e-07
Smik_6.388 Chr6 (622104..625145) [3042 bp, 1013 aa] {ON} YPL183C...    55   6e-07
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    55   7e-07
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    55   7e-07
CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa] ...    55   9e-07
CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly...    54   9e-07
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    54   1e-06
KNAG0F02420 Chr6 complement(453743..455668) [1926 bp, 641 aa] {O...    55   1e-06
Kpol_1048.38 s1048 (104927..105949) [1023 bp, 340 aa] {ON} (1049...    54   1e-06
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    54   1e-06
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    54   1e-06
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    54   1e-06
TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67...    54   1e-06
Suva_4.348 Chr4 (616802..618448) [1647 bp, 548 aa] {ON} YBR103W ...    54   1e-06
Skud_11.7 Chr11 complement(15413..17566) [2154 bp, 717 aa] {ON} ...    54   1e-06
NDAI0A07830 Chr1 (1802204..1804156) [1953 bp, 650 aa] {ON} Anc_3...    54   1e-06
AFL056C Chr6 complement(329216..332146) [2931 bp, 976 aa] {ON} S...    54   1e-06
KLTH0B00924g Chr2 complement(79302..81446) [2145 bp, 714 aa] {ON...    54   1e-06
Smik_13.289 Chr13 complement(454351..456864) [2514 bp, 837 aa] {...    54   1e-06
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    54   1e-06
NDAI0I01520 Chr9 complement(358776..360710) [1935 bp, 644 aa] {O...    54   1e-06
Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON...    54   1e-06
AGR168W Chr7 (1061516..1063993) [2478 bp, 825 aa] {ON} Syntenic ...    54   2e-06
Kwal_56.24163 s56 complement(879667..881856) [2190 bp, 729 aa] {...    54   2e-06
YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}  D...    54   2e-06
KAFR0G01710 Chr7 (373483..375048) [1566 bp, 521 aa] {ON} Anc_3.3...    54   2e-06
TPHA0C00320 Chr3 (53120..54184) [1065 bp, 354 aa] {ON} Anc_5.631...    53   2e-06
AER448W Chr5 (1497416..1499560) [2145 bp, 714 aa] {ON} Syntenic ...    54   2e-06
ZYRO0F09284g Chr6 (754433..755767) [1335 bp, 444 aa] {ON} simila...    53   2e-06
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...    53   2e-06
Kwal_47.17555 s47 complement(453984..455237) [1254 bp, 417 aa] {...    53   2e-06
NCAS0A02800 Chr1 (533712..535517) [1806 bp, 601 aa] {ON} Anc_4.3...    54   2e-06
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    53   2e-06
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    53   2e-06
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    53   2e-06
Kpol_1065.30 s1065 complement(61425..62993) [1569 bp, 522 aa] {O...    53   3e-06
YMR102C Chr13 complement(469848..472352) [2505 bp, 834 aa] {ON} ...    53   3e-06
Suva_16.126 Chr16 complement(209255..212296) [3042 bp, 1013 aa] ...    53   3e-06
TDEL0F01740 Chr6 complement(322088..325102) [3015 bp, 1004 aa] {...    53   3e-06
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    53   3e-06
SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar...    52   3e-06
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    53   3e-06
Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON} (85899....    53   3e-06
Skud_13.261 Chr13 complement(445193..447697) [2505 bp, 834 aa] {...    53   3e-06
KLLA0A08866g Chr1 (776960..778231) [1272 bp, 423 aa] {ON} simila...    52   3e-06
YPL183C Chr16 complement(199495..202536) [3042 bp, 1013 aa] {ON}...    53   4e-06
Smik_11.10 Chr11 complement(16139..18292) [2154 bp, 717 aa] {ON}...    53   4e-06
TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.6...    52   4e-06
ZYRO0C14564g Chr3 (1135755..1137491) [1737 bp, 578 aa] {ON} simi...    52   5e-06
KAFR0I00640 Chr9 (128872..129819) [948 bp, 315 aa] {ON} Anc_8.58...    51   5e-06
CAGL0D02090g Chr4 (214357..214893,215564..215860) [834 bp, 277 a...    51   5e-06
NCAS0A04400 Chr1 (888188..890743) [2556 bp, 851 aa] {ON} Anc_2.4...    52   5e-06
SAKL0E03520g Chr5 complement(283754..286654) [2901 bp, 966 aa] {...    52   6e-06
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    52   6e-06
ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {...    52   6e-06
Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272...    52   6e-06
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    52   6e-06
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    52   6e-06
Kpol_526.37 s526 complement(88726..89769) [1044 bp, 347 aa] {ON}...    51   6e-06
NDAI0F04030 Chr6 complement(958364..959839) [1476 bp, 491 aa] {O...    52   7e-06
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    52   7e-06
KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} simila...    52   7e-06
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    52   7e-06
NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4....    52   7e-06
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    52   7e-06
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    51   7e-06
Skud_7.283 Chr7 complement(493716..494972) [1257 bp, 418 aa] {ON...    51   7e-06
ZYRO0C11242g Chr3 complement(871160..872170) [1011 bp, 336 aa] {...    51   8e-06
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    52   8e-06
Ecym_2239 Chr2 complement(467139..470081) [2943 bp, 980 aa] {ON}...    52   9e-06
KAFR0A00700 Chr1 (126326..128149) [1824 bp, 607 aa] {ON} Anc_2.4...    52   9e-06
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...    51   9e-06
YGL004C Chr7 complement(490703..491956) [1254 bp, 417 aa] {ON}  ...    51   9e-06
Ecym_7229 Chr7 (475040..477529) [2490 bp, 829 aa] {ON} similar t...    52   9e-06
SAKL0F10010g Chr6 (767640..768644) [1005 bp, 334 aa] {ON} simila...    51   9e-06
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    51   1e-05
Kwal_55.21559 s55 complement(889630..890685) [1056 bp, 351 aa] {...    50   1e-05
Suva_13.280 Chr13 complement(451520..454051) [2532 bp, 843 aa] {...    51   1e-05
Skud_2.229 Chr2 (415869..417506) [1638 bp, 545 aa] {ON} YBR103W ...    51   1e-05
ADR264C Chr4 complement(1158216..1159256) [1041 bp, 346 aa] {ON}...    50   1e-05
TPHA0J02160 Chr10 (484299..487313) [3015 bp, 1004 aa] {ON} Anc_6...    51   1e-05
Suva_7.152 Chr7 (284623..286461) [1839 bp, 612 aa] {ON} YGL116W ...    51   1e-05
Suva_2.537 Chr2 complement(959258..960625) [1368 bp, 455 aa] {ON...    51   1e-05
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    51   1e-05
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    51   1e-05
Kwal_33.15591 s33 (1174119..1176263) [2145 bp, 714 aa] {ON} YKL2...    51   1e-05
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    51   1e-05
SAKL0A06534g Chr1 complement(584399..586162) [1764 bp, 587 aa] {...    51   1e-05
Kwal_26.7655 s26 complement(460957..463188) [2232 bp, 743 aa] {O...    51   2e-05
Kpol_1032.65 s1032 complement(150052..151095) [1044 bp, 347 aa] ...    50   2e-05
TPHA0F03650 Chr6 (793481..795703) [2223 bp, 740 aa] {ON} Anc_1.5...    50   2e-05
KLTH0E08096g Chr5 complement(743809..745041) [1233 bp, 410 aa] {...    50   2e-05
YMR092C Chr13 complement(451632..453479) [1848 bp, 615 aa] {ON} ...    50   2e-05
TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2....    50   2e-05
Suva_11.7 Chr11 complement(15456..17615) [2160 bp, 719 aa] {ON} ...    50   2e-05
Smik_7.159 Chr7 (285146..286981) [1836 bp, 611 aa] {ON} YGL116W ...    50   2e-05
YGL116W Chr7 (289809..291641) [1833 bp, 610 aa] {ON}  CDC20Cell-...    50   2e-05
KLLA0E21781g Chr5 complement(1944865..1945866) [1002 bp, 333 aa]...    49   2e-05
Kpol_1002.101 s1002 complement(252330..254240) [1911 bp, 636 aa]...    50   2e-05
YBR103W Chr2 (447709..449316) [1608 bp, 535 aa] {ON}  SIF2WD40 r...    50   3e-05
Kwal_34.15818 s34 (74248..75297) [1050 bp, 349 aa] {ON} YMR146C ...    49   3e-05
Ecym_8317 Chr8 (648256..649527) [1272 bp, 423 aa] {ON} similar t...    49   3e-05
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    49   3e-05
YDR364C Chr4 complement(1202843..1204210) [1368 bp, 455 aa] {ON}...    49   3e-05
KNAG0M00450 Chr13 complement(65548..68523) [2976 bp, 991 aa] {ON...    50   3e-05
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    50   3e-05
KLLA0E11331g Chr5 complement(994770..996308) [1539 bp, 512 aa] {...    49   3e-05
NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {O...    49   3e-05
NCAS0H01060 Chr8 complement(197867..200875) [3009 bp, 1002 aa] {...    50   3e-05
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    50   3e-05
Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [conti...    49   4e-05
NCAS0D03330 Chr4 (623172..625046) [1875 bp, 624 aa] {ON} Anc_6.135     49   4e-05
ABL024W Chr2 (353682..355886) [2205 bp, 734 aa] {ON} Syntenic ho...    50   4e-05
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...    49   4e-05
KLTH0D12188g Chr4 (990209..991582) [1374 bp, 457 aa] {ON} simila...    49   4e-05
TPHA0E00770 Chr5 (154048..155115) [1068 bp, 355 aa] {ON} Anc_7.4...    49   4e-05
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    49   4e-05
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       49   4e-05
NDAI0F02240 Chr6 (542551..545610) [3060 bp, 1019 aa] {ON} Anc_6....    50   4e-05
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    49   4e-05
NDAI0K01410 Chr11 (321553..324486) [2934 bp, 977 aa] {ON} Anc_2....    49   4e-05
AFL009C Chr6 complement(420007..421248) [1242 bp, 413 aa] {ON} S...    49   4e-05
CAGL0J04818g Chr10 (458449..460413) [1965 bp, 654 aa] {ON} highl...    49   4e-05
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    49   4e-05
NCAS0B00430 Chr2 (57814..59280) [1467 bp, 488 aa] {ON} Anc_8.717...    49   5e-05
KLLA0C07513g Chr3 complement(656060..657379) [1320 bp, 439 aa] {...    49   5e-05
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....    49   5e-05
CAGL0K12188g Chr11 (1192017..1193624) [1608 bp, 535 aa] {ON} sim...    49   5e-05
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    49   6e-05
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    49   6e-05
Kwal_47.17465 s47 (415977..418379) [2403 bp, 800 aa] {ON} YBL008...    49   6e-05
ACR091W Chr3 (520609..521595) [987 bp, 328 aa] {ON} Syntenic hom...    48   6e-05
NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa] ...    49   6e-05
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    49   6e-05
KLLA0F22000g Chr6 complement(2044973..2047354) [2382 bp, 793 aa]...    49   7e-05
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...    48   7e-05
TDEL0A01730 Chr1 complement(310640..312433) [1794 bp, 597 aa] {O...    49   7e-05
Kpol_1050.33 s1050 complement(78024..80390) [2367 bp, 788 aa] {O...    49   7e-05
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    48   8e-05
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    49   8e-05
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    48   8e-05
AFL007C Chr6 complement(424004..425659) [1656 bp, 551 aa] {ON} S...    48   8e-05
KAFR0D03060 Chr4 (604145..606625) [2481 bp, 826 aa] {ON} Anc_2.4...    48   9e-05
Skud_7.160 Chr7 (294214..296055) [1842 bp, 613 aa] {ON} YGL116W ...    48   9e-05
Smik_7.286 Chr7 complement(482658..483911) [1254 bp, 417 aa] {ON...    48   1e-04
Kpol_2001.63 s2001 complement(171777..175607) [3831 bp, 1276 aa]...    48   1e-04
KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.1...    48   1e-04
Ecym_7373 Chr7 complement(776909..779269) [2361 bp, 786 aa] {ON}...    48   1e-04
NCAS0J01100 Chr10 (187994..189307) [1314 bp, 437 aa] {ON} Anc_4....    48   1e-04
Suva_11.205 Chr11 complement(381101..382348) [1248 bp, 415 aa] {...    48   1e-04
ZYRO0G02420g Chr7 (184509..186686) [2178 bp, 725 aa] {ON} simila...    48   1e-04
Kwal_33.13515 s33 (259533..260729) [1197 bp, 398 aa] {ON} YNL253...    47   1e-04
YOR212W Chr15 (742910..744181) [1272 bp, 423 aa] {ON}  STE4G pro...    47   1e-04
Skud_4.634 Chr4 complement(1131614..1132978) [1365 bp, 454 aa] {...    47   1e-04
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    48   1e-04
AGL301C Chr7 complement(137221..138306) [1086 bp, 361 aa] {ON} S...    47   1e-04
Ecym_7149 Chr7 (308042..309139) [1098 bp, 365 aa] {ON} similar t...    47   1e-04
Smik_11.233 Chr11 complement(384291..385538) [1248 bp, 415 aa] {...    47   1e-04
Kpol_1002.36 s1002 (110010..112229) [2220 bp, 739 aa] {ON} (1100...    48   1e-04
Smik_4.631 Chr4 complement(1128746..1130113) [1368 bp, 455 aa] {...    47   1e-04
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    47   1e-04
NCAS0A07850 Chr1 complement(1561758..1563596) [1839 bp, 612 aa] ...    48   1e-04
CAGL0C02937g Chr3 (290289..291692) [1404 bp, 467 aa] {ON} simila...    47   1e-04
KLLA0F07403g Chr6 (697593..698636) [1044 bp, 347 aa] {ON} simila...    47   1e-04
NDAI0A01560 Chr1 (352038..353129) [1092 bp, 363 aa] {ON} Anc_5.6...    47   1e-04
Ecym_6167 Chr6 complement(309181..310437) [1257 bp, 418 aa] {ON}...    47   1e-04
Skud_11.207 Chr11 complement(378222..379469) [1248 bp, 415 aa] {...    47   2e-04
TBLA0A01540 Chr1 complement(355418..357592) [2175 bp, 724 aa] {O...    47   2e-04
Kpol_1033.58 s1033 (147020..149881) [2862 bp, 953 aa] {ON} (1470...    47   2e-04
Ecym_2356 Chr2 complement(697428..698819) [1392 bp, 463 aa] {ON}...    47   2e-04
NCAS0F02050 Chr6 complement(409352..413923) [4572 bp, 1523 aa] {...    47   2e-04
YKL021C Chr11 complement(397344..398750) [1407 bp, 468 aa] {ON} ...    47   2e-04
NDAI0D02250 Chr4 complement(526907..529294) [2388 bp, 795 aa] {O...    47   2e-04
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    47   2e-04
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    46   2e-04
TPHA0A04810 Chr1 complement(1090373..1092751) [2379 bp, 792 aa] ...    47   3e-04
KLTH0E07700g Chr5 (705358..707778) [2421 bp, 806 aa] {ON} simila...    47   3e-04
KLTH0E15158g Chr5 (1346780..1348309) [1530 bp, 509 aa] {ON} simi...    47   3e-04
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    46   3e-04
ZYRO0A08184g Chr1 (655686..656726) [1041 bp, 346 aa] {ON} highly...    46   3e-04
YOR269W Chr15 (826385..827869) [1485 bp, 494 aa] {ON}  PAC1Prote...    46   3e-04
KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {O...    46   3e-04
KNAG0D03460 Chr4 (622817..624055) [1239 bp, 412 aa] {ON} Anc_4.1...    46   3e-04
KAFR0K01900 Chr11 complement(388463..389554) [1092 bp, 363 aa] {...    46   3e-04
ZYRO0G03168g Chr7 (241103..242923) [1821 bp, 606 aa] {ON} simila...    47   3e-04
Skud_15.434 Chr15 (765132..766616) [1485 bp, 494 aa] {ON} YOR269...    46   3e-04
NCAS0D01130 Chr4 (208915..209958) [1044 bp, 347 aa] {ON} Anc_2.3...    46   3e-04
ZYRO0D00616g Chr4 complement(47163..48347) [1185 bp, 394 aa] {ON...    46   3e-04
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    46   3e-04
Kwal_14.884 s14 complement(95068..96255) [1188 bp, 395 aa] {ON} ...    46   3e-04
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    46   3e-04
KNAG0A01610 Chr1 complement(84663..85270,85389..86376) [1596 bp,...    46   3e-04
TBLA0B09190 Chr2 (2171629..2172669) [1041 bp, 346 aa] {ON} Anc_2...    46   3e-04
Skud_2.302 Chr2 (549799..550803) [1005 bp, 334 aa] {ON} YBR175W ...    46   3e-04
Kpol_467.21 s467 (46346..48160) [1815 bp, 604 aa] {ON} (46346..4...    46   4e-04
Kwal_33.15475 s33 complement(1123396..1125747) [2352 bp, 783 aa]...    46   4e-04
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    46   4e-04
KLTH0D12276g Chr4 (998921..1000258) [1338 bp, 445 aa] {ON} highl...    46   4e-04
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    46   4e-04
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    46   4e-04
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    46   4e-04
ACR166W Chr3 (647933..649102) [1170 bp, 389 aa] {ON} Syntenic ho...    46   4e-04
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    46   4e-04
AER337W Chr5 (1256750..1258087) [1338 bp, 445 aa] {ON} Syntenic ...    46   4e-04
TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {O...    46   5e-04
Kpol_1018.164 s1018 (420666..423203) [2538 bp, 845 aa] {ON} (420...    46   5e-04
Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212...    45   5e-04
Kpol_1057.12 s1057 (22322..23515) [1194 bp, 397 aa] {ON} (22322....    45   5e-04
ZYRO0G11660g Chr7 (924314..926665) [2352 bp, 783 aa] {ON} simila...    46   5e-04
Smik_15.451 Chr15 (775983..777467) [1485 bp, 494 aa] {ON} YOR269...    45   5e-04
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    46   5e-04
NCAS0D04050 Chr4 (760598..762865) [2268 bp, 755 aa] {ON}               46   6e-04
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)    45   6e-04
NDAI0E00950 Chr5 complement(192199..193734) [1536 bp, 511 aa] {O...    45   6e-04
Skud_4.530 Chr4 complement(945231..946247) [1017 bp, 338 aa] {ON...    45   6e-04
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)    45   6e-04
SAKL0H22418g Chr8 complement(1951429..1952724) [1296 bp, 431 aa]...    45   7e-04
KAFR0B05030 Chr2 (1040952..1041998) [1047 bp, 348 aa] {ON} Anc_2...    45   7e-04
ZYRO0G10494g Chr7 complement(846835..848133) [1299 bp, 432 aa] {...    45   7e-04
Smik_4.518 Chr4 complement(935380..936372) [993 bp, 330 aa] {ON}...    45   7e-04
ADR176W Chr4 (1012411..1013796) [1386 bp, 461 aa] {ON} Syntenic ...    45   7e-04
CAGL0L10890g Chr12 (1165380..1166753) [1374 bp, 457 aa] {ON} hig...    45   7e-04
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    45   7e-04
CAGL0F07337g Chr6 complement(714870..716735) [1866 bp, 621 aa] {...    45   7e-04
CAGL0M13409g Chr13 complement(1317818..1322401) [4584 bp, 1527 a...    45   8e-04
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    45   8e-04
TBLA0B08980 Chr2 complement(2125687..2129208) [3522 bp, 1173 aa]...    45   8e-04
TPHA0I00460 Chr9 (89882..91564) [1683 bp, 560 aa] {ON} Anc_8.817...    45   8e-04
SAKL0H21846g Chr8 (1905888..1908134) [2247 bp, 748 aa] {ON} simi...    45   8e-04
TDEL0E04900 Chr5 complement(913381..915738) [2358 bp, 785 aa] {O...    45   8e-04
KLTH0H05038g Chr8 complement(449230..452217) [2988 bp, 995 aa] {...    45   8e-04
TDEL0F02260 Chr6 (414020..415309) [1290 bp, 429 aa] {ON} Anc_4.1...    45   8e-04
Skud_15.379 Chr15 (681934..683211) [1278 bp, 425 aa] {ON} YOR212...    45   9e-04
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    45   9e-04
ACL116W Chr3 (140589..143003) [2415 bp, 804 aa] {ON} Syntenic ho...    45   9e-04
CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON...    45   0.001
KLTH0H06160g Chr8 complement(538741..540465) [1725 bp, 574 aa] {...    45   0.001
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    45   0.001
YDR267C Chr4 complement(1002510..1003502) [993 bp, 330 aa] {ON} ...    44   0.001
NDAI0H03030 Chr8 complement(733181..734233) [1053 bp, 350 aa] {O...    44   0.001
NDAI0D03490 Chr4 (820778..822079) [1302 bp, 433 aa] {ON} Anc_4.1...    45   0.001
TBLA0A03210 Chr1 complement(762289..764535) [2247 bp, 748 aa] {O...    45   0.001
KLLA0B14410g Chr2 (1264616..1266736) [2121 bp, 706 aa] {ON} simi...    45   0.001
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    45   0.001
Suva_8.318 Chr8 (565468..566961) [1494 bp, 497 aa] {ON} YOR269W ...    45   0.001
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    44   0.001
Ecym_7402 Chr7 complement(827224..829044) [1821 bp, 606 aa] {ON}...    45   0.001
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    44   0.001
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    44   0.001
Ecym_4433 Chr4 complement(893223..894923) [1701 bp, 566 aa] {ON}...    45   0.001
KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3....    45   0.001
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    44   0.001
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    44   0.001
ZYRO0F11374g Chr6 complement(934451..935983) [1533 bp, 510 aa] {...    44   0.001
TPHA0K01570 Chr11 (329273..330553) [1281 bp, 426 aa] {ON} Anc_4....    44   0.001
KLTH0F14344g Chr6 (1177844..1179556) [1713 bp, 570 aa] {ON} high...    44   0.001
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    44   0.001
Kwal_47.17572 s47 complement(461322..462626) [1305 bp, 434 aa] {...    44   0.001
KAFR0A06490 Chr1 complement(1314794..1316098) [1305 bp, 434 aa] ...    44   0.001
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    45   0.001
Suva_8.265 Chr8 (481783..483054) [1272 bp, 423 aa] {ON} YOR212W ...    44   0.001
KLTH0H15752g Chr8 complement(1359449..1360501) [1053 bp, 350 aa]...    44   0.001
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    44   0.002
KNAG0F00620 Chr6 (105380..106768) [1389 bp, 462 aa] {ON} Anc_1.1...    44   0.002
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)    44   0.002
SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {...    44   0.002
CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa] ...    44   0.002
SAKL0E05368g Chr5 complement(444630..445679) [1050 bp, 349 aa] {...    44   0.002
TDEL0G03100 Chr7 (582165..583205) [1041 bp, 346 aa] {ON} Anc_2.3...    44   0.002
Kwal_47.17310 s47 (345235..346896) [1662 bp, 553 aa] {ON} YER124...    44   0.002
Suva_2.435 Chr2 complement(769135..770127) [993 bp, 330 aa] {ON}...    44   0.002
YER107C Chr5 complement(373448..374545) [1098 bp, 365 aa] {ON}  ...    44   0.002
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    44   0.002
YER066W Chr5 (290242..290799) [558 bp, 185 aa] {ON}  RRT13Putati...    42   0.002
KLTH0D10186g Chr4 (845352..846617) [1266 bp, 421 aa] {ON} simila...    44   0.002
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...    44   0.002
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...    44   0.002
SAKL0D02068g Chr4 (167213..168823) [1611 bp, 536 aa] {ON} simila...    44   0.002
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    44   0.002
Smik_13.344 Chr13 complement(540043..541086) [1044 bp, 347 aa] {...    43   0.002
KLLA0F13772g Chr6 (1276532..1278094) [1563 bp, 520 aa] {ON} high...    44   0.002
Kwal_26.8953 s26 (1017811..1019187) [1377 bp, 458 aa] {ON} YOR26...    44   0.002
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    44   0.002
KAFR0A04550 Chr1 complement(901244..903100) [1857 bp, 618 aa] {O...    44   0.003
Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON} (77284....    43   0.003
KNAG0C04950 Chr3 (955701..957023) [1323 bp, 440 aa] {ON} Anc_5.4...    43   0.003
CAGL0L06952g Chr12 complement(782790..783833) [1044 bp, 347 aa] ...    43   0.003
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    44   0.003
Skud_13.307 Chr13 complement(530776..531819) [1044 bp, 347 aa] {...    43   0.003
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    43   0.003
CAGL0G00704g Chr7 (65805..67127) [1323 bp, 440 aa] {ON} similar ...    43   0.003
Suva_13.269 Chr13 complement(433166..435016) [1851 bp, 616 aa] {...    43   0.003
ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} simila...    43   0.003
TBLA0D03580 Chr4 complement(885182..887353) [2172 bp, 723 aa] {O...    43   0.003
Kwal_27.10785 s27 (495263..496366) [1104 bp, 367 aa] {ON} YER107...    43   0.003
CAGL0K00957g Chr11 (95657..98038) [2382 bp, 793 aa] {ON} similar...    43   0.003
YMR146C Chr13 complement(557481..558524) [1044 bp, 347 aa] {ON} ...    43   0.003
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    43   0.003
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...    43   0.004
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    43   0.004
AFL014C Chr6 complement(409496..411169) [1674 bp, 557 aa] {ON} S...    43   0.004
KAFR0D01700 Chr4 complement(339178..340785) [1608 bp, 535 aa] {O...    43   0.004
KNAG0J02560 Chr10 (482741..484294) [1554 bp, 517 aa] {ON} Anc_3....    43   0.004
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...    43   0.004
KLLA0F13750g Chr6 complement(1274110..1275972) [1863 bp, 620 aa]...    43   0.004
ZYRO0F16104g Chr6 complement(1322975..1324183) [1209 bp, 402 aa]...    42   0.004
KNAG0G03310 Chr7 complement(709092..710552) [1461 bp, 486 aa] {O...    43   0.004
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    43   0.004
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    43   0.004
SAKL0F12782g Chr6 complement(999031..1000134) [1104 bp, 367 aa] ...    42   0.004
Kwal_27.12586 s27 (1290276..1291805) [1530 bp, 509 aa] {ON} YBR1...    43   0.004
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    43   0.004
Skud_7.536 Chr7 complement(874704..877070) [2367 bp, 788 aa] {ON...    43   0.004
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    42   0.004
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    43   0.005
Kwal_26.8628 s26 (871377..872645) [1269 bp, 422 aa] {ON} YOR212W...    42   0.005
KLTH0B01628g Chr2 (129632..132004) [2373 bp, 790 aa] {ON} simila...    43   0.005
KAFR0A05270 Chr1 complement(1043260..1044975) [1716 bp, 571 aa] ...    42   0.005
Kpol_1050.100 s1050 (228171..229895) [1725 bp, 574 aa] {ON} (228...    42   0.005
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...    42   0.005
KLLA0F10791g Chr6 complement(991642..993279) [1638 bp, 545 aa] {...    42   0.005
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    42   0.005
KAFR0A07550 Chr1 (1523221..1524804) [1584 bp, 527 aa] {ON} Anc_2...    42   0.005
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    42   0.006
Suva_13.325 Chr13 complement(536805..537848) [1044 bp, 347 aa] {...    42   0.006
AGR367C Chr7 complement(1408852..1411167) [2316 bp, 771 aa] {ON}...    42   0.006
TPHA0G03110 Chr7 (661602..663428) [1827 bp, 608 aa] {ON} Anc_2.4...    42   0.006
SAKL0F03432g Chr6 complement(274302..276029) [1728 bp, 575 aa] {...    42   0.006
Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar t...    42   0.007
NCAS0A14470 Chr1 complement(2848835..2849923) [1089 bp, 362 aa] ...    42   0.007
Kpol_1044.27 s1044 complement(63632..65197) [1566 bp, 521 aa] {O...    42   0.007
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    42   0.007
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    42   0.007
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...    42   0.007
NDAI0H00820 Chr8 (185870..186940) [1071 bp, 356 aa] {ON} Anc_5.6...    42   0.008
KNAG0G00800 Chr7 (147792..150164) [2373 bp, 790 aa] {ON} Anc_5.1...    42   0.008
Kwal_14.1710 s14 (433526..435250) [1725 bp, 574 aa] {ON} YGL116W...    42   0.009
TDEL0D03660 Chr4 (671946..673298) [1353 bp, 450 aa] {ON} Anc_3.2...    42   0.009
TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON...    42   0.009
Suva_7.494 Chr7 complement(856266..858641) [2376 bp, 791 aa] {ON...    42   0.009
TBLA0C03990 Chr3 (960225..961538) [1314 bp, 437 aa] {ON} Anc_4.1...    42   0.009
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    42   0.010
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    42   0.010
NDAI0J01840 Chr10 (459174..460466) [1293 bp, 430 aa] {ON} Anc_4....    41   0.010
ZYRO0B04444g Chr2 complement(363742..365469) [1728 bp, 575 aa] {...    41   0.012
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...    41   0.012
TBLA0I00360 Chr9 (56206..57300) [1095 bp, 364 aa] {ON} Anc_7.405...    41   0.012
TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON} Anc_4...    41   0.012
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    42   0.012
CAGL0C01441g Chr3 complement(156930..159947) [3018 bp, 1005 aa] ...    41   0.013
CAGL0G03399g Chr7 complement(325879..326988) [1110 bp, 369 aa] {...    41   0.013
SAKL0G14432g Chr7 complement(1245508..1247877) [2370 bp, 789 aa]...    41   0.013
Smik_7.50 Chr7 complement(84865..86058) [1194 bp, 397 aa] {ON} Y...    41   0.013
SAKL0G08492g Chr7 (725684..727894) [2211 bp, 736 aa] {ON} simila...    41   0.014
KAFR0G01170 Chr7 (265249..267603) [2355 bp, 784 aa] {ON} Anc_5.1...    41   0.014
AFL006C Chr6 complement(425925..427226) [1302 bp, 433 aa] {ON} S...    41   0.014
Smik_16.106 Chr16 (194195..196564) [2370 bp, 789 aa] {ON} YGR200...    41   0.014
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...    41   0.015
NCAS0F02940 Chr6 complement(582657..584924) [2268 bp, 755 aa] {O...    41   0.016
TBLA0B08930 Chr2 complement(2117704..2119536) [1833 bp, 610 aa] ...    41   0.017
NCAS0A06510 Chr1 (1283824..1285056) [1233 bp, 410 aa] {ON} Anc_4...    40   0.017
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    41   0.017
KLLA0C07425g Chr3 complement(647673..649007) [1335 bp, 444 aa] {...    40   0.019
KLLA0E20703g Chr5 complement(1841092..1842207) [1116 bp, 371 aa]...    40   0.019
NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {O...    40   0.019
CAGL0K00275g Chr11 complement(26129..28276) [2148 bp, 715 aa] {O...    41   0.020
TBLA0H02380 Chr8 (568334..570721) [2388 bp, 795 aa] {ON} Anc_5.1...    41   0.020
TPHA0D04170 Chr4 (894124..895845) [1722 bp, 573 aa] {ON} Anc_3.4...    40   0.020
KLTH0E06930g Chr5 (637945..639609) [1665 bp, 554 aa] {ON} simila...    40   0.020
KNAG0E02020 Chr5 (416909..417949) [1041 bp, 346 aa] {ON} Anc_2.3...    40   0.020
NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {O...    41   0.020
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...    40   0.020
KLTH0C06358g Chr3 (556638..557741) [1104 bp, 367 aa] {ON} highly...    40   0.020
KLLA0E11177g Chr5 (983669..985150) [1482 bp, 493 aa] {ON} simila...    40   0.021
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...    40   0.021
KNAG0D02720 Chr4 complement(489642..494267) [4626 bp, 1541 aa] {...    41   0.021
KLLA0B12804g Chr2 (1117475..1120033) [2559 bp, 852 aa] {ON} simi...    40   0.022
TPHA0F00760 Chr6 (173015..174415) [1401 bp, 466 aa] {ON} Anc_4.1...    40   0.022
Kwal_55.21144 s55 (703153..704865) [1713 bp, 570 aa] {ON} YPR137...    40   0.022
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    40   0.022
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...    40   0.023
NCAS0A11750 Chr1 (2335605..2337320) [1716 bp, 571 aa] {ON} Anc_3...    40   0.023
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...    40   0.024
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    40   0.025
KLLA0A09471g Chr1 complement(827264..831784) [4521 bp, 1506 aa] ...    40   0.025
NDAI0A04540 Chr1 complement(1023305..1025011) [1707 bp, 568 aa] ...    40   0.025
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...    40   0.025
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    40   0.026
YHR186C Chr8 complement(475999..480672) [4674 bp, 1557 aa] {ON} ...    40   0.027
TBLA0E03320 Chr5 complement(831986..832945) [960 bp, 319 aa] {ON...    40   0.028
Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}...    40   0.028
Ecym_5334 Chr5 (679515..682574) [3060 bp, 1019 aa] {ON} similar ...    40   0.029
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    40   0.029
TPHA0J01890 Chr10 (430218..432287) [2070 bp, 689 aa] {ON} Anc_6....    40   0.030
Ecym_1039 Chr1 (72890..75073) [2184 bp, 727 aa] {ON} similar to ...    40   0.030
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    40   0.031
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    40   0.031
YGR200C Chr7 complement(899904..902270) [2367 bp, 788 aa] {ON}  ...    40   0.031
Kwal_56.23035 s56 complement(373146..374420) [1275 bp, 424 aa] {...    40   0.031
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    40   0.033
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    40   0.033
KNAG0A07760 Chr1 complement(1232666..1234366) [1701 bp, 566 aa] ...    40   0.034
TPHA0D02150 Chr4 complement(441410..443737) [2328 bp, 775 aa] {O...    40   0.034
CAGL0K03377g Chr11 complement(307358..310294) [2937 bp, 978 aa] ...    40   0.034
Skud_1.64 Chr1 (130376..131662) [1287 bp, 428 aa] {ON} YAR003W (...    40   0.035
KNAG0H01290 Chr8 (227947..229341) [1395 bp, 464 aa] {ON} Anc_3.2...    40   0.036
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...    39   0.037
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    40   0.037
TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON} Anc_8...    40   0.037
TBLA0A09070 Chr1 complement(2236928..2238094) [1167 bp, 388 aa] ...    39   0.038
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    40   0.039
KLTH0H01518g Chr8 (138469..139353) [885 bp, 294 aa] {ON} highly ...    39   0.039
Smik_13.276 Chr13 complement(435512..437359) [1848 bp, 615 aa] {...    40   0.039
Ecym_6170 Chr6 complement(316353..317675) [1323 bp, 440 aa] {ON}...    39   0.039
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    40   0.039
KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON...    40   0.042
Suva_15.389 Chr15 complement(680068..684735) [4668 bp, 1555 aa] ...    40   0.042
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    39   0.043
NCAS0A00740 Chr1 (143564..144946) [1383 bp, 460 aa] {ON} Anc_1.1...    39   0.043
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    39   0.043
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    39   0.044
Suva_1.74 Chr1 (131924..133210) [1287 bp, 428 aa] {ON} YAR003W (...    39   0.044
NCAS0A07270 Chr1 complement(1442956..1445355) [2400 bp, 799 aa] ...    40   0.044
Smik_8.275 Chr8 complement(450898..455568) [4671 bp, 1556 aa] {O...    40   0.049
YAR003W Chr1 (155005..156285) [1281 bp, 426 aa] {ON}  SWD1Subuni...    39   0.049
AAR102C Chr1 complement(526057..527832) [1776 bp, 591 aa] {ON} S...    39   0.051
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    39   0.051
Skud_13.248 Chr13 complement(425542..427389) [1848 bp, 615 aa] {...    39   0.052
SAKL0H22330g Chr8 complement(1943859..1945094) [1236 bp, 411 aa]...    39   0.052
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    39   0.053
Kpol_1025.38 s1025 (90229..90465,90467..91492) [1263 bp, 420 aa]...    39   0.053
TDEL0E02620 Chr5 (508356..510593) [2238 bp, 745 aa] {ON} Anc_5.3...    39   0.053
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    39   0.054
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    39   0.055
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    39   0.055
KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.4...    39   0.055
KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {...    39   0.055
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    39   0.055
Skud_11.108 Chr11 (200902..203460) [2559 bp, 852 aa] {ON} YKL121...    39   0.055
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    39   0.056
Kpol_2002.54 s2002 complement(118705..125166) [6462 bp, 2153 aa]...    39   0.057
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    39   0.059
ADR108C Chr4 complement(899198..900097) [900 bp, 299 aa] {ON} NO...    39   0.059
Smik_4.585 Chr4 complement(1040861..1043125) [2265 bp, 754 aa] {...    39   0.059
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...    39   0.060
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    39   0.061
KNAG0G02790 Chr7 (617832..619247) [1416 bp, 471 aa] {ON} Anc_8.7...    39   0.061
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    39   0.061
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    39   0.061
Kpol_1018.103 s1018 complement(268887..269966) [1080 bp, 359 aa]...    39   0.062
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    39   0.062
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    39   0.064
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    39   0.065
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    39   0.066
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...    39   0.066
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    39   0.067
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    39   0.067
TDEL0F03590 Chr6 (659038..660756) [1719 bp, 572 aa] {ON} Anc_3.4...    39   0.068
TPHA0O01610 Chr15 (319614..321224) [1611 bp, 536 aa] {ON} Anc_2....    39   0.068
Skud_8.252 Chr8 complement(444916..449586) [4671 bp, 1556 aa] {O...    39   0.069
Suva_11.103 Chr11 (200612..203182) [2571 bp, 856 aa] {ON} YKL121...    39   0.070
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9      39   0.071
TBLA0A05690 Chr1 (1412275..1413546) [1272 bp, 423 aa] {ON} Anc_1...    39   0.071
KLLA0D08371g Chr4 (710885..712411) [1527 bp, 508 aa] {ON} simila...    39   0.071
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     39   0.076
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    39   0.078
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    39   0.080
KLLA0C06633g Chr3 (580349..582244) [1896 bp, 631 aa] {ON} simila...    39   0.081
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    38   0.082
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    39   0.082
AER035W Chr5 (699524..702544) [3021 bp, 1006 aa] {ON} Syntenic h...    39   0.083
KNAG0C05420 Chr3 (1059879..1062236) [2358 bp, 785 aa] {ON} Anc_5...    39   0.086
Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247...    38   0.089
KLLA0A08800g Chr1 (770989..772308) [1320 bp, 439 aa] {ON} simila...    38   0.089
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    39   0.089
Smik_1.70 Chr1 (138173..139459) [1287 bp, 428 aa] {ON} YAR003W (...    38   0.091
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    38   0.099
TDEL0A01140 Chr1 complement(192604..194151) [1548 bp, 515 aa] {O...    38   0.099
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...    38   0.10 
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    38   0.10 
Skud_16.427 Chr16 (761681..763402) [1722 bp, 573 aa] {ON} YPR137...    38   0.10 
TBLA0D01190 Chr4 complement(301525..302820) [1296 bp, 431 aa] {O...    38   0.11 
Kpol_387.7 s387 (15235..16893) [1659 bp, 552 aa] {ON} (15235..16...    38   0.11 
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    39   0.11 
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    38   0.11 
ZYRO0C03190g Chr3 (245542..249363) [3822 bp, 1273 aa] {ON} simil...    39   0.11 
TPHA0G00720 Chr7 complement(136125..137672) [1548 bp, 515 aa] {O...    38   0.11 
Kpol_2001.68 s2001 complement(187786..188673) [888 bp, 295 aa] {...    38   0.11 
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...    38   0.11 
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    38   0.12 
KNAG0E02460 Chr5 complement(488247..490064) [1818 bp, 605 aa] {O...    38   0.12 
SAKL0C10098g Chr3 complement(909553..912489) [2937 bp, 978 aa] {...    38   0.12 
ZYRO0D10516g Chr4 (883922..886171) [2250 bp, 749 aa] {ON} simila...    38   0.12 
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    38   0.12 
CAGL0J06512g Chr10 complement(622640..624277) [1638 bp, 545 aa] ...    38   0.12 
KAFR0D04430 Chr4 (874649..876928) [2280 bp, 759 aa] {ON} Anc_5.3...    38   0.12 
Skud_4.592 Chr4 complement(1050634..1052892) [2259 bp, 752 aa] {...    38   0.13 
NDAI0H02250 Chr8 (546983..548821) [1839 bp, 612 aa] {ON} Anc_2.4...    38   0.13 
KLLA0F16038g Chr6 complement(1487475..1490063) [2589 bp, 862 aa]...    38   0.13 
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    38   0.13 
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    38   0.13 
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    38   0.13 
TDEL0C02650 Chr3 complement(460884..461978) [1095 bp, 364 aa] {O...    38   0.13 
TDEL0A02460 Chr1 (439489..441321) [1833 bp, 610 aa] {ON} Anc_2.4...    38   0.13 
KLTH0G15620g Chr7 complement(1363249..1366056) [2808 bp, 935 aa]...    38   0.13 
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    38   0.13 
TPHA0M00700 Chr13 complement(132140..135313) [3174 bp, 1057 aa] ...    38   0.13 
Kwal_26.7738 s26 (493416..495251) [1836 bp, 611 aa] {ON} YMR092C...    38   0.13 
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    38   0.14 
KLTH0C04378g Chr3 (381355..382860) [1506 bp, 501 aa] {ON} simila...    38   0.14 
Kpol_361.3 s361 complement(3792..5675) [1884 bp, 627 aa] {ON} co...    38   0.14 
Kwal_YGOB_27.12717 s27 (1347453..1348746,1348819..1349414) [1890...    38   0.14 
TPHA0G02940 Chr7 (631081..633837) [2757 bp, 918 aa] {ON} Anc_2.4...    38   0.15 
ZYRO0G20988g Chr7 complement(1723533..1726193) [2661 bp, 886 aa]...    38   0.15 
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...    37   0.15 
TBLA0C05340 Chr3 complement(1293851..1295560) [1710 bp, 569 aa] ...    38   0.16 
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    37   0.16 
KNAG0E02400 Chr5 (477698..480430) [2733 bp, 910 aa] {ON} Anc_2.4...    38   0.16 
TDEL0A04820 Chr1 (848835..849815) [981 bp, 326 aa] {ON} Anc_5.61...    37   0.16 
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    37   0.17 
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...    37   0.17 
TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {O...    37   0.17 
KAFR0A04080 Chr1 (820402..821889) [1488 bp, 495 aa] {ON} Anc_8.7...    37   0.17 
Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,...    37   0.18 
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    37   0.19 
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...    37   0.19 
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    37   0.19 
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    37   0.20 
Kpol_1061.35 s1061 (98864..100180) [1317 bp, 438 aa] {ON} (98864...    37   0.21 
TDEL0G00730 Chr7 (147888..152492) [4605 bp, 1534 aa] {ON} Anc_5....    37   0.21 
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    37   0.21 
Skud_5.232 Chr5 complement(369506..370603) [1098 bp, 365 aa] {ON...    37   0.21 
Kwal_56.23207 s56 (446947..449748) [2802 bp, 933 aa] {ON} YOL087...    37   0.21 
Ecym_5599 Chr5 complement(1220881..1221930) [1050 bp, 349 aa] {O...    37   0.22 
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...    37   0.22 
KLLA0F21076g Chr6 (1966373..1969036) [2664 bp, 887 aa] {ON} weak...    37   0.22 
TDEL0D05080 Chr4 (924017..927007) [2991 bp, 996 aa] {ON} Anc_3.1...    37   0.23 
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    37   0.24 
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    37   0.24 
TPHA0D04480 Chr4 complement(970967..974989) [4023 bp, 1340 aa] {...    37   0.24 
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    37   0.24 
ZYRO0B03652g Chr2 complement(301728..302804) [1077 bp, 358 aa] {...    37   0.25 
Suva_14.89 Chr14 (164766..166034) [1269 bp, 422 aa] {ON} YNL253W...    37   0.25 
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    37   0.25 
KAFR0E02470 Chr5 complement(503462..505351) [1890 bp, 629 aa] {O...    37   0.25 
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    37   0.26 
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    37   0.26 
Kwal_23.4327 s23 (670568..675208) [4641 bp, 1546 aa] {ON} YHR186...    37   0.26 
TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.4...    37   0.27 
ABL141C Chr2 complement(131670..133226) [1557 bp, 518 aa] {ON} S...    37   0.27 
TPHA0J01070 Chr10 complement(249880..251535) [1656 bp, 551 aa] {...    37   0.27 
TBLA0J01290 Chr10 (294789..296456) [1668 bp, 555 aa] {ON} Anc_7....    37   0.28 
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    37   0.29 
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    37   0.29 
Suva_13.43 Chr13 (68221..68556,68574..69404) [1167 bp, 388 aa] {...    37   0.29 
Smik_16.383 Chr16 (679641..681362) [1722 bp, 573 aa] {ON} YPR137...    37   0.30 
Smik_5.253 Chr5 complement(382390..383487) [1098 bp, 365 aa] {ON...    37   0.30 
KLTH0B07040g Chr2 (567756..569276) [1521 bp, 506 aa] {ON} simila...    37   0.31 
Smik_4.265 Chr4 complement(483300..484820) [1521 bp, 506 aa] {ON...    37   0.31 
Suva_16.464 Chr16 (804728..806449) [1722 bp, 573 aa] {ON} YPR137...    37   0.31 
KLTH0F01166g Chr6 (90708..92939) [2232 bp, 743 aa] {ON} similar ...    37   0.31 
TBLA0E03460 Chr5 (859536..863192) [3657 bp, 1218 aa] {ON} Anc_3....    37   0.32 
Ecym_2240 Chr2 (470406..473900) [3495 bp, 1164 aa] {ON} similar ...    37   0.32 
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    37   0.33 
KAFR0B01580 Chr2 (298942..303528) [4587 bp, 1528 aa] {ON} Anc_5....    37   0.33 
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    37   0.33 
KLLA0C09262g Chr3 (805512..807188) [1677 bp, 558 aa] {ON} highly...    37   0.34 
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    37   0.34 
TPHA0A05040 Chr1 (1137120..1138359,1138450..1139051) [1842 bp, 6...    37   0.34 
NDAI0H02330 Chr8 complement(564240..567221) [2982 bp, 993 aa] {O...    37   0.34 
KLLA0B11077g Chr2 complement(970761..972464) [1704 bp, 567 aa] {...    37   0.35 
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    37   0.35 
Skud_7.55 Chr7 complement(95372..96565) [1194 bp, 397 aa] {ON} Y...    36   0.37 
Suva_7.48 Chr7 complement(86451..87644) [1194 bp, 397 aa] {ON} Y...    36   0.37 
AER280C Chr5 complement(1148956..1150488) [1533 bp, 510 aa] {ON}...    36   0.37 
YKL121W Chr11 (214142..216700) [2559 bp, 852 aa] {ON}  DGR2Prote...    37   0.38 
Kpol_1061.6 s1061 complement(19407..20762) [1356 bp, 451 aa] {ON...    36   0.39 
Kpol_513.12 s513 complement(32164..36762) [4599 bp, 1532 aa] {ON...    37   0.39 
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    36   0.39 
TDEL0C05940 Chr3 complement(1070975..1072264) [1290 bp, 429 aa] ...    36   0.40 
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    37   0.40 
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    36   0.40 
TPHA0N01070 Chr14 complement(224464..225525) [1062 bp, 353 aa] {...    36   0.40 
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    37   0.41 
YPR137W Chr16 (802359..804080) [1722 bp, 573 aa] {ON}  RRP9Prote...    36   0.41 
YGL213C Chr7 complement(90054..91247) [1194 bp, 397 aa] {ON}  SK...    36   0.42 
KNAG0K00850 Chr11 complement(159329..162832) [3504 bp, 1167 aa] ...    37   0.42 
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    36   0.44 
KAFR0C03870 Chr3 (783131..784120) [990 bp, 329 aa] {ON} Anc_2.65...    36   0.45 
NCAS0F00640 Chr6 complement(123774..124396,124484..125543) [1683...    36   0.46 
ZYRO0B15268g Chr2 complement(1243795..1244396,1244475..1245684) ...    36   0.46 
YDR324C Chr4 complement(1114433..1116763) [2331 bp, 776 aa] {ON}...    36   0.47 
Suva_11.210 Chr11 (387997..388986) [990 bp, 329 aa] {ON} YKL018W...    36   0.48 
Skud_11.211 Chr11 (384964..385953) [990 bp, 329 aa] {ON} YKL018W...    36   0.48 
Suva_2.495 Chr2 complement(871929..874187) [2259 bp, 752 aa] {ON...    36   0.49 
NCAS0H03270 Chr8 (628484..630904) [2421 bp, 806 aa] {ON} Anc_2.6...    36   0.51 
KNAG0B03930 Chr2 complement(756034..757881) [1848 bp, 615 aa] {O...    36   0.51 
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    36   0.51 
CAGL0L02761g Chr12 complement(322823..324082) [1260 bp, 419 aa] ...    36   0.53 
Kwal_14.1235 s14 complement(247700..249523) [1824 bp, 607 aa] {O...    36   0.53 
KLTH0D05368g Chr4 (479606..481438) [1833 bp, 610 aa] {ON} simila...    36   0.53 
YKL018W Chr11 (404102..405091) [990 bp, 329 aa] {ON}  SWD2Subuni...    35   0.54 
ZYRO0A03234g Chr1 (258942..260183) [1242 bp, 413 aa] {ON} simila...    36   0.55 
TDEL0H01690 Chr8 (289748..291382) [1635 bp, 544 aa] {ON} Anc_7.2...    36   0.56 
Kwal_55.20233 s55 (311887..314130) [2244 bp, 747 aa] {ON} YDR324...    36   0.59 
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    36   0.60 
CAGL0F01837g Chr6 (181178..182980) [1803 bp, 600 aa] {ON} simila...    36   0.61 
Kwal_47.17093 s47 complement(245346..246860) [1515 bp, 504 aa] {...    36   0.62 
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    36   0.62 
Smik_11.237 Chr11 (391046..392035) [990 bp, 329 aa] {ON} YKL018W...    35   0.65 
Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782...    36   0.65 
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...    35   0.66 
KLLA0F26653g Chr6 (2461876..2464251) [2376 bp, 791 aa] {ON} simi...    36   0.69 
YML102W Chr13 (68294..69700) [1407 bp, 468 aa] {ON}  CAC2Subunit...    35   0.71 
Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa...    35   0.72 
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    35   0.73 
TDEL0C02130 Chr3 (366855..368435) [1581 bp, 526 aa] {ON} Anc_7.3...    35   0.73 
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    35   0.74 
Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON...    35   0.75 
KLTH0E08184g Chr5 complement(751459..752772) [1314 bp, 437 aa] {...    35   0.76 
TDEL0F03510 Chr6 complement(647165..648505) [1341 bp, 446 aa] {O...    35   0.77 
Kwal_33.13148 s33 (94593..96614) [2022 bp, 673 aa] {ON} YCL039W ...    35   0.79 
NCAS0A09060 Chr1 (1793006..1793854) [849 bp, 282 aa] {ON} Anc_1....    35   0.79 
ABL043W Chr2 (314670..316490) [1821 bp, 606 aa] {ON} Syntenic ho...    35   0.80 
KLTH0F02948g Chr6 (254134..255333) [1200 bp, 399 aa] {ON} weakly...    35   0.82 
Smik_15.69 Chr15 complement(118407..121760) [3354 bp, 1117 aa] {...    35   0.83 
KLTH0B04136g Chr2 complement(335902..338352) [2451 bp, 816 aa] {...    35   0.84 
Skud_4.283 Chr4 complement(493677..495191) [1515 bp, 504 aa] {ON...    35   0.85 
CAGL0J07854g Chr10 complement(767587..768885) [1299 bp, 432 aa] ...    35   0.86 
Suva_5.228 Chr5 complement(347755..348852) [1098 bp, 365 aa] {ON...    35   0.86 
TPHA0I01180 Chr9 (274330..276999) [2670 bp, 889 aa] {ON} Anc_1.3...    35   0.88 
Kwal_27.10385 s27 (317980..319590) [1611 bp, 536 aa] {ON} YML102...    35   0.91 
KAFR0D03800 Chr4 complement(735667..736953) [1287 bp, 428 aa] {O...    35   0.92 
TBLA0A02500 Chr1 complement(599925..601844) [1920 bp, 639 aa] {O...    35   0.92 
TBLA0A10190 Chr1 complement(2515833..2518256) [2424 bp, 807 aa] ...    35   0.95 
Ecym_4649 Chr4 (1264219..1265784) [1566 bp, 521 aa] {ON} similar...    35   0.95 
KAFR0C01310 Chr3 (268850..271888) [3039 bp, 1012 aa] {ON} Anc_3....    35   0.97 
KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa] ...    35   0.97 
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...    35   0.98 
CAGL0J01287g Chr10 (120215..122047) [1833 bp, 610 aa] {ON} simil...    35   0.98 
KNAG0A07390 Chr1 complement(1156310..1157542) [1233 bp, 410 aa] ...    35   1.0  
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    35   1.0  
NCAS0B01020 Chr2 complement(161030..162634) [1605 bp, 534 aa] {O...    35   1.0  
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    35   1.0  
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    35   1.1  
Kwal_47.18825 s47 complement(989263..991137) [1875 bp, 624 aa] {...    35   1.1  
SAKL0H24530g Chr8 complement(2127253..2128998) [1746 bp, 581 aa]...    35   1.1  
KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly...    35   1.1  
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    35   1.1  
KAFR0A04420 Chr1 complement(881701..882768) [1068 bp, 355 aa] {O...    35   1.1  
CAGL0L04950g Chr12 complement(564488..566905) [2418 bp, 805 aa] ...    35   1.1  
Suva_2.303 Chr2 complement(535706..536839) [1134 bp, 377 aa] {ON...    35   1.2  
TPHA0D04530 Chr4 complement(988612..989496) [885 bp, 294 aa] {ON...    34   1.2  
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    35   1.3  
KNAG0I01650 Chr9 (324016..325590) [1575 bp, 524 aa] {ON} Anc_1.3...    35   1.3  
KLLA0D13222g Chr4 complement(1132067..1134277) [2211 bp, 736 aa]...    35   1.3  
KNAG0F02280 Chr6 complement(432897..433967) [1071 bp, 356 aa] {O...    34   1.3  
ZYRO0G02618g Chr7 (201987..204629) [2643 bp, 880 aa] {ON} simila...    35   1.3  
KLLA0B07667g Chr2 (667863..673862) [6000 bp, 1999 aa] {ON} some ...    35   1.4  
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    34   1.4  
CAGL0I07073g Chr9 complement(681102..682283) [1182 bp, 393 aa] {...    34   1.4  
Ecym_2075 Chr2 (127773..129054,129182..129780) [1881 bp, 626 aa]...    35   1.4  
KNAG0G00350 Chr7 complement(57717..61508) [3792 bp, 1263 aa] {ON...    35   1.5  
TBLA0B04680 Chr2 complement(1095348..1099997) [4650 bp, 1549 aa]...    35   1.5  
Kpol_1055.2 s1055 complement(663..2915) [2253 bp, 750 aa] {ON} c...    35   1.5  
Kpol_1036.22 s1036 (54759..57860) [3102 bp, 1033 aa] {ON} (54759...    35   1.5  
NDAI0C04390 Chr3 complement(993861..996212) [2352 bp, 783 aa] {O...    35   1.5  
KAFR0B04210 Chr2 (874621..875803,875906..876507) [1785 bp, 594 a...    34   1.5  
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    35   1.5  
ABR101C Chr2 complement(567358..569841) [2484 bp, 827 aa] {ON} S...    35   1.5  
CAGL0J11286g Chr10 (1097912..1099498) [1587 bp, 528 aa] {ON} sim...    34   1.6  
KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.3...    34   1.6  
ZYRO0D11616g Chr4 (977141..978928) [1788 bp, 595 aa] {ON} simila...    34   1.7  
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    35   1.7  
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    35   1.7  
CAGL0D04884g Chr4 (475678..477369) [1692 bp, 563 aa] {ON} highly...    34   1.7  
Ecym_8393 Chr8 complement(805739..807394) [1656 bp, 551 aa] {ON}...    34   1.8  
Suva_2.181 Chr2 complement(312873..314396) [1524 bp, 507 aa] {ON...    34   1.8  
SAKL0B01540g Chr2 (150043..151752) [1710 bp, 569 aa] {ON} simila...    34   1.8  
Kpol_1050.55 s1050 complement(123375..124733) [1359 bp, 452 aa] ...    34   1.8  
SAKL0B11836g Chr2 complement(1020766..1023195) [2430 bp, 809 aa]...    34   1.9  
KLLA0E13553g Chr5 complement(1195444..1197186) [1743 bp, 580 aa]...    34   1.9  
Smik_4.386 Chr4 complement(701174..702304) [1131 bp, 376 aa] {ON...    34   1.9  
NDAI0C06420 Chr3 complement(1486617..1488686) [2070 bp, 689 aa] ...    34   1.9  
Smik_2.423 Chr2 complement(750642..753278) [2637 bp, 878 aa] {ON...    34   1.9  
TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.4...    34   2.0  
NDAI0C03540 Chr3 complement(810904..815580) [4677 bp, 1558 aa] {...    34   2.0  
KLLA0F08811g Chr6 complement(819834..821744) [1911 bp, 636 aa] {...    34   2.0  
Kpol_1050.56 s1050 (126134..127528,127531..127563,127565..128245...    34   2.0  
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    34   2.0  
YGR225W Chr7 (945145..946327,946421..947019) [1782 bp, 593 aa] {...    34   2.1  
Suva_3.173 Chr3 (262525..262587,262614..264791) [2241 bp, 746 aa...    34   2.1  
KNAG0A06340 Chr1 (967160..970114) [2955 bp, 984 aa] {ON} Anc_2.4...    34   2.1  
Skud_12.121 Chr12 complement(236234..238000) [1767 bp, 588 aa] {...    34   2.1  
Kpol_1057.7 s1057 complement(16034..17017) [984 bp, 327 aa] {ON}...    33   2.1  
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    34   2.2  
Kwal_33.14971 s33 (896070..898526) [2457 bp, 818 aa] {ON} YMR049...    34   2.3  
TBLA0G03080 Chr7 complement(817595..818923) [1329 bp, 442 aa] {O...    34   2.3  
NDAI0I01360 Chr9 complement(331085..332122) [1038 bp, 345 aa] {O...    33   2.3  
CAGL0J03564g Chr10 (340647..343736) [3090 bp, 1029 aa] {ON} simi...    34   2.3  
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    34   2.4  
Suva_13.218 Chr13 complement(352704..355115) [2412 bp, 803 aa] {...    34   2.4  
YDR030C Chr4 complement(501753..503273) [1521 bp, 506 aa] {ON}  ...    33   2.5  
AFR715C Chr6 complement(1753288..1755438) [2151 bp, 716 aa] {ON}...    34   2.5  
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    33   2.5  
KLLA0A01650g Chr1 complement(146030..147235) [1206 bp, 401 aa] {...    33   2.6  
SAKL0H01628g Chr8 (168606..173270) [4665 bp, 1554 aa] {ON} simil...    34   2.6  
NDAI0A03090 Chr1 (692473..694143) [1671 bp, 556 aa] {ON} Anc_7.2...    33   2.7  
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...    33   2.7  
Smik_3.37 Chr3 (53956..56256) [2301 bp, 766 aa] {ON} YCL039W (REAL)    33   2.7  
Ecym_5584 Chr5 complement(1199282..1200238) [957 bp, 318 aa] {ON...    33   2.9  
ZYRO0C08976g Chr3 complement(684862..686514) [1653 bp, 550 aa] {...    33   2.9  
KAFR0D01020 Chr4 (210874..212490) [1617 bp, 538 aa] {ON} Anc_8.4...    33   2.9  
KLTH0E15026g Chr5 (1331171..1335730) [4560 bp, 1519 aa] {ON} sim...    34   2.9  
TBLA0B04670 Chr2 (1088358..1089392) [1035 bp, 344 aa] {ON} Anc_6...    33   2.9  
KLTH0B08800g Chr2 complement(712793..717340) [4548 bp, 1515 aa] ...    33   3.0  
SAKL0A05962g Chr1 complement(543144..544184) [1041 bp, 346 aa] {...    33   3.0  
ZYRO0F00616g Chr6 (54556..56964) [2409 bp, 802 aa] {ON} similar ...    33   3.0  
Kpol_401.8 s401 (21214..22521) [1308 bp, 435 aa] {ON} (21214..22...    33   3.0  
Suva_7.519 Chr7 (900889..901503) [615 bp, 205 aa] {ON} YGR225W (...    33   3.1  
NCAS0D03490 Chr4 (650325..651362) [1038 bp, 345 aa] {ON} Anc_6.159     33   3.1  
TPHA0J02880 Chr10 (639057..640961) [1905 bp, 634 aa] {ON} Anc_5....    33   3.2  
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    33   3.2  
TDEL0F02220 Chr6 (406232..407542) [1311 bp, 436 aa] {ON} Anc_4.1...    33   3.3  
Suva_4.541 Chr4 complement(937148..939775) [2628 bp, 875 aa] {ON...    33   3.3  
TDEL0B07520 Chr2 complement(1320439..1321422) [984 bp, 327 aa] {...    33   3.3  
Kpol_262.1 s262 (224..2131) [1908 bp, 635 aa] {ON} (224..2131) [...    33   3.3  
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...    33   3.4  
TDEL0B03950 Chr2 complement(709272..710306) [1035 bp, 344 aa] {O...    33   3.4  
Skud_16.142 Chr16 complement(261333..262718) [1386 bp, 461 aa] {...    33   3.4  
AFR398W Chr6 (1152597..1154414) [1818 bp, 605 aa] {ON} Syntenic ...    33   3.5  
SAKL0C01188g Chr3 (104624..106948) [2325 bp, 774 aa] {ON} simila...    33   3.5  
CAGL0M01430g Chr13 (164428..166683) [2256 bp, 751 aa] {ON} highl...    33   3.5  
Skud_15.66 Chr15 complement(114566..117898) [3333 bp, 1110 aa] {...    33   3.6  
KLTH0C01848g Chr3 complement(165526..166121,166518..167517) [159...    33   3.7  
KNAG0B02670 Chr2 (517131..518042) [912 bp, 303 aa] {ON} Anc_7.33...    33   3.7  
SAKL0E03058g Chr5 complement(251271..253112) [1842 bp, 613 aa] {...    33   3.8  
ZYRO0G13596g Chr7 complement(1084499..1085908) [1410 bp, 469 aa]...    33   3.9  
TPHA0A05850 Chr1 (1327076..1328374) [1299 bp, 432 aa] {ON} Anc_3...    33   4.0  
KNAG0A07770 Chr1 complement(1234601..1237447) [2847 bp, 948 aa] ...    33   4.1  
ADL383W Chr4 (37143..38330) [1188 bp, 395 aa] {ON} Syntenic homo...    33   4.1  
YMR049C Chr13 complement(368094..370517) [2424 bp, 807 aa] {ON} ...    33   4.1  
Suva_10.139 Chr10 complement(252982..254748) [1767 bp, 588 aa] {...    33   4.1  
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    33   4.1  
KAFR0D00320 Chr4 (46078..48531) [2454 bp, 817 aa] {ON} Anc_1.34 ...    33   4.2  
Skud_13.205 Chr13 complement(349265..351682) [2418 bp, 805 aa] {...    33   4.3  
Smik_13.219 Chr13 complement(356393..358813) [2421 bp, 806 aa] {...    33   4.3  
ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {...    33   4.3  
TPHA0E03760 Chr5 complement(791726..794116) [2391 bp, 796 aa] {O...    33   4.3  
ZYRO0F17842g Chr6 complement(1477727..1480000) [2274 bp, 757 aa]...    33   4.3  
Kpol_309.6 s309 complement(10739..12673) [1935 bp, 644 aa] {ON} ...    33   4.4  
Suva_16.415 Chr16 complement(715808..717157) [1350 bp, 449 aa] {...    33   4.4  
KLLA0E18877g Chr5 complement(1676876..1680310) [3435 bp, 1144 aa...    33   4.4  
NDAI0E02190 Chr5 complement(450769..453492) [2724 bp, 907 aa] {O...    33   4.4  
AFR634W Chr6 (1594214..1595686) [1473 bp, 490 aa] {ON} Syntenic ...    33   4.5  
Skud_16.374 Chr16 complement(672714..674045) [1332 bp, 443 aa] {...    33   4.5  
Skud_7.561 Chr7 (920014..921196,921300..921898) [1782 bp, 593 aa...    33   4.5  
Smik_12.117 Chr12 complement(232159..233895) [1737 bp, 578 aa] {...    33   4.5  
TBLA0B07430 Chr2 complement(1767976..1768574,1768681..1770475) [...    33   4.7  
YOL087C Chr15 complement(155287..158637) [3351 bp, 1116 aa] {ON}...    33   4.8  
KAFR0F04190 Chr6 (822926..824110) [1185 bp, 394 aa] {ON} Anc_3.5...    33   4.9  
KLTH0H11000g Chr8 complement(943669..946260) [2592 bp, 863 aa] {...    33   5.0  
KAFR0H02680 Chr8 (507660..510239) [2580 bp, 859 aa] {ON} Anc_8.6...    33   5.0  
KNAG0H00220 Chr8 (32961..33944) [984 bp, 327 aa] {ON} Anc_2.657 ...    32   5.0  
Ecym_2274 Chr2 (539468..540592) [1125 bp, 374 aa] {ON} similar t...    32   5.1  
TDEL0B07060 Chr2 complement(1243893..1246289) [2397 bp, 798 aa] ...    33   5.1  
Kwal_0.40 s0 complement(16823..19411) [2589 bp, 862 aa] {ON} YBR...    33   5.2  
TPHA0N01540 Chr14 complement(335055..337412) [2358 bp, 785 aa] {...    33   5.2  
YBR281C Chr2 complement(764970..767606) [2637 bp, 878 aa] {ON}  ...    33   5.4  
YCL039W Chr3 (52645..54882) [2238 bp, 745 aa] {ON}  GID7Protein ...    33   5.4  
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    33   5.6  
NCAS0A07160 Chr1 complement(1419393..1420385) [993 bp, 330 aa] {...    32   5.7  
YDR142C Chr4 complement(740473..741600) [1128 bp, 375 aa] {ON}  ...    32   5.8  
NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa] ...    32   5.9  
Skud_4.423 Chr4 (754186..755523) [1338 bp, 445 aa] {ON} YDR165W ...    32   6.0  
Skud_3.23 Chr3 (40457..42805) [2349 bp, 782 aa] {ON} YCL039W (REAL)    33   6.0  
KLLA0D09086g Chr4 (763408..764607) [1200 bp, 399 aa] {ON} weakly...    32   6.1  
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    32   6.1  
KNAG0I02870 Chr9 (558973..562131) [3159 bp, 1052 aa] {ON} Anc_6....    33   6.1  
TPHA0L02130 Chr12 complement(441224..445750) [4527 bp, 1508 aa] ...    33   6.1  
ADL135C Chr4 complement(454163..454761,454819..456085) [1866 bp,...    32   6.4  
TBLA0B08220 Chr2 complement(1962086..1963405) [1320 bp, 439 aa] ...    32   6.4  
TDEL0A02260 Chr1 (409508..412027) [2520 bp, 839 aa] {ON} Anc_2.4...    32   6.7  
NDAI0A02880 Chr1 (644069..647938) [3870 bp, 1289 aa] {ON} Anc_7....    32   6.9  
Ecym_2287 Chr2 (558921..561386) [2466 bp, 821 aa] {ON} similar t...    32   7.2  
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    32   7.3  
NDAI0A00340 Chr1 (50320..53166) [2847 bp, 948 aa] {ON} Anc_1.34 ...    32   7.3  
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    32   7.4  
Smik_5.221 Chr5 complement(332843..334507) [1665 bp, 554 aa] {ON...    32   7.6  
CAGL0K02277g Chr11 (203760..205463) [1704 bp, 567 aa] {ON} simil...    32   7.7  
KAFR0C04130 Chr3 (825105..827501) [2397 bp, 798 aa] {ON} Anc_2.6...    32   7.8  
NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.3...    32   7.8  
KLLA0F06754g Chr6 complement(650475..651509) [1035 bp, 344 aa] {...    32   8.0  
Skud_2.412 Chr2 complement(733900..736536) [2637 bp, 878 aa] {ON...    32   8.0  
SAKL0H07832g Chr8 (669398..671995) [2598 bp, 865 aa] {ON} simila...    32   8.3  
KLTH0G18348g Chr7 (1581039..1582844) [1806 bp, 601 aa] {ON} simi...    32   8.3  
KAFR0L01120 Chr12 complement(211027..212679) [1653 bp, 550 aa] {...    32   8.4  
Kpol_530.39 s530 (90456..91340) [885 bp, 294 aa] {ON} (90456..91...    32   8.4  
TBLA0D03080 Chr4 (741949..748887) [6939 bp, 2312 aa] {ON} Anc_1....    32   8.6  
NDAI0B02760 Chr2 complement(694100..697327) [3228 bp, 1075 aa] {...    32   8.6  
Smik_11.117 Chr11 (199819..202362) [2544 bp, 847 aa] {ON} YKL121...    32   9.0  
KLLA0C01177g Chr3 (89978..92131) [2154 bp, 717 aa] {ON} similar ...    32   9.2  
TDEL0B00800 Chr2 (152025..153452) [1428 bp, 475 aa] {ON} Anc_8.8...    32   9.4  
CAGL0J10340g Chr10 complement(1010761..1011777) [1017 bp, 338 aa...    32   9.5  
NCAS0H00700 Chr8 (125259..126152) [894 bp, 297 aa] {ON} Anc_7.33...    32   9.5  
Skud_5.201 Chr5 complement(318460..320142) [1683 bp, 560 aa] {ON...    32   9.6  
Suva_5.195 Chr5 complement(298871..300550) [1680 bp, 559 aa] {ON...    32   9.7  
NCAS0H03450 Chr8 complement(653985..654968) [984 bp, 327 aa] {ON...    32   9.7  
Smik_2.377 Chr2 complement(671569..672723) [1155 bp, 384 aa] {ON...    32   9.9  
TDEL0G01280 Chr7 complement(258957..259555,259626..260934) [1908...    32   9.9  
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    32   10.0 

>Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON}
           (189457..192267) [2811 nt, 937 aa]
          Length = 936

 Score = 1838 bits (4761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 904/936 (96%), Positives = 904/936 (96%)

Query: 1   MVKSYQRFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISV 60
           MVKSYQRFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISV
Sbjct: 1   MVKSYQRFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISV 60

Query: 61  LSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKS 120
           LSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKS
Sbjct: 61  LSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKS 120

Query: 121 AITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVSTSK 180
           AITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVSTSK
Sbjct: 121 AITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVSTSK 180

Query: 181 DGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKEAGSKLI 240
           DGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKEAGSKLI
Sbjct: 181 DGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKEAGSKLI 240

Query: 241 EKGVYDKQSKQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRIRREEEISKAXXXXXXXXX 300
           EKGVYDKQSKQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRIRREEEISKA         
Sbjct: 241 EKGVYDKQSKQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRIRREEEISKALKKREKRLK 300

Query: 301 XXGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSNSIEY 360
             GMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSNSIEY
Sbjct: 301 EKGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSNSIEY 360

Query: 361 YSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLKTKAC 420
           YSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLKTKAC
Sbjct: 361 YSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLKTKAC 420

Query: 421 IRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSD 480
           IRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSD
Sbjct: 421 IRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSD 480

Query: 481 GRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDK 540
           GRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDK
Sbjct: 481 GRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDK 540

Query: 541 FLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600
           FLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF
Sbjct: 541 FLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600

Query: 601 GDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIA 660
           GDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIA
Sbjct: 601 GDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIA 660

Query: 661 ITSDGTSVISASHDHSLRVWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGSGDDAFKG 720
           ITSDGTSVISASHDHSLRVWEETDDQVFL             DTLLASLEEGSGDDAFKG
Sbjct: 661 ITSDGTSVISASHDHSLRVWEETDDQVFLEEEREKELEEQYEDTLLASLEEGSGDDAFKG 720

Query: 721 DAEKVEDESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQIDMKAWEKKKSSGEPP 780
           DAEKVEDESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQIDMKAWEKKKSSGEPP
Sbjct: 721 DAEKVEDESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQIDMKAWEKKKSSGEPP 780

Query: 781 IKPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPFSYVLKLLKFIDIVMKDKKM 840
           IKPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPFSYVLKLLKFIDIVMKDKKM
Sbjct: 781 IKPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPFSYVLKLLKFIDIVMKDKKM 840

Query: 841 TKNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNSLRDSLQENVDDLGFNIQGL 900
           TKNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNSLRDSLQENVDDLGFNIQGL
Sbjct: 841 TKNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNSLRDSLQENVDDLGFNIQGL 900

Query: 901 KFIKQQWNLKHNXXXXXXXXKKEESSGKKRIFGTLS 936
           KFIKQQWNLKHN        KKEESSGKKRIFGTLS
Sbjct: 901 KFIKQQWNLKHNFDFTDDFDKKEESSGKKRIFGTLS 936

>TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {ON}
           Anc_8.324 YLR129W
          Length = 937

 Score = 1479 bits (3829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 699/939 (74%), Positives = 817/939 (87%), Gaps = 5/939 (0%)

Query: 1   MVKSYQRFEQASVFGVISTNANCVWM-SPESKKSNSPGSVITSALENINIWDIKTGELIS 59
           MVKSYQRFEQ SVFGVI+TNANCVW+ S +S+KSN  G V+T ALENIN+WDIKTGEL+S
Sbjct: 1   MVKSYQRFEQDSVFGVITTNANCVWLPSSDSRKSNV-GQVLTGALENINLWDIKTGELLS 59

Query: 60  VLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHK 119
           VLSDGLP GSIDVKSSKPAEV+YL YHDETNLLAAGY DG IK+WDL+SK+VLL+F+GHK
Sbjct: 60  VLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHK 119

Query: 120 SAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVSTS 179
           S +T++KFD TGTRL+SGSRDS+II+WDLVSEVG++KLRSHKDAI+GIWCEGEDWLVST+
Sbjct: 120 SGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTA 179

Query: 180 KDGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKEAGSKL 239
           KDGLIK+WDLK QQC+ETHIA TGECWA+GVH DL++T+G D+Q+K+WNLD SKE GSK+
Sbjct: 180 KDGLIKLWDLKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKENGSKI 239

Query: 240 IEKGVYDKQSKQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRIRREEEISKAXXXXXXXX 299
           +EKG Y+KQSKQRGL + F    + T F YIQN+DKT E+FRIR+++EIS+A        
Sbjct: 240 VEKGTYEKQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIFRIRKQDEISRALKKREKRM 299

Query: 300 XXXGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSNSIE 359
              G TDE+IQQ   ++Y S+++ PFQ+IKS YKIK+VS+T  +N+K+E VVTTSSN+IE
Sbjct: 300 KEKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIELVVTTSSNTIE 359

Query: 360 YYSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLKTKA 419
           YYSIPYEKR P +P+P++LYTIE  GHRTDIRS+DISDD+KLLA+ASNGLLK+WNLKTK+
Sbjct: 360 YYSIPYEKRLPKNPSPSKLYTIEQKGHRTDIRSIDISDDNKLLASASNGLLKIWNLKTKS 419

Query: 420 CIRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITS 479
           CIR FDCGYALTCKFLP GTL ++GTREG +QLFDL +STL+E+ + AH  AIWSLDIT 
Sbjct: 420 CIRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQ 479

Query: 480 DGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPED 539
           DG+RLVTGSADK+IKFWNF +E+DLVPGT DK++PVMKLIHDTT+E+N+D+LSV+ISPED
Sbjct: 480 DGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPED 539

Query: 540 KFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLD 599
           K+LA+SLLDNTVKVF+LDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLD
Sbjct: 540 KYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLD 599

Query: 600 FGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSI 659
           FGDCHKSLFAHQDSIMNV FLPESHNFFSSSKDGLVKYWDGDKFEC+QKLAAHQSEVW++
Sbjct: 600 FGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWAL 659

Query: 660 AITSDGTSVISASHDHSLRVWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGSGDDAFK 719
           AITSDG++V+S+SHDHS+RVW+ETDDQVFL             DTLL SLEEGSGD AFK
Sbjct: 660 AITSDGSTVVSSSHDHSMRVWKETDDQVFLEEEREKELEEQYEDTLLTSLEEGSGDSAFK 719

Query: 720 GDAEKVEDESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQIDMKAWEKKKSSGEP 779
            D E   DESTSVRNQTMESLK+GERLMEAL+LG SEIEA EKY  D K WEKKK +GEP
Sbjct: 720 ADIEDGMDESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYNKDYKQWEKKK-AGEP 778

Query: 780 PIKPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPFSYVLKLLKFIDIVMKDKK 839
           P+KPQGNAIL+A+ ++P +YIM+TL+KIKPSQLEDALLVLPFSYVL+ LKFIDIVM D +
Sbjct: 779 PVKPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIVMDDPE 838

Query: 840 MTKNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNSLRDSLQENVDDLGFNIQG 899
           + KN L LICKNLF ++++NHKELISQRN+ LK QI +VKN LR SLQ NVDDLGFNIQG
Sbjct: 839 ILKNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLGFNIQG 898

Query: 900 LKFIKQQWNLKHNXX--XXXXXXKKEESSGKKRIFGTLS 936
           LKFIKQQWNLKHN          K+EE + KKRIFGTL+
Sbjct: 899 LKFIKQQWNLKHNYEFIDEEDQKKQEEKNSKKRIFGTLA 937

>NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {ON}
           Anc_8.324
          Length = 983

 Score = 1396 bits (3613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 663/956 (69%), Positives = 798/956 (83%), Gaps = 22/956 (2%)

Query: 1   MVKSYQRFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISV 60
           MVKSYQRFEQASVFGVIS+N+NCVW+   S K + PG +IT ALEN+NIWD+KTGEL S 
Sbjct: 28  MVKSYQRFEQASVFGVISSNSNCVWLPSTSSKKSHPGQIITGALENVNIWDLKTGELASF 87

Query: 61  LSDGL--PAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGH 118
           L+DGL  P GS+D KSSKPAE ++L +H ETNLLA GY DG +KVWDL SK+VL   NGH
Sbjct: 88  LNDGLVPPPGSVDAKSSKPAETTFLQHHKETNLLAVGYNDGVVKVWDLYSKTVLCNLNGH 147

Query: 119 KSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWC--------- 169
            SAIT +KFD +GTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAI+GIWC         
Sbjct: 148 SSAITALKFDTSGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNEVTNNNQE 207

Query: 170 EGE-DWLVSTSKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWN 228
           E E DWL+STSKDGLIKIWDLK+QQC+ETHIAHTGECW++ V  DL+IT+ +D+Q+K W 
Sbjct: 208 ENELDWLISTSKDGLIKIWDLKIQQCVETHIAHTGECWSLAVRNDLVITTSSDSQVKFWQ 267

Query: 229 LDFSKEA---GSKLIEKGVYDKQSKQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRIRRE 285
           L    +    GSKLIEKG+Y+KQSKQRGL+++F  + +G  FF IQNAD+T E+FR+R+E
Sbjct: 268 LSLQDDTVPNGSKLIEKGIYEKQSKQRGLNVEFIDSIDGVGFFLIQNADRTVEIFRLRKE 327

Query: 286 EEISKAXXXXXXXXXXXGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNT 345
           EEISKA           GMT +EI++++++S+ S++MHPFQ+I+S YK+K+ ++T  ++T
Sbjct: 328 EEISKALKKREKRLTEKGMTPDEIKKSLEDSFVSMMMHPFQIIRSIYKVKAATWTIATST 387

Query: 346 KLEFVVTTSSNSIEYYSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATA 405
           KLE  VTT++N+IEYYSIPYEKR+PT P   +LY +EL G RTDIRS+DISDD+KLLATA
Sbjct: 388 KLELTVTTANNTIEYYSIPYEKREPTQPIANKLYNVELQGQRTDIRSIDISDDNKLLATA 447

Query: 406 SNGLLKVWNLKTKACIRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKE 465
           SNG LK+WNLKTK CIR F+CGYALTCKFLPGG LVI+GTR G LQLFDLASST + N E
Sbjct: 448 SNGSLKIWNLKTKLCIRTFECGYALTCKFLPGGMLVIIGTRAGELQLFDLASSTQIANIE 507

Query: 466 DAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTME 525
           +AH+ AIWSLD+TSDG+RL+TGSADK++KFWNFQ+E++LVPGT+DK++P + L HDTT+E
Sbjct: 508 EAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQLEQELVPGTSDKFVPKLGLHHDTTLE 567

Query: 526 VNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLII 585
           +++D+LSVR+SPEDKFLA+SLLDNTVKVF+LDSMKFFLSLYGHKLPVLSIDISFDSK+II
Sbjct: 568 LSDDILSVRVSPEDKFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKMII 627

Query: 586 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFEC 645
           TSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKF+PESHNFFS SKDG++KYWDGDKFEC
Sbjct: 628 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGIIKYWDGDKFEC 687

Query: 646 IQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWEETDDQVFLXXXXXXXXXXXXXDTL 705
           IQKLAAHQSEVW++AI +D + V+S+SHDHS+R+WEET+D+VFL             DTL
Sbjct: 688 IQKLAAHQSEVWALAIANDASFVVSSSHDHSIRIWEETEDEVFLEEERDKEMEEQYEDTL 747

Query: 706 LASLEEGSGDDAFKGD---AEKVE-DESTSVRNQTMESLKAGERLMEALDLGMSEIEANE 761
           LASLEEG+GDDAFKGD   A  VE DE+T V  QTMESLKAGERLMEA DLGM+EIE+ E
Sbjct: 748 LASLEEGNGDDAFKGDTKGATNVEFDEATDVHKQTMESLKAGERLMEAFDLGMAEIESFE 807

Query: 762 KYQIDMKAWEKKKSSGEPPIKPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPF 821
           +Y  ++K W++KK +GEPPIKPQGNAILIA+KK P EYIM+TL++IKPSQLEDALLVLPF
Sbjct: 808 EYDKNLKLWQRKK-TGEPPIKPQGNAILIAIKKTPEEYIMDTLIRIKPSQLEDALLVLPF 866

Query: 822 SYVLKLLKFIDIVMKDKKMTKNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNS 881
           SYVLK LKFI+IV+ +KKM  N+L LICKNLFF+++SNHKEL+SQ+NE LK QI  VKN 
Sbjct: 867 SYVLKFLKFINIVIGNKKMLNNHLALICKNLFFIVKSNHKELVSQKNEVLKLQITKVKNE 926

Query: 882 LRDSLQENVDDLGFNIQGLKFIKQQWNLKHNXXXXXXXXKK--EESSGKKRIFGTL 935
           LR++L+ N DDLGFNIQG+KFIKQQWNL+HN        +K  E+   KKR FGTL
Sbjct: 927 LRNALKANEDDLGFNIQGMKFIKQQWNLRHNLEFVDEYDQKSHEDKMAKKRTFGTL 982

>Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 1393 bits (3606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 659/940 (70%), Positives = 793/940 (84%), Gaps = 9/940 (0%)

Query: 1   MVKSYQRFEQASVFGVISTNANCVWMSPESKKSNS--PGSVITSALENINIWDIKTGELI 58
           MVKSYQRFEQA+ FGVI++NANCVW+   S+ +N   PG +ITSALEN+NIWDIKTG+L+
Sbjct: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLV 60

Query: 59  SVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGH 118
           + LSDGLP G+ D K SKPAE +YL  H +TNLLA GY DG IKVWDL+SK+VLL FNGH
Sbjct: 61  TTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGH 120

Query: 119 KSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVST 178
           K+AIT+M+FD TGTRLISGS+DSNIIVWDLV EVGLYKLRSHKDAI+G WC+GEDWLVST
Sbjct: 121 KAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGEDWLVST 180

Query: 179 SKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKE-AGS 237
           SKDGLIKIWDLK QQCIETHIAHTGECW + V +DLLIT+  D+Q+K+W L+   E  G 
Sbjct: 181 SKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMGE 240

Query: 238 KLIEKGVYDKQSKQRGLDIKF-SVAPNGTAFFYIQNADKTTEVFRIRREEEISKAXXXXX 296
           KL E G+++KQSKQRGL I+F + A +G +FFYIQNADKT E +RIR+EEEI++      
Sbjct: 241 KLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIARGLKKRE 300

Query: 297 XXXXXXGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSN 356
                 G+TDEEI ++IK+SYSS+I+HPFQ ++S YKIKS S+TTV+++KLE VVTTS+N
Sbjct: 301 KRLREKGLTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSNN 360

Query: 357 SIEYYSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLK 416
           +IEYYSIPYEKRDPTSPAP + +TIEL G RTD+RS+D+SDD+KLLATASNG LK+WN+K
Sbjct: 361 TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNVK 420

Query: 417 TKACIRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLD 476
           T  CIR F+CGYALTCKFLPGG LVI+GTR G LQLFDLASS+LL+  EDAH+ AIWSLD
Sbjct: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLD 480

Query: 477 ITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRIS 536
           +TSDG+RLVTGSADKT+KFW+FQVE+ LVPGT DK++P++KL HDTT+E+N+D+LSVRIS
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRIS 540

Query: 537 PEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW 596
           P+D++LAISLLDNTVKVF+LDSMKF+LSLYGHKLPVLSIDISFDSK+IITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 597 GLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEV 656
           GLDFGDCHKSLFAHQDSIM+VKFLPESHNFFS SKD +VKYWDG+KFECIQKL AHQSEV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 657 WSIAITSDGTSVISASHDHSLRVWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGSGDD 716
           W++AI++DG+ V+S+SHDHS+R+WEET+DQVFL             DTLL SLEEG+GDD
Sbjct: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDD 720

Query: 717 AFKGDA--EKVEDESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQIDMKAWEKKK 774
           AFKGDA  E VEDE++ V  QT+ESLKAGE+LMEALDLG++EIE  E Y  DMK W++KK
Sbjct: 721 AFKGDATGENVEDEASGVHKQTLESLKAGEKLMEALDLGIAEIEGMEMYNKDMKLWQRKK 780

Query: 775 SSGEPPIKPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPFSYVLKLLKFIDIV 834
             GE P+KPQGN++LIA+KK P +YIM+TL +I+ SQLEDAL+V+PFSYVLK LKF D V
Sbjct: 781 -LGEAPMKPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVMPFSYVLKFLKFTDAV 839

Query: 835 MKDKKMTKNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNSLRDSLQENVDDLG 894
           M++K +  N+L LICKNLFF+I+ NHKELISQ+NE LK QI  VK  LR++L+   DDLG
Sbjct: 840 MQNKTLLHNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVKTELRNALKSTEDDLG 899

Query: 895 FNIQGLKFIKQQWNLKHNXXXXXX--XXKKEESSGKKRIF 932
           FN+QGLKFI+QQWNLKHN          +KE +S +KR+F
Sbjct: 900 FNVQGLKFIRQQWNLKHNYEFVDEYDQQEKENTSARKRVF 939

>SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 941

 Score = 1391 bits (3601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 648/943 (68%), Positives = 789/943 (83%), Gaps = 11/943 (1%)

Query: 1   MVKSYQRFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISV 60
           MVKSYQRFEQ S FGVIS+N NCVW++  S+   S G ++T ALEN+N WDIKTGEL  +
Sbjct: 1   MVKSYQRFEQGSAFGVISSNTNCVWIA--SRNRGSAGQILTGALENVNCWDIKTGELSKI 58

Query: 61  LSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKS 120
           L+DGLP G++D KS+K AE +YL YH ETNLLA GY DG IK+WDL+SK+VL+ FNGHKS
Sbjct: 59  LTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKS 118

Query: 121 AITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVSTSK 180
           AITV++FD TGTRLISGS+DS+II+WDLV EVGLYKLRSHKD+I+GIWCE EDWL+STSK
Sbjct: 119 AITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSK 178

Query: 181 DGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKEAGSKLI 240
           DGLIKIWDLK QQC+ETH+AHT ECW + +H DL+IT+  ++Q+K+WNLD  K+ GSKLI
Sbjct: 179 DGLIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKDMGSKLI 238

Query: 241 EKGVYDKQSKQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRIRREEEISKAXXXXXXXXX 300
           EKG+Y+KQSKQRG+ ++F    +G  FFYIQNADKT E+FR+R +EEISKA         
Sbjct: 239 EKGIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLR 298

Query: 301 XXGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSNSIEY 360
             GM DE+IQQNIK+SY S+IMHPFQ I+S +KIK+ ++   + +KLE V+TTS+N++EY
Sbjct: 299 DKGMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNNTVEY 358

Query: 361 YSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLKTKAC 420
           YSIPY+KR+PT PAP +LYTIEL GHRTD+RS+DISDD+KLLATASNG LK+WN+KT AC
Sbjct: 359 YSIPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKTHAC 418

Query: 421 IRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSD 480
           IR F+CGYALTCKFLPGG LV+VG R G LQLFDLASSTLLENKEDAH  AIWSLD+TSD
Sbjct: 419 IRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSD 478

Query: 481 GRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDK 540
           G+RLVTGSADKT+KFW+F+V+++L+PGT DK++P +K+ HDTT+E+N+D+L+V+IS ++K
Sbjct: 479 GKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNK 538

Query: 541 FLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600
           FLA+SLLDNTVKVF+L+SMKFFLSLYGHKLPVLSIDISFDSKL+ITSSADKNIKIWGLDF
Sbjct: 539 FLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDF 598

Query: 601 GDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIA 660
           GDCHKSLFAHQDSIM+VKF+PESHNFFS SKDGLVKYWDGDKFEC+QKLAAHQSEVW++A
Sbjct: 599 GDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALA 658

Query: 661 ITSDGTSVISASHDHSLRVWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGSGDDAFKG 720
           I++D   V+S SHDHS+RVWEET+D+VFL             +TLL SLE GSGDD F+ 
Sbjct: 659 ISNDARFVVSTSHDHSIRVWEETEDEVFLEEEREKEMDEQYENTLLHSLEAGSGDDNFQR 718

Query: 721 DAE------KVEDESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQIDMKAWEKKK 774
           D E      ++ D++T V  QT+ESLKAGER++EALDLG++ IE NE Y+ ++K W+KKK
Sbjct: 719 DIEGRGEDGEITDQATDVHKQTIESLKAGERVIEALDLGIAVIEENETYEKNLKDWQKKK 778

Query: 775 SSGEPPIKPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPFSYVLKLLKFIDIV 834
            SGEPP KPQ NAIL+A+KK P +YIMETLVKI+PSQLEDALLVLPFSYVL  LKFID+V
Sbjct: 779 -SGEPPSKPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLPFSYVLSFLKFIDVV 837

Query: 835 MKDKKMTKNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNSLRDSLQENVDDLG 894
           +KDKKM  N+L LICK LFF+I+SN++EL++Q+NE LK QI  VK  LR +L+ N DDLG
Sbjct: 838 IKDKKMQNNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQELRTALKGNADDLG 897

Query: 895 FNIQGLKFIKQQWNLKHNXXXX--XXXXKKEESSGKKRIFGTL 935
           FN+QGLKFI+QQWNL+HN          K+EE + KKRIF TL
Sbjct: 898 FNVQGLKFIRQQWNLRHNLEFVDDYDQRKQEEKTVKKRIFETL 940

>NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {ON}
           Anc_8.324 YLR129W
          Length = 958

 Score = 1386 bits (3588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 665/957 (69%), Positives = 792/957 (82%), Gaps = 22/957 (2%)

Query: 1   MVKSYQRFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISV 60
           MVKSYQRFEQ SVFGVI++N+NC+W+  +S  S SPG +ITSALENINIWDIKTGEL S 
Sbjct: 1   MVKSYQRFEQESVFGVINSNSNCIWLPSDSNPSTSPGQIITSALENINIWDIKTGELSSH 60

Query: 61  LSDGL--PAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGH 118
           L D L  P GSID KS+KPAE +YL +H +TNLLA GY DG IKVWDL SK+VL   NGH
Sbjct: 61  LIDSLIPPPGSIDAKSTKPAETTYLQHHKDTNLLAVGYNDGVIKVWDLYSKTVLCNLNGH 120

Query: 119 KSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCE-----GED 173
            SAITV+KFD TGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAI+GIWC      GED
Sbjct: 121 SSAITVLKFDSTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNEMQNNGED 180

Query: 174 ------WLVSTSKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLW 227
                 WL+STSKDGLIKIWDLK+QQCIETHIAHTGECW++ V  DLLIT+ +D+Q+K+W
Sbjct: 181 DENELDWLISTSKDGLIKIWDLKIQQCIETHIAHTGECWSVAVRNDLLITTSSDSQIKIW 240

Query: 228 NLDFSKE---AGSKLIEKGVYDKQSKQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRIRR 284
            L+   +      KLIEKG+Y+KQSKQRGL I+F    + T FFYIQNADKT E+FR+R+
Sbjct: 241 ELNLDNDDDGKNKKLIEKGIYEKQSKQRGLSIEFIDTADETGFFYIQNADKTVEIFRLRK 300

Query: 285 EEEISKAXXXXXXXXXXXGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSN 344
           ++EI+KA           GMT E+I+QNIK+SY S+IMHPFQ+++S YKIK+V++T  + 
Sbjct: 301 QDEINKAIKKRTKRLTEKGMTPEDIEQNIKDSYISLIMHPFQIVRSIYKIKAVTWTIATP 360

Query: 345 TKLEFVVTTSSNSIEYYSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLAT 404
           +KLE  +TTS+N+IEYYS PYEKR+PT P P +L+TIEL G RTDIRS+DISDD+KLLAT
Sbjct: 361 SKLELCLTTSNNTIEYYSTPYEKREPTQPTPNKLHTIELQGQRTDIRSIDISDDNKLLAT 420

Query: 405 ASNGLLKVWNLKTKACIRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENK 464
           ASNGLLK+WN+KTK+CIR F+CGY+LTCKFLPGGTLVIVGTR G LQLFDLASSTLLE  
Sbjct: 421 ASNGLLKIWNIKTKSCIRTFECGYSLTCKFLPGGTLVIVGTRGGELQLFDLASSTLLETI 480

Query: 465 EDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTM 524
           EDAH+ AIWSLD+TSDG+RLVTGSADK++KFW+FQ+E++LV GT DKYLP +KL HDTT+
Sbjct: 481 EDAHDAAIWSLDLTSDGKRLVTGSADKSVKFWDFQLEQELVAGTVDKYLPKLKLFHDTTL 540

Query: 525 EVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLI 584
           E+N+D+LSV+ISPEDKFLA+SLLDNTVKVF++D+MKFFLSLYGHKLPVLSIDISFDSKLI
Sbjct: 541 ELNDDILSVKISPEDKFLAVSLLDNTVKVFFMDTMKFFLSLYGHKLPVLSIDISFDSKLI 600

Query: 585 ITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFE 644
           ITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKF+PESHNFFS SKDGL+KYWDGDKFE
Sbjct: 601 ITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGLIKYWDGDKFE 660

Query: 645 CIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWEETDDQVFLXXXXXXXXXXXXXDT 704
           CIQKLA HQSEVWSIAI +D + ++S+SHDHS+R+WEET+D+VFL             DT
Sbjct: 661 CIQKLAGHQSEVWSIAIANDASFIVSSSHDHSIRIWEETEDEVFLEEEREKELEELYEDT 720

Query: 705 LLASLEEGSGDDAFKGDAEKVEDESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQ 764
           LL SLEE +GDDAFK D  + +DE+T V  QTMESLKA ERLMEA DLGM EIEA E+Y+
Sbjct: 721 LLTSLEEDNGDDAFKKDGGEDKDEATDVHKQTMESLKASERLMEAFDLGMKEIEAMEEYE 780

Query: 765 IDMKAWEKKKSSGEP----PIKPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLP 820
            ++K W++K S+ +     PIKPQGNAIL+A+KK P EYIM+TLV+IKPSQLEDALLVLP
Sbjct: 781 RELKNWQRKDSNNKATQTVPIKPQGNAILLAIKKTPEEYIMDTLVRIKPSQLEDALLVLP 840

Query: 821 FSYVLKLLKFIDIVMKDKKMTKNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKN 880
           FSY++K LKFIDIV+  KK+  N+L LIC+ LFF+++SNHKEL+SQ+NE LK+QI  VK+
Sbjct: 841 FSYIIKFLKFIDIVINSKKILNNHLPLICRILFFIVKSNHKELVSQKNEELKSQITRVKD 900

Query: 881 SLRDSLQENVDDLGFNIQGLKFIKQQWNLKHNXXXXXXXXKKEESS--GKKRIFGTL 935
           +LR++L+ N DDLGFNIQGLKFIKQQW LKHN        +K + +   KKR FGT+
Sbjct: 901 NLRNALKNNEDDLGFNIQGLKFIKQQWKLKHNYEYVDDQDQKAQEAKFAKKRTFGTI 957

>Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 1378 bits (3566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 647/943 (68%), Positives = 795/943 (84%), Gaps = 9/943 (0%)

Query: 1   MVKSYQRFEQASVFGVISTNANCVWMSPESK--KSNSPGSVITSALENINIWDIKTGELI 58
           MVKSYQRFEQ+++FGVI++NANCVW+ P S+  K + PG +ITSALEN+NIWDIKTG+L+
Sbjct: 1   MVKSYQRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLL 60

Query: 59  SVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGH 118
           + LSDGLP G+ D + SKPAE +YL  H++T+LLA GY DG IKVWDL+SK+VLL FNGH
Sbjct: 61  ATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120

Query: 119 KSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVST 178
           K+AIT+++FD TGTRLISGSRDSNIIVWDLV EVGLYKLRSHKD I+GIWC+GEDWL+ST
Sbjct: 121 KAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGEDWLIST 180

Query: 179 SKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKE-AGS 237
           SKDG+IK+WDLK QQCIETHIAHTGECW++ V +DLLIT+G D+Q+K+W L+   +  G 
Sbjct: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMGE 240

Query: 238 KLIEKGVYDKQSKQRGLDIKF-SVAPNGTAFFYIQNADKTTEVFRIRREEEISKAXXXXX 296
           KL E GV++KQSKQRGL ++F + A +G +FFYIQNADKT E FRIR+EEEI++      
Sbjct: 241 KLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIARGLKKRE 300

Query: 297 XXXXXXGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSN 356
                 G+TDEEI ++IK SYSS+++HPFQ I+S YK+KS S+TTV+++KLE V+TTS+N
Sbjct: 301 KRLREKGLTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSNN 360

Query: 357 SIEYYSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLK 416
           +IEYYSIPYEKR+ TSPAP + +TIEL G RTD+RS+DISDD+KLLATASNG LK+WN+K
Sbjct: 361 TIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNVK 420

Query: 417 TKACIRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLD 476
           T  CIR F+CGYAL+CKFLPGG LVI+GTR G LQLFDLASS+LL+  EDAH+ AIWSLD
Sbjct: 421 THKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLD 480

Query: 477 ITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRIS 536
           +TSDG+RLVTGSADKT+KFW+FQVE  LVPGT DK LP++KL HDTT+E+N+D+LSVRIS
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRIS 540

Query: 537 PEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW 596
           P+D++LAISLLDNTVKVF+LDSMKF+LSLYGHKLPVLSIDISFDSK+IITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 597 GLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEV 656
           GLDFGDCHKSLFAHQDSIM+VKFLPESHNFFS SKD +VKYWDG+KFECIQKL AHQSEV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 657 WSIAITSDGTSVISASHDHSLRVWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGSGDD 716
           W++AI S+G+ V+S+SHDHS+R+WEET+DQVFL             DTLLASLEEG+ DD
Sbjct: 661 WALAIASNGSFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLASLEEGNADD 720

Query: 717 AFKGDA--EKVEDESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQIDMKAWEKKK 774
           AFKGDA  E VEDE++ V  QT+ESLKAGERLMEALD+G+++IE  E Y  DM+ W++KK
Sbjct: 721 AFKGDAAGEDVEDEASGVHKQTLESLKAGERLMEALDIGIADIEGMETYNKDMELWQRKK 780

Query: 775 SSGEPPIKPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPFSYVLKLLKFIDIV 834
             GE P+KPQGN++LIA+ K P +YI++TL +I+ SQLEDAL+V+PFSYVLK LKFID V
Sbjct: 781 -LGEAPMKPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVMPFSYVLKFLKFIDTV 839

Query: 835 MKDKKMTKNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNSLRDSLQENVDDLG 894
           M++K +  ++L L+C+NLFF+I+ NHKEL+SQ+NE LK QI  VK  LR++L+   DDLG
Sbjct: 840 MQNKTLLHSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVKTELRNALKSTEDDLG 899

Query: 895 FNIQGLKFIKQQWNLKHNXXXXXX--XXKKEESSGKKRIFGTL 935
           FN+QGLKFIKQQWNL+HN          +KE SS +KR+F T+
Sbjct: 900 FNVQGLKFIKQQWNLRHNYEFVDEYDQQEKENSSARKRVFETV 942

>YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}
           DIP2Nucleolar protein, specifically associated with the
           U3 snoRNA, part of the large ribonucleoprotein complex
           known as the small subunit (SSU) processome, required
           for 18S rRNA biogenesis, part of the active pre-rRNA
           processing complex
          Length = 943

 Score = 1376 bits (3562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 652/943 (69%), Positives = 788/943 (83%), Gaps = 9/943 (0%)

Query: 1   MVKSYQRFEQASVFGVISTNANCVWMSPESKKSNS--PGSVITSALENINIWDIKTGELI 58
           MVKSYQRFEQA+ FGVI++NANCVW+   S  SN   PG +ITSALE++NIWDIKTG+L+
Sbjct: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSGNSNGSGPGQLITSALEDVNIWDIKTGDLV 60

Query: 59  SVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGH 118
           S LSDGLP G+ D + +KPAE +YL  H +T+LLA GY DG IKVWDL+SK+VLL FNGH
Sbjct: 61  SKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120

Query: 119 KSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVST 178
           K+AIT+++FD TGTRLISGS+DSNIIVWDLV EVGLYKLRSHKD+I+G WC+GEDWL+ST
Sbjct: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180

Query: 179 SKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKE-AGS 237
           SKDG+IK+WDLK  QCIETHIAHTGECW + V +DLLIT+G D+Q+K+W LD   +  G 
Sbjct: 181 SKDGMIKLWDLKTHQCIETHIAHTGECWGLAVKDDLLITTGTDSQVKIWKLDIENDKMGG 240

Query: 238 KLIEKGVYDKQSKQRGLDIKF-SVAPNGTAFFYIQNADKTTEVFRIRREEEISKAXXXXX 296
           KL E G+++KQSKQRGL I+F + + + T+FFYIQNADKT E FRIR+EEEI++      
Sbjct: 241 KLTEMGIFEKQSKQRGLKIEFITNSSDKTSFFYIQNADKTIETFRIRKEEEIARGLKKRE 300

Query: 297 XXXXXXGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSN 356
                 G+T+EEI ++IKESYSS I+HPFQ I+S YKIKS S+TTVS++KLE V+TTSSN
Sbjct: 301 KRLKEKGLTEEEIAKSIKESYSSFILHPFQTIRSLYKIKSASWTTVSSSKLELVLTTSSN 360

Query: 357 SIEYYSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLK 416
           +IEYYSIPYEKRDPTSPAP + +TIEL G RTD+RS+DISDD+KLLATASNG LK+WN+K
Sbjct: 361 TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNIK 420

Query: 417 TKACIRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLD 476
           T  CIR F+CGYALTCKFLPGG LVI+GTR G LQLFDLASS+LL+  EDAH+ AIWSLD
Sbjct: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480

Query: 477 ITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRIS 536
           +TSDG+RLVTGSADKT+KFW+F+VE  LVPGT +K+LPV+KL HDTT+E+ +D+L VR+S
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHDTTLELTDDILCVRVS 540

Query: 537 PEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW 596
           P+D++LAISLLDNTVKVF+LDSMKF+LSLYGHKLPVLSIDISFDSK+IITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 597 GLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEV 656
           GLDFGDCHKSLFAHQDSIMNVKFLP+SHNFFS SKD +VKYWDG+KFECIQKL AHQSEV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMNVKFLPQSHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 657 WSIAITSDGTSVISASHDHSLRVWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGSGDD 716
           W++A+ +DG  V+S+SHDHS+R+WEET+DQVFL             DTLL SLEEG+GDD
Sbjct: 661 WALAVATDGGFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDD 720

Query: 717 AFKGDA--EKVEDESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQIDMKAWEKKK 774
           AFK DA  E VEDE++ V  QT+ESLKAGERLMEALDLG++EIE  E Y  DMK W++KK
Sbjct: 721 AFKADASGEGVEDEASGVHKQTLESLKAGERLMEALDLGIAEIEGLEAYNRDMKLWQRKK 780

Query: 775 SSGEPPIKPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPFSYVLKLLKFIDIV 834
             GE PIKPQGNA+LIA+ K P +YIM+TL++I+ SQLEDAL+V+PFSYVLK LKFID V
Sbjct: 781 -LGEAPIKPQGNAVLIAVNKTPEQYIMDTLLRIRMSQLEDALMVMPFSYVLKFLKFIDTV 839

Query: 835 MKDKKMTKNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNSLRDSLQENVDDLG 894
           M++K +  ++L LICKNLFF+I+ NHKEL+SQ+NE LK QI  VK  LR +L+   DDLG
Sbjct: 840 MQNKTLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKLQINRVKTELRSALKSTEDDLG 899

Query: 895 FNIQGLKFIKQQWNLKHNXXXXXX--XXKKEESSGKKRIFGTL 935
           FN+QGLKF+KQQWNL+HN          +KE +S +KR+FGT+
Sbjct: 900 FNVQGLKFVKQQWNLRHNYEFVDEYDQQEKESNSARKRVFGTV 942

>Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 1373 bits (3555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 647/943 (68%), Positives = 795/943 (84%), Gaps = 9/943 (0%)

Query: 1   MVKSYQRFEQASVFGVISTNANCVWM--SPESKKSNSPGSVITSALENINIWDIKTGELI 58
           MVKSYQRFEQ++ FGVI++NANCVW+  S  +K  + PG +ITSALEN+N+WDIKTG+L+
Sbjct: 1   MVKSYQRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLM 60

Query: 59  SVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGH 118
           S LSDGLP G+ D + +KPAE +YL  H +T+LLA GY DG IKVWDL+SK+VLL FNGH
Sbjct: 61  STLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120

Query: 119 KSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVST 178
           K+AIT+++FD TGTRLISGS+DSNIIVWDLV EVGLYKLRSHKD+I+G WC+GEDWL+ST
Sbjct: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180

Query: 179 SKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKEA-GS 237
           SKDG+IK+WDLK QQCIETHIAHTGECW + V +DLLIT+G D+Q+KLW L+   +  G 
Sbjct: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDLLITTGTDSQVKLWKLNIENDKLGG 240

Query: 238 KLIEKGVYDKQSKQRGLDIKF-SVAPNGTAFFYIQNADKTTEVFRIRREEEISKAXXXXX 296
           KL E G ++KQSKQRGL I+F +   +G +FFYIQNADKT E+FRIR+EEEI++      
Sbjct: 241 KLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNADKTIEIFRIRKEEEIARGLKKRE 300

Query: 297 XXXXXXGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSN 356
                 G+TDEEI ++IK+SYSS+I+HPFQ ++S YKIKS S+TT++++KLE V+TTS+N
Sbjct: 301 KRLREKGLTDEEITKSIKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTSNN 360

Query: 357 SIEYYSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLK 416
           +IEYYSIPYEKR+PTSPAP + +TIEL G RTD+RS+DISDD++LLATASNG LK+WN+K
Sbjct: 361 TIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNVK 420

Query: 417 TKACIRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLD 476
           T  CIR F+CGYALTCKFLPGG LVI+GTR G LQLFDLASS+LL+  EDAH+ AIWSLD
Sbjct: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480

Query: 477 ITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRIS 536
           +TSDG+RLVTGSADKT+KFW+FQVE  LVPGT DK+LP++KL HDTT+E+N+D+LS+RIS
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRIS 540

Query: 537 PEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW 596
           P+D++LAISLLDNTVKVF+LDSMKF+LSLYGHKLPVLSIDISFDSK+IITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 597 GLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEV 656
           GLDFGDCHKSLFAHQDSIM+VKFLPESHNFFS SKD +VKYWDG+KFECIQKL AHQSEV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 657 WSIAITSDGTSVISASHDHSLRVWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGSGDD 716
           W++AI++DG+ V+S+SHDHS+R+WEET+DQVFL             DTLL SLEEG+GDD
Sbjct: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDD 720

Query: 717 AFKGDA--EKVEDESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQIDMKAWEKKK 774
           AFKGDA  E V+DE + V  QT+ESLKAGERLMEALDLG++EIE  E Y  DMK W++KK
Sbjct: 721 AFKGDATGESVDDEVSGVHKQTLESLKAGERLMEALDLGIAEIEGIEAYSRDMKLWQRKK 780

Query: 775 SSGEPPIKPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPFSYVLKLLKFIDIV 834
             GE PIKPQGN++LIA+ K P +YIM+TL++I+ SQLEDAL+V+PFSYVLK LKFID +
Sbjct: 781 -LGEAPIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFIDSI 839

Query: 835 MKDKKMTKNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNSLRDSLQENVDDLG 894
           M++K +  ++L LICKNLFF+I+ NHKEL+SQ+NE LK Q+  VK  LR++L+   DDLG
Sbjct: 840 MQNKSLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVKTELRNALKSTEDDLG 899

Query: 895 FNIQGLKFIKQQWNLKHNXXXXXXXXKKE-ESSG-KKRIFGTL 935
           FN+QGLKFIKQQWNL+HN        ++E ES+G +KR F T+
Sbjct: 900 FNVQGLKFIKQQWNLRHNYEFVDEYDQQEKESNGARKRFFETV 942

>TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.324
           YLR129W
          Length = 938

 Score = 1352 bits (3499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 629/940 (66%), Positives = 779/940 (82%), Gaps = 8/940 (0%)

Query: 1   MVKSYQRFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISV 60
           MVKSYQRFEQ++ FGVIS+N+NCV++ P ++K    G V+T  LE +N+WD+KTG+L+S 
Sbjct: 1   MVKSYQRFEQSASFGVISSNSNCVYIPPANRKG--LGQVLTGGLEKVNLWDLKTGDLVSC 58

Query: 61  LSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKS 120
           LSDGLP GSID KS+KPAE +YL YH ETNLLA GY +G IKVWDL+SK+VLLT NGHKS
Sbjct: 59  LSDGLPPGSIDAKSTKPAETTYLEYHAETNLLAVGYAEGVIKVWDLMSKTVLLTLNGHKS 118

Query: 121 AITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVSTSK 180
           A+T++KFD+TGTRLISGS+DSNII+WDL+ EVGLYKLRSHK AISG+W E ++WL+STS+
Sbjct: 119 AVTILKFDITGTRLISGSQDSNIIMWDLIGEVGLYKLRSHKGAISGLWLEKDEWLISTSR 178

Query: 181 DGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKEAGSKLI 240
           DGLIK+WDLK QQC+ETHIAHTGECW++GVHEDL IT+ AD+Q+K+W+L+F  EAGSKLI
Sbjct: 179 DGLIKVWDLKTQQCVETHIAHTGECWSLGVHEDLAITASADSQVKIWHLNFESEAGSKLI 238

Query: 241 EKGVYDKQSKQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRIRREEEISKAXXXXXXXXX 300
           EKG+Y+KQS QRG  I+F    + T FFYIQNADK+ E+FRIR+EEEI KA         
Sbjct: 239 EKGIYEKQSNQRGSSIEFVTTTDETTFFYIQNADKSIEIFRIRKEEEILKATRKREKRLK 298

Query: 301 XXGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSNSIEY 360
             G++DEEI+QNI++ Y S+IMHPFQ+++S +K+K+ ++   + +KL+ VVTT+SN++EY
Sbjct: 299 EKGLSDEEIKQNIQDGYISMIMHPFQILRSNFKVKAAAWGQATASKLDLVVTTASNTVEY 358

Query: 361 YSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLKTKAC 420
           Y+IPYEKR+P  PAP RL+++EL GHRTD+R++DIS+D  LLATASNG LKVWNLKT+ C
Sbjct: 359 YTIPYEKREPKLPAPNRLHSVELQGHRTDVRAMDISNDSSLLATASNGTLKVWNLKTRMC 418

Query: 421 IRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSD 480
           +R FDCGYAL C+FLPGG L++VGTR G LQLFDLASST+L+NKE AH+ AIWSLDITSD
Sbjct: 419 LRTFDCGYALCCRFLPGGFLIVVGTRNGDLQLFDLASSTMLDNKEGAHDAAIWSLDITSD 478

Query: 481 GRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDK 540
           G++LVTGSADK++KFW FQVE+DL+ GT DK+ PVMKL HDTT+E+N+DVLSVRISPEDK
Sbjct: 479 GKKLVTGSADKSVKFWKFQVEKDLIAGTVDKFAPVMKLSHDTTLELNDDVLSVRISPEDK 538

Query: 541 FLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600
           + AISLLDNTVKVF+LDSMKF+LSLYGHKLPVLSIDISFDSK+IITSSADKNIKIWGLDF
Sbjct: 539 YFAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKVIITSSADKNIKIWGLDF 598

Query: 601 GDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIA 660
           GDCHKSLFAHQDSIM+VKFLPESHNFFS SKDGLVKYWDGDKFECIQKLA HQSEVW++A
Sbjct: 599 GDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDGLVKYWDGDKFECIQKLAGHQSEVWALA 658

Query: 661 ITSDGTSVISASHDHSLRVWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGSGDDAFKG 720
           I+++G  V+SASHD S+R+WEET+DQVFL               LL+SLEEGSGD AF+ 
Sbjct: 659 ISNNGKYVVSASHDRSIRIWEETEDQVFLEEEREKELEEQNETALLSSLEEGSGDAAFRK 718

Query: 721 DA---EKVEDESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQIDMKAWEKKKSSG 777
           D    E  +DE+  VR QT+ESLKAGERLMEALDLG+ EIE  E Y+ ++KAW K K   
Sbjct: 719 DVGGDEADQDEAADVRKQTIESLKAGERLMEALDLGIPEIENREHYEKELKAWNKHKGDA 778

Query: 778 EPPIKPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPFSYVLKLLKFIDIVMKD 837
           + P+KP GNAIL A+ K P EYI+ETL +IKPSQLEDALLVLPFSYVLK  +FID  + D
Sbjct: 779 K-PVKPPGNAILTAISKTPEEYILETLARIKPSQLEDALLVLPFSYVLKFFRFIDAALLD 837

Query: 838 KKMTKNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNSLRDSLQENVDDLGFNI 897
            ++ ++ L LICKNLFF+++SNH+EL+SQ+NE LK +I  VK+ LR +L+ N DDLGFNI
Sbjct: 838 NRILQHNLPLICKNLFFIVKSNHRELVSQKNEELKLRIAKVKDLLRGALKSNEDDLGFNI 897

Query: 898 QGLKFIKQQWNLKHNXXXXXXXXKKEES--SGKKRIFGTL 935
           +GLKFI++QW+L+H         ++E+   + KKR+F T+
Sbjct: 898 EGLKFIRRQWDLRHKLEFVDDYSQREQEDKTAKKRVFETI 937

>ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} similar
           to uniprot|Q12220 Saccharomyces cerevisiae YLR129W DIP2
           Nucleolar protein specifically associated with the U3
           snoRNA part of the large ribonucleoprotein complex known
           as the small subunit (SSU) processome required for 18S
           rRNA biogenesis part of the active pre- rRNA processing
           complex
          Length = 938

 Score = 1352 bits (3499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 639/939 (68%), Positives = 776/939 (82%), Gaps = 4/939 (0%)

Query: 1   MVKSYQRFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISV 60
           MVKSYQRFEQ+SVFGV+S+  N +W+  E+K++N PG +IT ALEN+NIWDIKTGEL+S 
Sbjct: 1   MVKSYQRFEQSSVFGVVSSGDNSIWIPAENKRTNGPGQIITGALENVNIWDIKTGELVSH 60

Query: 61  LSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKS 120
           LSDGLP G+ID +++KPAEV+Y+ Y+ +T+LLA GY DG IK+WD+ SK+VLL+FNGH+S
Sbjct: 61  LSDGLPPGAIDARTTKPAEVTYMQYYSDTSLLAVGYADGVIKIWDMFSKTVLLSFNGHRS 120

Query: 121 AITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVSTSK 180
           A+T + FD TGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKD+I+G+    E+WL+S SK
Sbjct: 121 AVTQLLFDSTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDSITGLSLPDENWLMSVSK 180

Query: 181 DGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKEAGSKLI 240
           DGLIK+WDLK+QQC+ETHIAH GECWA+GV ED+++T+ +D+Q+K+W+LD   +AG K+ 
Sbjct: 181 DGLIKLWDLKIQQCVETHIAHPGECWALGVDEDVVVTTSSDSQIKIWHLDLDADAGVKVT 240

Query: 241 EKGVYDKQSKQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRIRREEEISKAXXXXXXXXX 300
           EKG+++KQSKQRG+ + F    +GT FFY+QNADKT E+ R+R+EEEIS+A         
Sbjct: 241 EKGIFEKQSKQRGVAVSFITVSDGTKFFYVQNADKTLEIIRLRKEEEISRALKKREKRFK 300

Query: 301 XXGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSNSIEY 360
             GMTDEEIQQN KESY SIIMH FQV++S +KI++ S+   +++KLE  VTTS N+IEY
Sbjct: 301 EKGMTDEEIQQNFKESYISIIMHSFQVLRSAFKIRAASWAVTTSSKLELTVTTSGNTIEY 360

Query: 361 YSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLKTKAC 420
           YSIPYEKR+P  P P R+++IEL GHRTD+R++DISDD KLLATASNGLLK+WN++TK C
Sbjct: 361 YSIPYEKREPKHPTPIRVHSIELQGHRTDVRAIDISDDGKLLATASNGLLKIWNIRTKTC 420

Query: 421 IRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSD 480
           +R F+CGYALTCKFLPGG LVIVGTR G LQLFDLASST+LEN E+AH+ AIWSLDITSD
Sbjct: 421 LRTFECGYALTCKFLPGGVLVIVGTRSGQLQLFDLASSTILENNEEAHDAAIWSLDITSD 480

Query: 481 GRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDK 540
           GRRLVTGSADKT+KFWNF VEE  VPGT DK +P M L HDTT+E+++D+LSV+ISPE+K
Sbjct: 481 GRRLVTGSADKTVKFWNFIVEEKKVPGTTDKLIPTMSLHHDTTLEMSDDILSVKISPENK 540

Query: 541 FLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600
            LA+SLLDNTVKVFYL++MKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF
Sbjct: 541 LLAVSLLDNTVKVFYLETMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600

Query: 601 GDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIA 660
           GDCHKSLFAHQDSIMNVKFLPESHNFFS SKD  VKYWDGDKFE IQKLA HQSEVW++A
Sbjct: 601 GDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDATVKYWDGDKFETIQKLAGHQSEVWALA 660

Query: 661 ITSDGTSVISASHDHSLRVWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGSGDDAFK- 719
           +   GT VIS SHD S+RVWEETDDQVFL             + LL SLEEGSGD AFK 
Sbjct: 661 VARSGTCVISVSHDSSIRVWEETDDQVFLEEERERELEEQNEEGLLTSLEEGSGDSAFKQ 720

Query: 720 GDAEKVEDESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQIDMKAWEKKKSSGEP 779
            + +   D++  V  QT+ESLKAGERLMEA+DLG+ EIEA E Y+ +++ W+KKK   EP
Sbjct: 721 DEKDDDHDDAVDVHKQTVESLKAGERLMEAIDLGIPEIEAWEIYEKELQLWKKKKQGVEP 780

Query: 780 PIKPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPFSYVLKLLKFIDIVMKDKK 839
             +PQ NAIL+A+ K+P EYIM+TLV+IKPSQLEDALL LPFSYVLK LKF+D V++DKK
Sbjct: 781 E-RPQDNAILLAINKRPEEYIMDTLVRIKPSQLEDALLTLPFSYVLKFLKFLDTVLQDKK 839

Query: 840 MTKNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNSLRDSLQENVDDLGFNIQG 899
           +  N+L LICKNLFF+++SNH+EL+SQ+NE LK +I  VKN LR++L+ N DDLGFNI+G
Sbjct: 840 LLHNHLSLICKNLFFIVQSNHRELVSQKNEELKQRITRVKNELREALKNNEDDLGFNIEG 899

Query: 900 LKFIKQQWNLKHNXXXXXX--XXKKEESSGKKRIFGTLS 936
           LKFIKQQWNLKHN          K+ E + KKR+F TLS
Sbjct: 900 LKFIKQQWNLKHNYEFVDEFDQRKQAEKTAKKRVFETLS 938

>TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.324
           YLR129W
          Length = 936

 Score = 1348 bits (3490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 642/913 (70%), Positives = 767/913 (84%), Gaps = 2/913 (0%)

Query: 1   MVKSYQRFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISV 60
           MVKSYQRFEQ+SVFGVIS+N+NCVW+ P SKKS S G VIT ALENI++WD+KT EL  V
Sbjct: 1   MVKSYQRFEQSSVFGVISSNSNCVWVPPSSKKSKSLGKVITGALENISVWDLKTSELEYV 60

Query: 61  LSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKS 120
           LSDGLP GS+D+KSSKPAEVSYL +H ET L+AAGY DG IK+WDL+SK+VLL+FNGHKS
Sbjct: 61  LSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKS 120

Query: 121 AITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVSTSK 180
            IT++KFD TGT+LISGS DSNIIVWDLVSEVGLYKLRSHK  I+G+WC+ ++WL+STSK
Sbjct: 121 RITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLISTSK 180

Query: 181 DGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKEAGSKLI 240
           DGLIK+WDLK QQCIETHIAHTGECWA+G+  D ++TS AD+QLK+W +D   E GSKLI
Sbjct: 181 DGLIKVWDLKTQQCIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEPGSKLI 240

Query: 241 EKGVYDKQSKQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRIRREEEISKAXXXXXXXXX 300
           EKG ++KQSKQRGL I+F+   +G  FFY+QNADKT E+FR+R++ EI+KA         
Sbjct: 241 EKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREKRLT 300

Query: 301 XXGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSNSIEY 360
             GMT+E+I+ NI ESY S +MHPFQV++S YKIKSV++T   +TKLE VVTT+SN+IEY
Sbjct: 301 EKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSNTIEY 360

Query: 361 YSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLKTKAC 420
           YS+PYEKRDPTSP P + +TIEL G RTD+RS+DISDD+ LLATASNG LK+WNL TK+C
Sbjct: 361 YSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLNTKSC 420

Query: 421 IRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSD 480
           IR F+CGYALTCKFLPGG LV+VGTREG+LQLFDLASS LL   E AHE AIWSLD+T+D
Sbjct: 421 IRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTND 480

Query: 481 GRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDK 540
           G+RLVTGSADK+IKFW+FQV+++L+ GT+DKY+P M ++HD+T+E+ +D+LS++IS +DK
Sbjct: 481 GKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDK 540

Query: 541 FLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600
           FLAISLLDNTVKVF+LDSMKFFLSLYGHKLPVLS+DIS D+K+IITSSADKNIKIWGLDF
Sbjct: 541 FLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDF 600

Query: 601 GDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIA 660
           GDCHKSLFAHQDSIM VKFLP SHNFFS+SKDG VKYWDGDKFECIQKLAAHQSEVW++A
Sbjct: 601 GDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALA 660

Query: 661 ITSDGTSVISASHDHSLRVWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGSGDDAFKG 720
           ++ +G  V+S SHDHS+R+WEETDDQVFL             DTLLASLEEG+ DD FKG
Sbjct: 661 VSDNGERVVSVSHDHSIRIWEETDDQVFLEEEREKELEEQYEDTLLASLEEGNADDTFKG 720

Query: 721 DAEKVE-DESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQIDMKAWEKKKSSGEP 779
           D +  E DE+T V  QT+ESLKAGERLM+ALDLG+ EIE  E Y+ +M  + KKK   + 
Sbjct: 721 DVKNDEDDEATRVSKQTIESLKAGERLMDALDLGIKEIEEMENYEAEMVKY-KKKQRIDA 779

Query: 780 PIKPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPFSYVLKLLKFIDIVMKDKK 839
           P+KP GNAIL+A++K P EYIM+TL+ IKPSQLED+LLVLPFSYVLK LKF D VMK   
Sbjct: 780 PVKPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFSYVLKFLKFFDYVMKVPN 839

Query: 840 MTKNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNSLRDSLQENVDDLGFNIQG 899
           +  N L LICKNLFF+++SN KEL+SQ+NE LK QI  VK+ LR +LQ N DDLGFNIQG
Sbjct: 840 ILNNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQLRSALQTNEDDLGFNIQG 899

Query: 900 LKFIKQQWNLKHN 912
           LKFIKQQWN+KHN
Sbjct: 900 LKFIKQQWNMKHN 912

>KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {ON}
           Anc_8.324 YLR129W
          Length = 938

 Score = 1334 bits (3453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 650/943 (68%), Positives = 775/943 (82%), Gaps = 14/943 (1%)

Query: 1   MVKSYQRFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISV 60
           MVKSYQRFEQ SVFGVIS+N+N VW+       N PG++ITSALENINIWDIKTGEL++ 
Sbjct: 1   MVKSYQRFEQTSVFGVISSNSNSVWIP----NGNGPGNIITSALENINIWDIKTGELVNQ 56

Query: 61  LSDGLPA-GSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHK 119
           L+DGLP  GSID K SKPA V+Y  YH++TNLLAAGY DG IKVWDL+SK++LLTFNGHK
Sbjct: 57  LTDGLPPPGSIDSKLSKPASVTYFKYHEDTNLLAAGYSDGVIKVWDLISKTILLTFNGHK 116

Query: 120 SAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWC-EGEDWLVST 178
           SAIT++ FD TGTRLISGS DS+IIVWDLVSEVGLYKLRSHKD I+GIWC + E+WL+ST
Sbjct: 117 SAITILTFDSTGTRLISGSNDSDIIVWDLVSEVGLYKLRSHKDNITGIWCSDDENWLIST 176

Query: 179 SKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKEA-GS 237
           SKDGLIK+WDLK+QQC+ETHIAHTGECW++G+H DL++T+ A++Q+K W LD   +  GS
Sbjct: 177 SKDGLIKVWDLKIQQCVETHIAHTGECWSLGIHNDLVVTTSAESQVKFWKLDLENQPNGS 236

Query: 238 KLIEKGVYDKQSKQRGLDIKFSVAP-NGTAFFYIQNADKTTEVFRIRREEEISKAXXXXX 296
           KL+EKG+++KQSKQRGL ++F  +  +  +FF+IQNADKT E+FRIR+++EI KA     
Sbjct: 237 KLVEKGIFEKQSKQRGLSVEFITSKGDDVSFFHIQNADKTVEIFRIRKKDEIEKALKKRE 296

Query: 297 XXXXXXGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSN 356
                 GMTD+EI QN+ E++ S +MHPFQ ++S YKIKSV +T  +++KLE VVTTSSN
Sbjct: 297 KRLKEKGMTDDEIAQNVDEAFVSFLMHPFQTVRSTYKIKSVCWTHATSSKLELVVTTSSN 356

Query: 357 SIEYYSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLK 416
           +IEYYS+ Y KR P    P++++TIEL G RTDIRS+ ISDD+KLLATASNGLLK+WNLK
Sbjct: 357 TIEYYSVTYAKRIP--QPPSKIHTIELHGQRTDIRSIAISDDNKLLATASNGLLKIWNLK 414

Query: 417 TKACIRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLD 476
           T  CIR F+CGYAL CKFLPGG LVIVGTR G LQLFDLASST LEN EDAH+ AIWSLD
Sbjct: 415 THKCIRTFECGYALCCKFLPGGLLVIVGTRNGELQLFDLASSTQLENIEDAHDAAIWSLD 474

Query: 477 ITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRIS 536
           ITSDG+RL+TGSADKT+KFW+F++++  V GT D Y+PV+KL HDTT+E+ ED+L VR+S
Sbjct: 475 ITSDGKRLITGSADKTVKFWDFKLDQQKVEGTRDSYIPVLKLFHDTTLEIGEDILCVRLS 534

Query: 537 PEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW 596
           P+DKFLA+SLLD TVK+F+LDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW
Sbjct: 535 PDDKFLAVSLLDYTVKIFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW 594

Query: 597 GLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEV 656
           GLDFGDCHKSLFAH DSIMNVKFL  SHNFFS SKDG +KYWDGDKFECIQKL AHQ+EV
Sbjct: 595 GLDFGDCHKSLFAHADSIMNVKFLNNSHNFFSCSKDGTIKYWDGDKFECIQKLVAHQNEV 654

Query: 657 WSIAITSDGTSVISASHDHSLRVWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGSGDD 716
           WSIAI  D + V+S+SHDHSLR+WEET+DQVFL             +TLL SLEEG+GD 
Sbjct: 655 WSIAIADDSSFVVSSSHDHSLRIWEETEDQVFLEEEREREMEEQYENTLLNSLEEGTGDS 714

Query: 717 AFKGDAE--KVEDESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQIDMKAWEKKK 774
           AFK D +  + EDE+T V  QT ESLKAGERLMEALDLG+ EIE NE Y  D++ W+KKK
Sbjct: 715 AFKSDTKGSEDEDEATDVHKQTAESLKAGERLMEALDLGIEEIEKNETYLKDLELWKKKK 774

Query: 775 SSGEPPIKPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPFSYVLKLLKFIDIV 834
             G+ PIKPQGNAIL A+ K P +YI+ETL+KIKPSQLEDA+LV PFSYVLK LKFIDIV
Sbjct: 775 IGGDAPIKPQGNAILTAINKTPEQYILETLIKIKPSQLEDAILVFPFSYVLKFLKFIDIV 834

Query: 835 MKDKKMTKNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNSLRDSLQENVDDLG 894
           + D K+  N+L LICKNLFFVI+SNHKELISQ+NE LK Q+  VK+ LR +L++N DDLG
Sbjct: 835 LNDPKVLNNHLTLICKNLFFVIKSNHKELISQKNEDLKLQVDRVKDRLRGALRKNEDDLG 894

Query: 895 FNIQGLKFIKQQWNLKHNXXXXXXXXK--KEESSGKKRIFGTL 935
           +NIQGLKFIKQQWNL HN        +  +E  SGKKR+FGT+
Sbjct: 895 YNIQGLKFIKQQWNLTHNFEFNDELDQNVQESKSGKKRVFGTI 937

>KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 937

 Score = 1333 bits (3449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 617/939 (65%), Positives = 769/939 (81%), Gaps = 7/939 (0%)

Query: 1   MVKSYQRFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISV 60
           MVKSYQRFEQASV GVIS+N+NC+W+  E++  N+ G V+T ALEN+N W +K+G+L+S 
Sbjct: 1   MVKSYQRFEQASVLGVISSNSNCIWIPAETR--NASGQVLTGALENVNCWSMKSGDLLST 58

Query: 61  LSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKS 120
           LSDGLP G++D KSSKPAE ++L YH ET LLAAGY DG +K+WDLLSKSVL+ FNGHKS
Sbjct: 59  LSDGLPPGAVDAKSSKPAETTFLQYHPETKLLAAGYNDGVVKIWDLLSKSVLINFNGHKS 118

Query: 121 AITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVSTSK 180
           AITV+KFD TGTRLISGS+DS+IIVWDLV EVGL+KLRSHKD+I+G+WCEGEDWLVSTSK
Sbjct: 119 AITVLKFDSTGTRLISGSKDSDIIVWDLVGEVGLFKLRSHKDSITGLWCEGEDWLVSTSK 178

Query: 181 DGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKEAGSKLI 240
           DGLIK+WDLK QQC+ETH+AH GECW+MGVHEDL++T G D Q+KLW++D+ K  GS L 
Sbjct: 179 DGLIKVWDLKTQQCVETHVAHVGECWSMGVHEDLVVTCGGDNQIKLWSVDYEKPVGSMLT 238

Query: 241 EKGVYDKQSKQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRIRREEEISKAXXXXXXXXX 300
           E+G ++KQSKQRG+ ++F+   +G  FF++QNAD+T E FR+R E+EISKA         
Sbjct: 239 ERGTHEKQSKQRGVSVEFTTISDGVTFFFVQNADRTVETFRLRTEDEISKALKKREKRLS 298

Query: 301 XXGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSNSIEY 360
             G+T EEIQ N+KESY+S IMHPFQ+++S YKIKS  +   + +KLE VV+TS+N+++Y
Sbjct: 299 DKGLTGEEIQANLKESYTSFIMHPFQILRSPYKIKSACWAVTTTSKLEIVVSTSNNTVDY 358

Query: 361 YSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLKTKAC 420
           YSIPY K++P  P+P ++Y+I++ GHRTD+R++DISDD+KLLATASNG LK+WN+KTK+C
Sbjct: 359 YSIPYNKKEPKLPSPPKIYSIDIKGHRTDVRAIDISDDNKLLATASNGSLKIWNIKTKSC 418

Query: 421 IRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSD 480
           IR F+CGYAL CKFLPGG LV++GT+ G L LFDLASSTLL + E AH  AIWSLD+T+D
Sbjct: 419 IRTFECGYALACKFLPGGALVVIGTKTGDLNLFDLASSTLLSSIEAAHSGAIWSLDLTAD 478

Query: 481 GRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDK 540
           G+RLVTGSADK+++FW+FQVE++LVPGT DK++P +K+ HDTT+E+N+DVL+V+ISP+++
Sbjct: 479 GKRLVTGSADKSVRFWDFQVEQELVPGTTDKFVPKLKMFHDTTLELNDDVLAVKISPDNR 538

Query: 541 FLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600
            LAISLLDNTVKVF+LDSMKFFLSLYGHKLPVLSIDISFDSKL+ITSSADKNIK+WGLDF
Sbjct: 539 LLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKVWGLDF 598

Query: 601 GDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIA 660
           GDCHKSLFAH DSIM V FLPESHNFFS  KDGLVKYWDGDKFECIQKLAAHQ EVW+IA
Sbjct: 599 GDCHKSLFAHSDSIMKVAFLPESHNFFSCGKDGLVKYWDGDKFECIQKLAAHQKEVWTIA 658

Query: 661 ITSDGTSVISASHDHSLRVWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGSGDDAFKG 720
           I+ DGT V+SASHD S+RVW ETDDQVFL              TLL SLE+G+GD  F G
Sbjct: 659 ISHDGTFVVSASHDQSIRVWVETDDQVFLEEEREKEMDEQYEKTLLNSLEDGAGDAMFHG 718

Query: 721 DAE---KVEDESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQIDMKAWEKKKSSG 777
           D     ++ DE+T V  QT ESLKA ERLMEA+D+GM+EI  + +Y+  +K W+KKK SG
Sbjct: 719 DGNGGAEIGDEATDVHKQTTESLKASERLMEAMDMGMAEISNHLEYEQALKEWQKKK-SG 777

Query: 778 EPPIKPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPFSYVLKLLKFIDIVMKD 837
             P +PQ N+ILIA+ K P EYIM+ L +IKPSQLEDALLVLPFSYVL+ L FI++V++D
Sbjct: 778 PHPGRPQPNSILIAINKTPLEYIMDVLARIKPSQLEDALLVLPFSYVLEFLHFIELVIED 837

Query: 838 KKMTKNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNSLRDSLQENVDDLGFNI 897
           K + + +L L+CKNLFF+I++NH+EL SQ+NE LK QI  +K  LR+S++   DDLGFNI
Sbjct: 838 KSLVRRHLPLLCKNLFFIIKANHRELFSQKNEKLKIQIDRIKYGLRNSIKAKADDLGFNI 897

Query: 898 QGLKFIKQQWNLKHNXXXX-XXXXKKEESSGKKRIFGTL 935
           QGLKFIKQQWNLKHN          K++   KKR+F T+
Sbjct: 898 QGLKFIKQQWNLKHNFEFSDDVIISKQDKKVKKRVFETV 936

>KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.324
           YLR129W
          Length = 942

 Score = 1324 bits (3427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 637/941 (67%), Positives = 768/941 (81%), Gaps = 6/941 (0%)

Query: 1   MVKSYQRFEQASVFGVISTNANCVWMSP-ESKKSNSPGSVITSALENINIWDIKTGELIS 59
           MVKSYQRFEQ++VFGVIS+ AN VW+ P + + S SPG +ITSALEN+NIWDIKTGELI+
Sbjct: 1   MVKSYQRFEQSAVFGVISSEANNVWLPPLKGRSSGSPGQIITSALENVNIWDIKTGELIA 60

Query: 60  VLSDGLPAGSIDVK-SSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGH 118
            L DG+  GS D K ++KPAEV++L YH +++LLA GY DG IKVWDL+SK+VL+  NGH
Sbjct: 61  QLQDGITPGSADSKVNTKPAEVTFLQYHPDSSLLAVGYRDGNIKVWDLVSKTVLINLNGH 120

Query: 119 KSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGE-DWLVS 177
           KS+ITV+KFDV  TRL+SGS DSNII+WDLVSEVG+ KLRSHKD IS ++ + + +WL+S
Sbjct: 121 KSSITVLKFDVNCTRLVSGSSDSNIIIWDLVSEVGICKLRSHKDRISDLYVDDDFNWLLS 180

Query: 178 TSKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKEAGS 237
            SKDGLIK+WDLK  QC+ETHIAHTGECW++G+ +D++IT+   +Q+KLW+LD   E GS
Sbjct: 181 VSKDGLIKVWDLKTNQCVETHIAHTGECWSLGIKDDVVITTSNTSQIKLWSLDLDGEVGS 240

Query: 238 KLIEKGVYDKQSKQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRIRREEEISKAXXXXXX 297
           KLIEKGVY+KQSKQRG  +KF    +G AFF I NADKT E+FRIR +EEI++A      
Sbjct: 241 KLIEKGVYEKQSKQRGTSVKFIENSSGVAFFAIGNADKTIEIFRIRPQEEITRALKKREK 300

Query: 298 XXXXXGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSNS 357
                GM DE+IQQNIKES+ S +MH FQ ++S +K+KS S+T  +N+KLE V TTSSN+
Sbjct: 301 RLKEKGMEDEDIQQNIKESFVSTMMHSFQTVRSAFKLKSFSWTFATNSKLELVATTSSNT 360

Query: 358 IEYYSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLKT 417
           IEYY+I YEKR+PT PAP RLYTIEL G RTDIR+ DISDD+ LLATASNGLLK+WNL+T
Sbjct: 361 IEYYTIAYEKREPTQPAPNRLYTIELQGLRTDIRATDISDDNMLLATASNGLLKIWNLRT 420

Query: 418 KACIRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDI 477
           K CIR FDCGYALTCKFLPGG LVI+GTR G LQLFDLASST +EN E AH+ AIWSLD+
Sbjct: 421 KQCIRTFDCGYALTCKFLPGGLLVILGTRNGELQLFDLASSTQIENIEGAHDAAIWSLDL 480

Query: 478 TSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISP 537
           TS+G+RLVTGSADKT+KFW+FQ+E+  + GT+ K    + L HDTT+E+N+DVL V+ISP
Sbjct: 481 TSNGKRLVTGSADKTVKFWDFQLEQLPIEGTSGKSESKLTLNHDTTLELNDDVLCVKISP 540

Query: 538 EDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWG 597
           EDK LA+SLLDNTVK+F+LD+MKFFLSLYGHKLPVLSIDISFDSK++ITSSADKNIKIWG
Sbjct: 541 EDKHLAVSLLDNTVKIFFLDTMKFFLSLYGHKLPVLSIDISFDSKMVITSSADKNIKIWG 600

Query: 598 LDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVW 657
           LDFGDCHKSLFAHQDSIMNVKFLPESHNFFS SKDG VKYWDGDKFEC+QKL +HQSEVW
Sbjct: 601 LDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGQVKYWDGDKFECVQKLVSHQSEVW 660

Query: 658 SIAITSDGTSVISASHDHSLRVWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGSGDDA 717
            +A+  DG+ V+S SHDHS+R+W+ET+DQVFL             +TLL SLEEG+GDDA
Sbjct: 661 CLAMGLDGSFVVSTSHDHSIRIWQETEDQVFLEEEREKEMEEQYEETLLNSLEEGTGDDA 720

Query: 718 FKGDAEKVE-DESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQIDMKAWEKKKSS 776
           FK D+   E DE+T V  QT+ESLKA E+LM+ALDLG++EIEA E+Y  DM  W+KKK  
Sbjct: 721 FKKDSVDGEGDEATDVHKQTIESLKANEKLMDALDLGLTEIEAMERYNSDMALWKKKKIG 780

Query: 777 GEPPIKPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPFSYVLKLLKFIDIVMK 836
            E P+KP GNA+L+A+KK P +YIMETL +IKPSQLEDALL+LPFSYVLK LKFIDIV+K
Sbjct: 781 SEMPVKPSGNAVLLAVKKSPEQYIMETLARIKPSQLEDALLILPFSYVLKFLKFIDIVLK 840

Query: 837 DKKMTKNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNSLRDSLQENVDDLGFN 896
           +KKM  NYL LICKNLFF++R+NHKELISQ+NE LK QI  VK  LR++L++N D LGFN
Sbjct: 841 NKKMLHNYLALICKNLFFIVRTNHKELISQKNEELKLQITRVKQELRNTLKQNEDALGFN 900

Query: 897 IQGLKFIKQQWNLKHNXXXXXXXXKK--EESSGKKRIFGTL 935
           IQGLKFIKQQW+LKHN        ++  EE   KKRIF TL
Sbjct: 901 IQGLKFIKQQWDLKHNFEFVDEYDQRIQEEKKAKKRIFETL 941

>Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129W
           (DIP2) - interacts with Dom3p [contig 171] FULL
          Length = 937

 Score = 1319 bits (3413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 614/940 (65%), Positives = 768/940 (81%), Gaps = 9/940 (0%)

Query: 1   MVKSYQRFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISV 60
           MVKSYQRFEQ SVFGVIS+N+NC+W+  E++  NS G V+T ALEN+N W +K+GELI  
Sbjct: 1   MVKSYQRFEQESVFGVISSNSNCLWLPAENR--NSTGQVLTGALENVNCWSMKSGELIGT 58

Query: 61  LSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKS 120
           L+DGLP G++D KS+KPAE SYL YH ET LLA GY DG IK+WDLLSKSVL++FNGHKS
Sbjct: 59  LTDGLPPGAVDAKSTKPAETSYLQYHPETRLLAVGYNDGAIKIWDLLSKSVLISFNGHKS 118

Query: 121 AITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVSTSK 180
           AIT++ FD TGTRLISGSRDS+IIVWDLV EVGLYKLRSHKD+I+G+WCEGE+WL+STSK
Sbjct: 119 AITILTFDQTGTRLISGSRDSDIIVWDLVGEVGLYKLRSHKDSITGLWCEGEEWLISTSK 178

Query: 181 DGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKEAGSKLI 240
           DGLIK+WDLKVQQC+ETH+AH GECW+MGVHEDL+IT+GAD Q+KLWNL+F + AGS LI
Sbjct: 179 DGLIKVWDLKVQQCVETHVAHVGECWSMGVHEDLVITAGADNQIKLWNLNFEESAGSMLI 238

Query: 241 EKGVYDKQSKQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRIRREEEISKAXXXXXXXXX 300
           EKG ++KQS+QRG+ I+F+   + T FF+IQNAD++ E FR+R+++EI+KA         
Sbjct: 239 EKGTHEKQSRQRGVAIQFTTVSDETTFFFIQNADRSVETFRLRKQDEIAKALKKREKRLT 298

Query: 301 XXGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSNSIEY 360
             G++++EIQQN+K+S++S IMHPFQ+++S YK++SV + T + +KL+ VVTT++N+++Y
Sbjct: 299 EKGLSEDEIQQNLKDSFTSFIMHPFQIVRSIYKVRSVCWATTTTSKLDLVVTTANNTVDY 358

Query: 361 YSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLKTKAC 420
           YSI Y+KR+PT P+P +L++I++ GHR+D+R++DIS D+KLLATASNG LK+WN+KT +C
Sbjct: 359 YSIKYQKREPTMPSPPKLHSIDIRGHRSDVRAIDISGDNKLLATASNGTLKIWNIKTNSC 418

Query: 421 IRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSD 480
           IR F+CGYAL CKFLPGG LV++GT+ G L L+DLASSTLL   E AH  AIWSLD+T+D
Sbjct: 419 IRTFECGYALACKFLPGGALVVLGTKTGDLHLYDLASSTLLNTIEGAHSGAIWSLDMTTD 478

Query: 481 GRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDK 540
           G+RLVTGSADKT+ FW+FQVE++ VPGT DK+ P +K+ HDTT+E+N+DVL+V+ISP+++
Sbjct: 479 GKRLVTGSADKTVCFWDFQVEQEPVPGTTDKFNPKLKMFHDTTLELNDDVLAVKISPDNR 538

Query: 541 FLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600
            LA+SLLDNTVKVF++DSMKFFLSLYGHKLPVLSIDISFDSKL+ITSSADKNIKIWGLDF
Sbjct: 539 LLAVSLLDNTVKVFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDF 598

Query: 601 GDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIA 660
           GDCH+SLFAH DSIM V F+PESHNFFS SKD LVKYWDGDKFECIQKLAAHQ EVW++A
Sbjct: 599 GDCHRSLFAHNDSIMKVVFVPESHNFFSCSKDALVKYWDGDKFECIQKLAAHQKEVWTLA 658

Query: 661 ITSDGTSVISASHDHSLRVWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGSGDDAFK- 719
           I+SDG  V+SASHD S+RVW ETDDQVFL              TLL SLE G+GDD F+ 
Sbjct: 659 ISSDGRFVVSASHDQSIRVWSETDDQVFLEEERERESDEQYEKTLLNSLENGAGDDMFEK 718

Query: 720 ---GDAEKVEDESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQIDMKAWEKKKSS 776
              GD E + D++T V  QT ESLKA E+LMEALDLGMSEI    +Y+  +K WEKK+ S
Sbjct: 719 DGNGDGE-ITDQATDVHKQTTESLKASEKLMEALDLGMSEINNLLEYEKALKQWEKKR-S 776

Query: 777 GEPPIKPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPFSYVLKLLKFIDIVMK 836
           G  P KP  N+IL+A+ K P EYIM+ LVKIKPSQLEDALLVLPF+YVL  L FID+V+K
Sbjct: 777 GPHPGKPLPNSILVAINKTPLEYIMDVLVKIKPSQLEDALLVLPFTYVLTFLHFIDLVLK 836

Query: 837 DKKMTKNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNSLRDSLQENVDDLGFN 896
           +K++ +  L LIC+NLFF+I+SNH+EL SQ+NE LK Q+  +K+ LR S++   DDLGFN
Sbjct: 837 EKELARRRLPLICRNLFFIIKSNHRELFSQKNEELKIQMNRIKDGLRKSIKAKSDDLGFN 896

Query: 897 IQGLKFIKQQWNLKHNXXXX-XXXXKKEESSGKKRIFGTL 935
           IQGL FIKQQWN+KHN          K     KKR+F TL
Sbjct: 897 IQGLTFIKQQWNMKHNFEFSDDITVNKTNEKAKKRVFETL 936

>CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highly
           similar to uniprot|Q12220 Saccharomyces cerevisiae
           YLR129w DIP2 DOM34P-interacting protein
          Length = 940

 Score = 1306 bits (3379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 622/943 (65%), Positives = 766/943 (81%), Gaps = 10/943 (1%)

Query: 1   MVKSYQRFEQASVFGVISTNANCVWMSPES--KKSNSPGSVITSALENINIWDIKTGELI 58
           MVKSYQRFEQA+VFGVIS+N+N VW+ PE+  +K+ + G VI   LENI +WDIKTGE I
Sbjct: 1   MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVGGLENILVWDIKTGEQI 60

Query: 59  SVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGH 118
           + L+DGLP G+ D K SKPAE ++L YH ETNLLAAGY DG IK+WDL+SK+VL++FNGH
Sbjct: 61  AQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGH 120

Query: 119 KSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVST 178
           KSAITV+ FD TGTRLIS S+DS+IIVWDLV E GLYKLRSHKDAI+G+WCE E+WL+ST
Sbjct: 121 KSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLIST 180

Query: 179 SKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKEAGSK 238
           SKDGL+KIWDLK QQC+ETH+AHTGECW++G+ ED+ +T  AD+Q+KLW LD   E GSK
Sbjct: 181 SKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAENGSK 240

Query: 239 LIEKGVYDKQSKQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRIRREEEISKAXXXXXXX 298
           L EKG+ +KQSKQRG++I F+VAP+G  FFYIQNADKT E++R+R+EEEIS+A       
Sbjct: 241 LTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKR 300

Query: 299 XXXXGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSNSI 358
               GM++EEI++ +  S  S++ H FQV++S YKIKS  +T  SN+KLE VVTTS+NSI
Sbjct: 301 LQDKGMSEEEIKEAMG-SPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNNSI 359

Query: 359 EYYSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLKTK 418
           EYYSIPY KR+PT PAP +L+TI+L G RTDIRS  ISDD+KLLATASNG LK+WN+KTK
Sbjct: 360 EYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNIKTK 419

Query: 419 ACIRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDIT 478
            CIR F+CGYALTCKFLPGG LV+VGTR G LQLFD+ASST+L+NKE AH+ AIWSLD+T
Sbjct: 420 RCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLT 479

Query: 479 SDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPE 538
           SDGR+LVTGSADKT++FW F+V E  V   ++K +P+++L HDTT+E+++D+LSV ISP+
Sbjct: 480 SDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPD 539

Query: 539 DKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGL 598
           DKF+A+SLLDNTVKVF+LDSMKFFLSLYGHKLPVLS+DIS+DSKLI+T SADKNIKIWGL
Sbjct: 540 DKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGL 599

Query: 599 DFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWS 658
           DFGDCHKSLFAHQDSIMNVKFLPES+NFFS SKD  VKYWDG KFECIQKLAAHQSEVWS
Sbjct: 600 DFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWS 659

Query: 659 IAITSDGTSVISASHDHSLRVWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGSGDDAF 718
           I++++DGT VIS  HDHS+RVWEET+DQVFL             DTLL SLE G+GD+  
Sbjct: 660 ISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGDEML 719

Query: 719 ---KGDAEKVEDESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQIDMKAWEKKKS 775
              KGD E+ E E   V  QT+ESLKAGERLMEAL++G+++I A E++   + AW+K K 
Sbjct: 720 SVKKGDNEESE-EVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKKSK- 777

Query: 776 SGEPPIKPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPFSYVLKLLKFIDIVM 835
            G  PI+PQ N +L+A+KK P EYI+ETLVKIKPSQ+EDAL+V+PFSY+LK LKFID+V 
Sbjct: 778 KGIQPIRPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFIDVVT 837

Query: 836 KDKKMTKNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNSLRDSLQENVDDLGF 895
               + + ++ L+CK LFFVIR N+KEL++Q+N  LK QI  VK++LR SL+ NVD+LGF
Sbjct: 838 TKAALLQKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDELGF 897

Query: 896 NIQGLKFIKQQWNLKHNXXXXXXXXKK--EESSGKKRIFGTLS 936
           NI+G+KFIKQQW L H+        +K  EE   KKR+FGTL+
Sbjct: 898 NIEGMKFIKQQWELNHHLEFNDEYEEKNFEEKHSKKRVFGTLA 940

>Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar to
           Ashbya gossypii AGL196C
          Length = 937

 Score = 1293 bits (3347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 604/939 (64%), Positives = 760/939 (80%), Gaps = 6/939 (0%)

Query: 1   MVKSYQRFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISV 60
           MV SYQRFEQ S FGVI++N+NCVW+  E  ++ SPG +ITS+LENIN WDIKTG L+  
Sbjct: 1   MVNSYQRFEQRSFFGVIASNSNCVWIPTEGSRT-SPGQIITSSLENINCWDIKTGNLLKT 59

Query: 61  LSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKS 120
           LSD +P GSID K  KPAEV+YL YH ETNLLAAGY DG IK+WD+ +++VL+ FN H +
Sbjct: 60  LSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTA 119

Query: 121 AITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVSTSK 180
           AIT +KFD +GTRLISGSRDSNII+WDLV EVGL KLRSHKD+I+GIW E +DWL+STSK
Sbjct: 120 AITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLISTSK 179

Query: 181 DGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKEAGSKLI 240
           DGLIK+WD+K QQC+ETH+AHT ECW++ + +DL++T+ AD++LK+W LD  +E GSKL 
Sbjct: 180 DGLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTANADSELKIWELDLERENGSKLK 239

Query: 241 EKGVYDKQSKQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRIRREEEISKAXXXXXXXXX 300
           EKG+Y+KQS+QR +D+K    P+   FFY+QNADKTTEVFRIR   E+SKA         
Sbjct: 240 EKGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTTEVFRIRTSSELSKALKKREKRLK 299

Query: 301 XXGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSNSIEY 360
             G++++EIQ+ IK S+ + I+ PFQV++S +K KS ++T  S +KLE V TTS+N+IEY
Sbjct: 300 EKGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNNTIEY 359

Query: 361 YSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLKTKAC 420
           YSIPY+ + PT  A ++LYTIEL GHRTD+RS+DIS+D+KLLA ASNG+LK+WN+ T++C
Sbjct: 360 YSIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKIWNITTQSC 419

Query: 421 IRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSD 480
           IR FDCGYAL CKFLPGGTLV+VGTR G LQLFDLASS +LENKE AH+ AIWSLD+TSD
Sbjct: 420 IRTFDCGYALCCKFLPGGTLVVVGTRGGELQLFDLASSIVLENKEAAHDAAIWSLDLTSD 479

Query: 481 GRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDK 540
           GRRL+TGSADKT+KFWNFQVE++L+  + DKY   ++++HDTT+E+ ED+LSV+ISPED+
Sbjct: 480 GRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDR 539

Query: 541 FLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600
           FLA+SLLDNTVKVF+LDSMKFFLSLYGHKLPVLSIDIS+DSKLIITSSADKNIKIWGLDF
Sbjct: 540 FLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDF 599

Query: 601 GDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIA 660
           GDCH+SLFAHQD+IMNVKF+P+SHNFFS  KDG++KYWDG KF+CIQKL AH+SEVW++A
Sbjct: 600 GDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALA 659

Query: 661 ITSDGTSVISASHDHSLRVWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGSGDDAFKG 720
           ++SDG   +S SHD S+RVWEET+DQVFL             + LL++LE  + D+ F  
Sbjct: 660 LSSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTLENDASDEKFAR 719

Query: 721 DAEKVED--ESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQIDMKAWEKKKSSGE 778
           ++E+  D  E T V  QT+ESLKAGERLMEALDLG+SE+EA E+Y  ++  W K K SG+
Sbjct: 720 NSEEDTDVTEVTDVHKQTIESLKAGERLMEALDLGISELEAQEEYHRNLLLWNKNK-SGD 778

Query: 779 PPIKPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPFSYVLKLLKFIDIVMKDK 838
            P+KPQ N+ILIA+ K P EYIM+TLV+IKP+QLEDALLVLPFSYVLK LKFID  ++ K
Sbjct: 779 QPMKPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFSYVLKFLKFIDASIEKK 838

Query: 839 KMTKNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNSLRDSLQENVDDLGFNIQ 898
           ++  N+L LIC+NL +V++ NHKELI+Q+NE LK QI  VK+ LR +L+ N+DDLGFNI+
Sbjct: 839 QLVNNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKLRAALKGNIDDLGFNIE 898

Query: 899 GLKFIKQQWNLKHNXXXXXXXXKK--EESSGKKRIFGTL 935
           GLKFIKQQWN+KHN        ++  E  S KKR+F T+
Sbjct: 899 GLKFIKQQWNVKHNFEFVDEYDQRDAETKSSKKRVFTTV 937

>AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR129W
           (DIP2)
          Length = 935

 Score = 1281 bits (3314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 606/940 (64%), Positives = 749/940 (79%), Gaps = 10/940 (1%)

Query: 1   MVKSYQRFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISV 60
           MVKSYQRFEQA VFGV++ N+NCVW+  ++K  NSPG VIT ALE +  W+IKTGEL+  
Sbjct: 1   MVKSYQRFEQADVFGVVTANSNCVWLPSQAK--NSPGQVITGALEEVKCWEIKTGELLKT 58

Query: 61  LSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKS 120
           + DGLP G+ID K+ KPAE +YL YH+ET +LA GY DGTIK+WD+ +++VL+ F+ H S
Sbjct: 59  MRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSS 118

Query: 121 AITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVSTSK 180
           AIT+++FD TGTRLISGSRD+ II+WDLV+E GL KLRSHKDAI+GIWCE +DWL+S SK
Sbjct: 119 AITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSK 178

Query: 181 DGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKEAGSKLI 240
           DGLIK+WD+KV QC+ETH+AHTGECW++ V ++++IT+ A++++KLW LD  +  GS L+
Sbjct: 179 DGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPNGSMLL 238

Query: 241 EKGVYDKQSKQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRIRREEEISKAXXXXXXXXX 300
           EKG Y+KQSKQR  ++ F+   +GT FFY  N+DKT E+FRIR E EI+KA         
Sbjct: 239 EKGSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKRFK 298

Query: 301 XXGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSNSIEY 360
             GM+DEEIQ++ + SY+++++HPFQ+++S +K+K+ S+T  + +KLE V+TT++N+IEY
Sbjct: 299 EKGMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANNTIEY 358

Query: 361 YSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLKTKAC 420
           YSIPY+K++P  P   +L++IE PGHRTD+R+ DIS DDKLLATASNG LKVWN+KTK C
Sbjct: 359 YSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIKTKTC 418

Query: 421 IRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSD 480
           IR  DCGYAL CKFLPGG LVI+GTR G LQLFDLASST+LEN E+AH  AIWSLD+TSD
Sbjct: 419 IRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSD 478

Query: 481 GRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDK 540
           G+RLVT SADKT+KFW+F+VE++LV GT DK++P MKLIHDTT+++ ED+  V+ISPED+
Sbjct: 479 GKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDR 538

Query: 541 FLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600
           FLA+SLLDNTVKVF+LDSMKFFLSLYGHKLPVLS+DIS DSKLIITSSADKNIKIWGLDF
Sbjct: 539 FLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDF 598

Query: 601 GDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIA 660
           GDCHKSLFAHQDSIMNVKFLPESHNFFS SKDG VKYWDG+ F+CIQKL  HQ EVW++A
Sbjct: 599 GDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALA 658

Query: 661 ITSDGTSVISASHDHSLRVWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGSGDDAF-- 718
           ++SDG +V+S SHD S+RVWEET+DQVFL              TLL SLE GSGDDAF  
Sbjct: 659 VSSDGQAVVSVSHDRSIRVWEETEDQVFLEEEREKELEEQYEKTLLTSLEGGSGDDAFIS 718

Query: 719 -KGDAEKVEDESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQIDMKAWEKKKSSG 777
             GD E    EST V  QT+ESLKAGERLMEALDLG++EI+A EKY+  MK W KK   G
Sbjct: 719 NNGD-ETAGVESTEVHKQTIESLKAGERLMEALDLGITEIDAWEKYEQQMKLWNKK--LG 775

Query: 778 EPPIKPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPFSYVLKLLKFIDIVMKD 837
           + P KPQ NAIL A+ K P  Y+METL KIKPSQLEDALLVLPFSYVLK LKFIDI +K+
Sbjct: 776 DQPTKPQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVLPFSYVLKFLKFIDIAIKN 835

Query: 838 KKMTKNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNSLRDSLQENVDDLGFNI 897
             +    L L+CK L FV+RSNHKEL+SQ+NE LK QI  VK+ LR +L+ +VDDLGFNI
Sbjct: 836 DVILHKQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVKDQLRAALRSHVDDLGFNI 895

Query: 898 QGLKFIKQQWNLKHNXXXXXXXXK--KEESSGKKRIFGTL 935
           QGLKF++  WN+ HN        +  KE+   KKR+F T 
Sbjct: 896 QGLKFVRNHWNVNHNYDFNDEYDQLAKEKVHSKKRLFPTF 935

>KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} similar
           to uniprot|Q12220 Saccharomyces cerevisiae YLR129W DIP2
           Nucleolar protein specifically associated with the U3
           snoRNA part of the large ribonucleoprotein complex known
           as the small subunit (SSU) processome required for 18S
           rRNA biogenesis part of the active pre- rRNA processing
           complex
          Length = 936

 Score = 1172 bits (3031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 574/943 (60%), Positives = 721/943 (76%), Gaps = 16/943 (1%)

Query: 1   MVKSYQRFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISV 60
           MVKSYQRFEQ+ +FG+IST+   +++   +  S   G +IT ALENI IW +KT E + V
Sbjct: 1   MVKSYQRFEQSGLFGLISTSNQSIYLPATNSTS---GKLITGALENIQIWTLKTNE-VEV 56

Query: 61  LSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKS 120
           L+DGLP G+++   SKP+ V+ + +H ET LL  GY DG IKVWDLLSKSVL+ FNGHKS
Sbjct: 57  LTDGLPIGAVETNISKPSVVTAMCFHKETELLCVGYEDGVIKVWDLLSKSVLMQFNGHKS 116

Query: 121 AITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGE-DWLVSTS 179
            +TV++ D  GTRL+SGS+DS++I+WDLV EVGL KLRSHKDAI+GIW +   DWL+S +
Sbjct: 117 GVTVLRLDSEGTRLVSGSKDSDLIIWDLVGEVGLMKLRSHKDAITGIWIDHNMDWLISVA 176

Query: 180 KDGLIKIWDLKVQ-QCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKEAGSK 238
           KDGLIK+WDLK   QC+ETH+AHTG+CW+M + E+++IT+  D+Q K+W LD  K  G K
Sbjct: 177 KDGLIKVWDLKAGGQCVETHMAHTGQCWSMAIDEEVIITTSMDSQAKIWELDLEKSNGEK 236

Query: 239 LIEKGVYDKQSKQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRIRREEEISKAXXXXXXX 298
           + E+G ++ +SKQRG+  +F  APNGT FFYIQN DKT E+FRIR EEEI KA       
Sbjct: 237 ISERGTFETESKQRGVSTEFITAPNGTRFFYIQNNDKTIEIFRIRPEEEIRKALNRREKR 296

Query: 299 XXXXGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSNSI 358
               G ++EEIQ+ +  +  S++ H F  ++S YKIKS ++   SN+KLE V+TTS+N+I
Sbjct: 297 LRDKGASEEEIQEAVNPNDISVLFHSFSTVRSSYKIKSSNWIQASNSKLEVVLTTSNNTI 356

Query: 359 EYYSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLKTK 418
           E Y IPY KRD  +  P R Y +EL GHRTDIRS+DISDD KLL+TASNG LKVWNL TK
Sbjct: 357 ESYQIPYSKRD--AEPPVRRYNVELQGHRTDIRSMDISDDGKLLSTASNGELKVWNLTTK 414

Query: 419 ACIRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDIT 478
            CIR F CGYAL  + LPGG LV+VGTR+G LQLFDLASSTLL   E AH  AIWSLD+T
Sbjct: 415 KCIRTFSCGYALCSQMLPGGLLVVVGTRQGELQLFDLASSTLLSTTE-AHTAAIWSLDLT 473

Query: 479 SDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPE 538
           S+G+RLVTGSADK+ KFW+F+V E LVPGT DKY+P +KL+HDTT+E+ +D+L+V+IS E
Sbjct: 474 SNGKRLVTGSADKSCKFWDFEVVEQLVPGTKDKYIPQLKLVHDTTLELTDDILAVKISSE 533

Query: 539 DKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGL 598
           D++LA+SLLDNTVKVF+ DS+KF+LSLYGHKLPVLSID S DSK++ITSSADKNIKIWG+
Sbjct: 534 DRYLAVSLLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIKIWGV 593

Query: 599 DFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWS 658
           DFGDCHKS+FAHQDSIM+V+F  ++HNFFS  KDG VK WDGDKF+CIQKL  HQSEVW 
Sbjct: 594 DFGDCHKSIFAHQDSIMSVRFEADTHNFFSCGKDGAVKRWDGDKFDCIQKLNGHQSEVWC 653

Query: 659 IAITSDGTSVISASHDHSLRVWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGSGDDAF 718
           IA++ DG +V+S SHDHS+RVW+ETDDQVFL             +TLL SLE GSGDD F
Sbjct: 654 IAVSPDGRTVVSTSHDHSIRVWQETDDQVFLEEEKEREMEEEYEETLLKSLEGGSGDDQF 713

Query: 719 KGDA----EKVEDESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQIDMKAWEKKK 774
             D     + V DE + V  QT+ESLKAGE+LMEALDLG++EIE+ E Y+  +K+  KKK
Sbjct: 714 LRDKNSGDDGVIDEVSGVNKQTLESLKAGEKLMEALDLGVAEIESWENYEKSLKS-WKKK 772

Query: 775 SSGEPPIKPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPFSYVLKLLKFIDIV 834
            SGEPP+KPQ NAILIAMK +P +YIM+TL KIKPSQLED+LLVLPFSYV+K  KF D++
Sbjct: 773 KSGEPPMKPQSNAILIAMKIKPEKYIMDTLGKIKPSQLEDSLLVLPFSYVIKFFKFFDVI 832

Query: 835 MKDKKMTKNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNSLRDSLQENVDDLG 894
           MK K +   +L LICK LFF++R+N+KEL++Q+NE LK +I  VK ++R  LQ+N DDLG
Sbjct: 833 MKQKDLVLLHLSLICKILFFIVRTNNKELVAQKNEELKQRIERVKTNIRTMLQKNADDLG 892

Query: 895 FNIQGLKFIKQQWNLKHNXXXX--XXXXKKEESSGKKRIFGTL 935
           FNI GL FIKQQWNL+HN          + E+   KKR+F T+
Sbjct: 893 FNIAGLNFIKQQWNLRHNLEFTDDYSQLEHEKKVAKKRVFETV 935

>TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {ON}
           Anc_8.435 YLR222C
          Length = 805

 Score =  144 bits (363), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 160/637 (25%), Positives = 279/637 (43%), Gaps = 110/637 (17%)

Query: 73  KSSKPAEVSYLHYHDETN-LLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKF--DV 129
           +S K +  SY+   D T+ L+A G  DG+I V D+ +  +  +F GH   I+ +KF  ++
Sbjct: 96  RSMKISSPSYVMDSDSTSTLIAIGGTDGSISVVDVENGYITHSFKGHGGTISSLKFHGEL 155

Query: 130 TGTRLISGSRDSNII--VWDLVSEVGLYKLRSHKDAISGI---WCEGEDW--LVSTSKDG 182
            G + +  S D+N +  VWDLV    L+ ++ H  AI G+     EGED   L+S  +D 
Sbjct: 156 NGDKWLLASGDTNGVAKVWDLVKRRCLHTMQEHTSAIRGLDFKEVEGEDCVKLLSGGRDD 215

Query: 183 LIKIWDLKVQQ---CIETHIAHTG-ECWAMGVHEDLLITSGADTQLKLWNLDFSKEAGSK 238
           ++ +W+  +++    ++T   H   E        DL+ T+G +  L+L +L+       K
Sbjct: 216 IVNLWEFNMKKHSKLLKTVPVHQQVESCGFVRESDLVYTAGGEAVLQLISLE-----SQK 270

Query: 239 LIEKGVYDKQSKQRGLDIKF--SVAPNGTAF-FYIQNADKTTEVFRIRREEEISKAXXXX 295
           +I+K        Q+ ++  F   V P  +   FY+  +D+T ++  I  EE IS      
Sbjct: 271 VIKK-------TQKPIEELFIVGVLPILSGREFYLVLSDQTLQL--INMEEAISN----- 316

Query: 296 XXXXXXXGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSS 355
                     DE I  N+  S          +  +   I  +        K+   + T+S
Sbjct: 317 --------FDDELI--NVASS----------IAGNHGTIADIRVVGPGLNKI--ALATNS 354

Query: 356 NSIEYYSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATAS-NGLLKVWN 414
            ++    IP +  + + P    +Y     GH   + S+D ++D   LAT S +    +W 
Sbjct: 355 PALRIIPIP-QTSENSLPLDVEVY----EGHEDLLNSLDATEDGLWLATCSKDSSAILWR 409

Query: 415 LKTKACIRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWS 474
              +            T KF P                              A  TA+  
Sbjct: 410 FNVE------------TAKFFPYAKFT----------------------GHSASVTAVAL 435

Query: 475 LDITSDG--RRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDT--TMEVN-ED 529
            ++   G    L+T S D T+K W        VP  A++ +  +  I  +  T  V+ +D
Sbjct: 436 PNVMLRGWPEFLITASNDLTVKRWK-------VPKPANEDISDLLTIKQSEYTFHVHAKD 488

Query: 530 VLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSA 589
           + ++ ++P D   A +  D T K++ +++ +   +L GHK  +  +      KL+ TSS 
Sbjct: 489 INALSLAPNDSLFATASYDKTCKIWDVETGESKATLAGHKRGLWDVSFCQYDKLLATSSG 548

Query: 590 DKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKL 649
           DK IKIW LD   C K+L  H +++    F+ +     SS  DGL+K WD    +C++ L
Sbjct: 549 DKTIKIWNLDTFSCVKTLEGHTNAVQRCAFMNKQKQLVSSGADGLIKIWDCITGDCLKTL 608

Query: 650 AAHQSEVWSIAITSDGTSVISASHDHSLRVWEETDDQ 686
             H + +W++ + +DG  +ISA  D   + W +  ++
Sbjct: 609 DGHGNRIWAMNVCNDGDLIISADADGVFQFWRDCTEE 645

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 66/140 (47%), Gaps = 13/140 (9%)

Query: 49  IWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLS 108
           IWD++TGE  + L+ G   G  DV        S+  Y     LLA    D TIK+W+L +
Sbjct: 512 IWDVETGESKATLA-GHKRGLWDV--------SFCQYD---KLLATSSGDKTIKIWNLDT 559

Query: 109 KSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI- 167
            S + T  GH +A+    F     +L+S   D  I +WD ++   L  L  H + I  + 
Sbjct: 560 FSCVKTLEGHTNAVQRCAFMNKQKQLVSSGADGLIKIWDCITGDCLKTLDGHGNRIWAMN 619

Query: 168 WCEGEDWLVSTSKDGLIKIW 187
            C   D ++S   DG+ + W
Sbjct: 620 VCNDGDLIISADADGVFQFW 639

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 77/176 (43%), Gaps = 9/176 (5%)

Query: 514 PVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVL 573
           P  KL+H    +  +++ ++R++P+ ++L        +K+F LDSMK   S+     P  
Sbjct: 47  PTQKLLHTIENDDEQEITALRLTPDGRYLCYVSQAQQLKIFSLDSMKITRSMKISS-PSY 105

Query: 574 SIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHN----FFSS 629
            +D    S LI     D +I +  ++ G    S   H  +I ++KF  E +       S 
Sbjct: 106 VMDSDSTSTLIAIGGTDGSISVVDVENGYITHSFKGHGGTISSLKFHGELNGDKWLLASG 165

Query: 630 SKDGLVKYWDGDKFECIQKLAAHQSEVWSIAIT----SDGTSVISASHDHSLRVWE 681
             +G+ K WD  K  C+  +  H S +  +        D   ++S   D  + +WE
Sbjct: 166 DTNGVAKVWDLVKRRCLHTMQEHTSAIRGLDFKEVEGEDCVKLLSGGRDDIVNLWE 221

>NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {ON}
           Anc_8.435
          Length = 815

 Score =  135 bits (339), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 146/593 (24%), Positives = 247/593 (41%), Gaps = 83/593 (13%)

Query: 120 SAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGED----WL 175
           S   +M  D T T +  G  D +I V D+ +    + L+ H   IS +   G+     WL
Sbjct: 107 SPCYIMDCDSTSTLVALGGTDGSITVVDIENGFITHSLKGHGATISALKFFGQANSNVWL 166

Query: 176 V-STSKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHED----LLITSGADTQLKLWNLD 230
           + S   +G++K+WDL  ++C+ T   H+     + V E      LI+ G D    LWN +
Sbjct: 167 LCSGDTNGMVKVWDLVKRKCLHTMQEHSNAVRGLDVREVGDEWQLISGGRDNVCTLWNFN 226

Query: 231 FSKEAGSKLIEKGVYDKQSKQRGL------DIKFSVAPNGTAFFYIQNADKTTEVFRIRR 284
             K+    L++     +Q +  G       D+ ++    G A     + +K T + + ++
Sbjct: 227 LKKKC--TLLKTIPVHQQVESCGFINHEHDDLIYTAG--GDALLQFISLEKATMIKKTKK 282

Query: 285 EEE---ISKAXXXXXXXXXXXGMTDE-----EIQQNIKESYSSIIMHPFQVIKSQYKIKS 336
             E   I               M+D+     +I+ N+    S II     +  +   I  
Sbjct: 283 HIEELFIIGVLPILENDKMYLVMSDQTLELVDIKSNLLNESSDIIEIESCIAGNNGTIAD 342

Query: 337 VSFTTVSNTKLEFVVTTSSNSIEYYSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDIS 396
           + F   ++ KL   + T+S ++    +P  +++   P    +Y     GH   + S+D +
Sbjct: 343 MKFVGPNHDKL--ALATNSPTLRIIPVPSSEQEEL-PINVEMY----EGHEDLLNSLDTT 395

Query: 397 DDDKLLATAS-NGLLKVWNLKTKACIRVFDCGYALTCKFLP-GGTLVIVGTREGSLQLFD 454
           DD   +ATAS +    VW  K  + I  F   Y    KF+    T+  VG     L+ + 
Sbjct: 396 DDGLWMATASKDHTAIVW--KYNSIINKFQ-PYV---KFIGHSATVTAVGLPNVMLRGYP 449

Query: 455 LASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNF-----QVEEDLVPGTA 509
                                        L+T S D TIK W        VEED      
Sbjct: 450 ---------------------------EFLLTASNDLTIKKWKIPKPSTTVEEDC----- 477

Query: 510 DKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHK 569
                ++K+   T     +D+ ++ ISP D   A +  D T K++ L++ +   +L  HK
Sbjct: 478 ----QIVKVSEYTRRAHEKDINALAISPNDSIFATASYDKTCKIWDLENGELTATLSNHK 533

Query: 570 LPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSS 629
             +  +      KLI T S DK IKIW LD     K+L  H +++    F+ +     SS
Sbjct: 534 RGLWDVAFCQYDKLIATCSGDKTIKIWSLDTFSVMKTLEGHTNAVQRCMFINKQLQLVSS 593

Query: 630 SKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWEE 682
             DGL+K WD    +C++ L  H + +W++   +DG  ++SA  D   + W++
Sbjct: 594 GADGLIKIWDCSTGDCLKTLDGHDNRIWALTEINDGDMIVSADADGVFQFWKD 646

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 76/158 (48%), Gaps = 3/158 (1%)

Query: 73  KSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGT 132
           + +   +++ L      ++ A    D T K+WDL +  +  T + HK  +  + F     
Sbjct: 487 RRAHEKDINALAISPNDSIFATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDK 546

Query: 133 RLISGSRDSNIIVWDLVSEVGLYKLRSHKDAIS-GIWCEGEDWLVSTSKDGLIKIWDLKV 191
            + + S D  I +W L +   +  L  H +A+   ++   +  LVS+  DGLIKIWD   
Sbjct: 547 LIATCSGDKTIKIWSLDTFSVMKTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCST 606

Query: 192 QQCIETHIAHTGECWAMG-VHE-DLLITSGADTQLKLW 227
             C++T   H    WA+  +++ D+++++ AD   + W
Sbjct: 607 GDCLKTLDGHDNRIWALTEINDGDMIVSADADGVFQFW 644

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 108/501 (21%), Positives = 193/501 (38%), Gaps = 87/501 (17%)

Query: 78  AEVSYLHYHDETN----LLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGT- 132
           A +S L +  + N    LL +G  +G +KVWDL+ +  L T   H +A+  +     G  
Sbjct: 149 ATISALKFFGQANSNVWLLCSGDTNGMVKVWDLVKRKCLHTMQEHSNAVRGLDVREVGDE 208

Query: 133 -RLISGSRDSNIIVW--DLVSEVGLYK---LRSHKDAISGIWCEGEDWLVSTSKDGLIKI 186
            +LISG RD+   +W  +L  +  L K   +    ++   I  E +D + +   D L++ 
Sbjct: 209 WQLISGGRDNVCTLWNFNLKKKCTLLKTIPVHQQVESCGFINHEHDDLIYTAGGDALLQF 268

Query: 187 WDLKVQQCIETHIAHTGECWAMGV----HEDLLITSGADTQLKLWNLDFS-KEAGSKLIE 241
             L+    I+    H  E + +GV      D +    +D  L+L ++  +     S +IE
Sbjct: 269 ISLEKATMIKKTKKHIEELFIIGVLPILENDKMYLVMSDQTLELVDIKSNLLNESSDIIE 328

Query: 242 KGVYDKQSKQRGLDIKF--------SVAPNGTAFFYIQNADKTTEVFRIRREEEISKAXX 293
                  +     D+KF        ++A N      I       E   I  E        
Sbjct: 329 IESCIAGNNGTIADMKFVGPNHDKLALATNSPTLRIIPVPSSEQEELPINVEMYEGHEDL 388

Query: 294 XXXXXXXXXGM---TDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKL--- 347
                    G+   T  +    I   Y+SII      +K      +V+   + N  L   
Sbjct: 389 LNSLDTTDDGLWMATASKDHTAIVWKYNSIINKFQPYVKFIGHSATVTAVGLPNVMLRGY 448

Query: 348 -EFVVTTSSN-SIEYYSIPYEKRDPTSPAPTRLYTIELP-----GHRTDIRSVDISDDDK 400
            EF++T S++ +I+ + IP     P++        +++       H  DI ++ IS +D 
Sbjct: 449 PEFLLTASNDLTIKKWKIP----KPSTTVEEDCQIVKVSEYTRRAHEKDINALAISPNDS 504

Query: 401 LLATAS-----------NGLL--------------------------------KVWNLKT 417
           + ATAS           NG L                                K+W+L T
Sbjct: 505 IFATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDKLIATCSGDKTIKIWSLDT 564

Query: 418 KACIRVFD--CGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSL 475
            + ++  +        C F+     ++    +G ++++D ++   L+   D H+  IW+L
Sbjct: 565 FSVMKTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLKTL-DGHDNRIWAL 623

Query: 476 DITSDGRRLVTGSADKTIKFW 496
              +DG  +V+  AD   +FW
Sbjct: 624 TEINDGDMIVSADADGVFQFW 644

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 64/143 (44%), Gaps = 19/143 (13%)

Query: 49  IWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLS 108
           IWD++ GEL + LS+               +V++  Y     L+A    D TIK+W L +
Sbjct: 517 IWDLENGELTATLSN---------HKRGLWDVAFCQYD---KLIATCSGDKTIKIWSLDT 564

Query: 109 KSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIW 168
            SV+ T  GH +A+    F     +L+S   D  I +WD  +   L  L  H +    IW
Sbjct: 565 FSVMKTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLKTLDGHDNR---IW 621

Query: 169 CEGE----DWLVSTSKDGLIKIW 187
              E    D +VS   DG+ + W
Sbjct: 622 ALTEINDGDMIVSADADGVFQFW 644

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/174 (20%), Positives = 78/174 (44%), Gaps = 10/174 (5%)

Query: 517 KLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKF----FLSLYGHKLPV 572
           + +H    +  +++ +++++P+ ++L+    +  +K+F LD  K      +       P 
Sbjct: 50  RRLHSIANDDEQEITALKLTPDAQYLSFISQNQLLKIFKLDQEKKDQGKIIRSMKMSSPC 109

Query: 573 LSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHN----FFS 628
             +D    S L+     D +I +  ++ G    SL  H  +I  +KF  ++++      S
Sbjct: 110 YIMDCDSTSTLVALGGTDGSITVVDIENGFITHSLKGHGATISALKFFGQANSNVWLLCS 169

Query: 629 SSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAI--TSDGTSVISASHDHSLRVW 680
              +G+VK WD  K +C+  +  H + V  + +    D   +IS   D+   +W
Sbjct: 170 GDTNGMVKVWDLVKRKCLHTMQEHSNAVRGLDVREVGDEWQLISGGRDNVCTLW 223

>ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 808

 Score =  132 bits (333), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 154/633 (24%), Positives = 260/633 (41%), Gaps = 82/633 (12%)

Query: 78  AEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISG 137
           A+  YL +  +  LL         K++DL    ++ +     S   V+  D T T L  G
Sbjct: 70  ADGRYLCFASQAQLL---------KIFDLREGKIVRSMK-ISSPSYVVDSDSTSTLLAIG 119

Query: 138 SRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGED----WLVSTS-KDGLIKIWDLKVQ 192
             D +I V D+ +    + L+ H   IS +   GE     WL+++   +G++KIWDL  +
Sbjct: 120 GTDGSITVVDVENGYVTHSLKGHGGTISSVKFYGEQNGEVWLLASGDTNGMVKIWDLVKR 179

Query: 193 QCIETHIAHTGECWAMGVHED--------LLITSGADTQLKLWNLDFSKEAGSKLIEKGV 244
           +CI T   HT     +  HE          LI+ G D  +  W  +  K+    L++   
Sbjct: 180 KCIHTVQEHTAAVRGIDFHESKNNDESELFLISGGRDDVINYWQFNLKKKC--TLLKTLP 237

Query: 245 YDKQSKQRGLDIKFSVAPNGT-AFFYIQNADKTTEVFRIRRE-EEISKAXXXXXXXXXXX 302
             +Q +  G      +   G+ AF  + + +    V R  +  EE+              
Sbjct: 238 VSQQVESCGFANSELIYTAGSDAFLQLISLESGKAVKRTHKPVEELFTVGVLSILGGSKL 297

Query: 303 GM--TDEEIQ----QNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSN 356
            M  +D+ +     +   ES S++I     +  +   I  ++F      KL      ++N
Sbjct: 298 YMVISDQTLALINLEEALESESALIEVESYIAGNHGTIADMNFVGPELDKLAL----ATN 353

Query: 357 SIEYYSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATAS-NGLLKVWNL 415
           S     IP        P    LY     GH+  + +VD ++D   LATAS +    +W  
Sbjct: 354 SPTLRIIPVSMEGGL-PIDVELY----EGHKDLLNAVDATEDGLWLATASKDSTAILWWY 408

Query: 416 KTKACIRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSL 475
           ++             + KF+P                F+  SS +         TA+   
Sbjct: 409 QSN------------SNKFVPYAK-------------FEGHSSAV---------TAVGLP 434

Query: 476 DITSDG--RRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSV 533
           +I   G    ++T S D T+K W        V       L V+K+   T     +D+ ++
Sbjct: 435 NIMHKGWPEFILTASNDLTVKKWAVPKP---VASNESFELQVVKVSEYTRRAHEKDINAL 491

Query: 534 RISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNI 593
            ++P D   A +  D T KV+ L+S +   +L  H+  +  +      +LI T S DK I
Sbjct: 492 SVAPNDSTFATASYDKTCKVWDLESGEVKATLANHRRGLWDVAFCQYERLIATCSGDKTI 551

Query: 594 KIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQ 653
           KIW LD     K+   H +++    F+ +     SSS DGLVK WD    EC++ L  H 
Sbjct: 552 KIWSLDTFAVVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWDCSTGECVKTLDGHT 611

Query: 654 SEVWSIAITSDGTSVISASHDHSLRVWEETDDQ 686
           + +W++ +  DG  ++SA  D   + W+++ +Q
Sbjct: 612 NRIWALCVAEDGDLIVSADADGVFQFWKDSTEQ 644

 Score = 74.3 bits (181), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 90/197 (45%), Gaps = 5/197 (2%)

Query: 92  LAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSE 151
            A    D T KVWDL S  V  T   H+  +  + F      + + S D  I +W L + 
Sbjct: 500 FATASYDKTCKVWDLESGEVKATLANHRRGLWDVAFCQYERLIATCSGDKTIKIWSLDTF 559

Query: 152 VGLYKLRSHKDAISGI-WCEGEDWLVSTSKDGLIKIWDLKVQQCIETHIAHTGECWAMGV 210
             +     H +A+    +   +  LVS+S DGL+KIWD    +C++T   HT   WA+ V
Sbjct: 560 AVVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWDCSTGECVKTLDGHTNRIWALCV 619

Query: 211 HE--DLLITSGADTQLKLWNLDFSKEAGSKLIEKGVYDKQSKQRGLDIKFSVAPNGTAFF 268
            E  DL++++ AD   + W  D +++   +  E+  + K  +++ L    S      AF 
Sbjct: 620 AEDGDLIVSADADGVFQFWK-DSTEQERQQHNEQQ-HLKVEQEQSLQNYLSQGDWTNAFL 677

Query: 269 YIQNADKTTEVFRIRRE 285
                D    +FR+ ++
Sbjct: 678 LAITLDHPLRLFRVLKQ 694

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 67/136 (49%), Gaps = 4/136 (2%)

Query: 383 LPGHRTDIRSVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFD--CGYALTCKFLPGGT 439
           L  HR  +  V     ++L+AT S +  +K+W+L T A ++ F+        C F+   T
Sbjct: 523 LANHRRGLWDVAFCQYERLIATCSGDKTIKIWSLDTFAVVKTFEGHTNAVQRCSFINKQT 582

Query: 440 LVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQ 499
            ++  + +G ++++D ++   ++   D H   IW+L +  DG  +V+  AD   +FW   
Sbjct: 583 QLVSSSADGLVKIWDCSTGECVKTL-DGHTNRIWALCVAEDGDLIVSADADGVFQFWKDS 641

Query: 500 VEEDLVPGTADKYLPV 515
            E++       ++L V
Sbjct: 642 TEQERQQHNEQQHLKV 657

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 68/153 (44%), Gaps = 5/153 (3%)

Query: 511 KYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKL 570
           + +P  K +     +  +D+ +++++ + ++L  +     +K+F L   K   S+     
Sbjct: 44  QLVPERKTLFTIENDDEQDITALKLTADGRYLCFASQAQLLKIFDLREGKIVRSMKISS- 102

Query: 571 PVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHN----F 626
           P   +D    S L+     D +I +  ++ G    SL  H  +I +VKF  E +      
Sbjct: 103 PSYVVDSDSTSTLLAIGGTDGSITVVDVENGYVTHSLKGHGGTISSVKFYGEQNGEVWLL 162

Query: 627 FSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSI 659
            S   +G+VK WD  K +CI  +  H + V  I
Sbjct: 163 ASGDTNGMVKIWDLVKRKCIHTVQEHTAAVRGI 195

>Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}
           similar to Ashbya gossypii AGR180W
          Length = 810

 Score =  132 bits (332), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 154/646 (23%), Positives = 268/646 (41%), Gaps = 125/646 (19%)

Query: 72  VKSSKPAEVSYLHYHDETN-LLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKF--D 128
           V+S K +   Y+   DET+ LL  G  DG++ ++D+ +  V  +F GH   I+ +KF  +
Sbjct: 95  VRSMKVSSPVYVMDCDETSTLLVIGGTDGSVSIFDIENGYVTHSFKGHGGIISSVKFYGE 154

Query: 129 VTGTRLISGSRDSNIIV--WDLVSEVGLYKLRSHKDAISGI-WC--EGEDWLVSTSKDGL 183
           + G   +  S D+N +V  WDLV    ++ ++ H  A+ G+ +C  + E  L+S  +D +
Sbjct: 155 LDGANWLLASGDTNGVVKIWDLVKRRCMHTIQEHTAAVRGLDFCVKDSEMLLISGGRDEI 214

Query: 184 IKIWD------------LKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDF 231
           I +              L V+Q IE        C  +  HE L+  +G            
Sbjct: 215 INLHHFDYKKTCKLLKTLPVKQQIEA-------CGFIANHESLIYHAG------------ 255

Query: 232 SKEAGSKLIEKGVYDKQSKQRGLDIKFSVAPNGTAFFY----IQNADKTTEVFRIRREEE 287
                    +  VY     Q G  IK S  P    F      I+N  K   V        
Sbjct: 256 ---------DNAVYQIVCLQSGKQIKSSQKPQEELFIIGVLSIENGSKHYLV-------- 298

Query: 288 ISKAXXXXXXXXXXXGMTDE-----EIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTV 342
                           ++D+     +I+Q + E  ++I +   ++  +   I  + F   
Sbjct: 299 ----------------LSDQTLFLLDIEQALMEEDTTIPIKS-KIAGNHGTIADMKFVGP 341

Query: 343 SNTKLEFVVTTSSNSIEYYSIPY-EKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKL 401
           +   L   + T+S ++     P   + D   P  T +Y     GH   + ++D S+D   
Sbjct: 342 NLDML--ALATNSPTLRIIKAPQASEEDGQFPVETNMY----GGHVDLLNALDASEDGLW 395

Query: 402 LATAS-NGLLKVWNLKTKACIRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTL 460
           +ATAS +  + +W    +         +    KF+            GS+      ++  
Sbjct: 396 IATASKDHTVLLWRYSEQL------GDFKQYAKFI---------GHAGSV------TAVA 434

Query: 461 LENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIH 520
           L N  D H               L++ S D T+K W  +V +     T D+ +PV+K   
Sbjct: 435 LPNIMDQHFPNF-----------LLSSSTDMTVKKW--KVPKPTQNPTEDE-IPVVKTSE 480

Query: 521 DTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFD 580
            T     +D+ ++ ISP D   A +  D T K++ L + +   +L  HK  +  +     
Sbjct: 481 YTRRAHEKDINALSISPNDSIFATASYDKTCKIWDLVTGELVATLANHKRGLWDVSFCQH 540

Query: 581 SKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDG 640
            KLI T S DK IKIW L+  +   +L  H +++  + F+ ++    S   DGLVK WD 
Sbjct: 541 DKLIATCSGDKTIKIWSLENYNIKATLEGHTNAVQRISFINKNKQLVSCGADGLVKIWDC 600

Query: 641 DKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWEETDDQ 686
              EC++ L AH + +W++ +  DG   ++A  D   + W++  ++
Sbjct: 601 STGECLRTLDAHDNRIWALEVADDGDRFVTADADGLFQFWKDNSEE 646

 Score = 71.2 bits (173), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 74/156 (47%), Gaps = 4/156 (2%)

Query: 90  NLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLV 149
           ++ A    D T K+WDL++  ++ T   HK  +  + F      + + S D  I +W L 
Sbjct: 500 SIFATASYDKTCKIWDLVTGELVATLANHKRGLWDVSFCQHDKLIATCSGDKTIKIWSLE 559

Query: 150 SEVGLYKLRSHKDAISGI-WCEGEDWLVSTSKDGLIKIWDLKVQQCIETHIAHTGECWAM 208
           +      L  H +A+  I +      LVS   DGL+KIWD    +C+ T  AH    WA+
Sbjct: 560 NYNIKATLEGHTNAVQRISFINKNKQLVSCGADGLVKIWDCSTGECLRTLDAHDNRIWAL 619

Query: 209 GVHE--DLLITSGADTQLKLWNLDFSKEAGSKLIEK 242
            V +  D  +T+ AD   + W  D S+E   + +EK
Sbjct: 620 EVADDGDRFVTADADGLFQFWK-DNSEEEHEQDLEK 654

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 67/140 (47%), Gaps = 13/140 (9%)

Query: 49  IWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLS 108
           IWD+ TGEL++ L++    G  DV   +         HD+  L+A    D TIK+W L +
Sbjct: 513 IWDLVTGELVATLANH-KRGLWDVSFCQ---------HDK--LIATCSGDKTIKIWSLEN 560

Query: 109 KSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIW 168
            ++  T  GH +A+  + F     +L+S   D  + +WD  +   L  L +H + I  + 
Sbjct: 561 YNIKATLEGHTNAVQRISFINKNKQLVSCGADGLVKIWDCSTGECLRTLDAHDNRIWALE 620

Query: 169 CEGE-DWLVSTSKDGLIKIW 187
              + D  V+   DGL + W
Sbjct: 621 VADDGDRFVTADADGLFQFW 640

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 80/174 (45%), Gaps = 6/174 (3%)

Query: 334 IKSVSFTTVSNTKLEFVVTTSSNSIEYYSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSV 393
           +K+  +T  ++ K    ++ S N   + +  Y+K        T      L  H+  +  V
Sbjct: 476 VKTSEYTRRAHEKDINALSISPNDSIFATASYDKTCKIWDLVTGELVATLANHKRGLWDV 535

Query: 394 DISDDDKLLATAS-NGLLKVWNLKTKACIRVFDCGYALTCK---FLPGGTLVIVGTREGS 449
                DKL+AT S +  +K+W+L+    I+    G+    +   F+     ++    +G 
Sbjct: 536 SFCQHDKLIATCSGDKTIKIWSLENYN-IKATLEGHTNAVQRISFINKNKQLVSCGADGL 594

Query: 450 LQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEED 503
           ++++D ++   L    DAH+  IW+L++  DG R VT  AD   +FW    EE+
Sbjct: 595 VKIWDCSTGECLRTL-DAHDNRIWALEVADDGDRFVTADADGLFQFWKDNSEEE 647

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 69/144 (47%), Gaps = 5/144 (3%)

Query: 517 KLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSID 576
           +++H    +  +++ +++++P+  +L     +  ++++ L S K   S+     PV  +D
Sbjct: 50  EIVHKINNDDEQEITALKLTPDGSYLCFVAQNQLLRIYSLASKKIVRSMKVSS-PVYVMD 108

Query: 577 ISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE--SHNFFSSSKD-- 632
               S L++    D ++ I+ ++ G    S   H   I +VKF  E    N+  +S D  
Sbjct: 109 CDETSTLLVIGGTDGSVSIFDIENGYVTHSFKGHGGIISSVKFYGELDGANWLLASGDTN 168

Query: 633 GLVKYWDGDKFECIQKLAAHQSEV 656
           G+VK WD  K  C+  +  H + V
Sbjct: 169 GVVKIWDLVKRRCMHTIQEHTAAV 192

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 50/109 (45%), Gaps = 10/109 (9%)

Query: 397 DDDKLLATASNGLLKVWNLKTKACIRVFDCG---YALTCKFLPGGTLVIVGTREGSLQLF 453
           D   L   A N LL++++L +K  +R        Y + C      TL+++G  +GS+ +F
Sbjct: 71  DGSYLCFVAQNQLLRIYSLASKKIVRSMKVSSPVYVMDCD--ETSTLLVIGGTDGSVSIF 128

Query: 454 DLASSTLLENKEDAHETAIWSLDITS--DGRR--LVTGSADKTIKFWNF 498
           D+ +  +  + +  H   I S+      DG    L +G  +  +K W+ 
Sbjct: 129 DIENGYVTHSFK-GHGGIISSVKFYGELDGANWLLASGDTNGVVKIWDL 176

>KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {ON}
           Anc_8.435 YLR222C
          Length = 849

 Score =  132 bits (331), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 140/608 (23%), Positives = 245/608 (40%), Gaps = 103/608 (16%)

Query: 124 VMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGED----WLVSTS 179
           +M  + T T +  G  D +IIV D+ +    +  + H   IS +   GE     WL+++ 
Sbjct: 136 IMDSEATSTLVAVGGTDGSIIVVDIENGYVTHSFKGHGGTISCLKFFGEANSNVWLLASG 195

Query: 180 -KDGLIKIWDLKVQQCIETHIAHTGECWAMGVH---------EDLLITSGADTQLKLWNL 229
             +G+IK+W+L  ++C  T   HT     + +          +  +I+ G D  +  W L
Sbjct: 196 DTNGMIKVWNLVTRKCTHTVQEHTSAVRGIDIRSISDDTKSMQLQMISGGRDDVVNYWEL 255

Query: 230 DFSKEAGSKLIEKGVYDKQSKQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRIRREEEIS 289
           D  K+   KL++     +Q +Q G    F  +P      Y    D   +   + +   + 
Sbjct: 256 DNKKKC--KLLQTIPAHQQVEQCG----FIASPGHKNLIYTSGGDAIMQFISLEKGSIVK 309

Query: 290 KAXX------------XXXXXXXXXGMTDE-----EIQQNIKESYSSIIMHPFQVIKSQY 332
           K+                        M+D+     +++ N+K +    + +   +  +  
Sbjct: 310 KSKKPIEELFIIGVLPISQGEKLISVMSDQSLHYLDVESNLKATNEEELTYESALAGNHG 369

Query: 333 KIKSVSFTTVSNTKLEFVVTTSSNSIEYYSIPYEKRDPTSPAPTRLYTIEL---PGHRTD 389
            I  + F  V        + T+S ++     P    D ++     L  I++    GH   
Sbjct: 370 TIADMVF--VGPKFQHLALATNSPTLRIIPTPL---DDSTVDTNNLLPIDVDMYEGHEDL 424

Query: 390 IRSVDISDDDKLLATASNGLLKVWNLKTKACIRVFDCGYALTCKFLPGGTLVIVGTREGS 449
           + +VD ++D   LATAS         KT    R  D     T KF P    +        
Sbjct: 425 LNAVDATEDGLWLATASKD-------KTAIVWRYDD----ETAKFKPYAKFI-------- 465

Query: 450 LQLFDLASSTLLENKEDAHETAIWSLDITSDGRR-----LVTGSADKTIKFWNFQVEEDL 504
                             H +++ ++ + +   R     L+T S D TIK WN       
Sbjct: 466 -----------------GHSSSVTAVGLPNVMLRHWPEFLLTASNDLTIKKWN------- 501

Query: 505 VPGTADKYLPVMKLIH-----DTTMEVNE-DVLSVRISPEDKFLAISLLDNTVKVFYLDS 558
           +P  +DK    M+ IH     + T   +E D+ ++ +SP D   A +  D T K++ L++
Sbjct: 502 IPKPSDK----MEGIHLIKGSEYTRRAHEKDINALSVSPNDSVFATASYDKTSKIWDLET 557

Query: 559 MKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVK 618
            +   +L  HK  +  +      KL+ T S DK IKIW LD     ++L  H +++    
Sbjct: 558 GELTATLANHKRGLWDVSFCQYDKLLATCSGDKTIKIWSLDTFSVVRTLEGHTNAVQRCH 617

Query: 619 FLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLR 678
           F+ +     SS  DGL+K WD    EC++ L  H + +W++ I  DG  + SA  D   +
Sbjct: 618 FINKQTQLVSSGADGLIKIWDCSSGECVKTLDGHANRIWALTIQRDGELIASADADGVFQ 677

Query: 679 VWEETDDQ 686
            W +  +Q
Sbjct: 678 FWTDCSEQ 685

 Score = 90.5 bits (223), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 138/618 (22%), Positives = 245/618 (39%), Gaps = 114/618 (18%)

Query: 72  VKSSKPAEVSYLHYHDETN-LLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVT 130
           ++S K +  SY+   + T+ L+A G  DG+I V D+ +  V  +F GH   I+ +KF   
Sbjct: 125 MRSMKISSPSYIMDSEATSTLVAVGGTDGSIIVVDIENGYVTHSFKGHGGTISCLKFFGE 184

Query: 131 GTR----LISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEG--------EDWLVST 178
                  L SG  +  I VW+LV+    + ++ H  A+ GI            +  ++S 
Sbjct: 185 ANSNVWLLASGDTNGMIKVWNLVTRKCTHTVQEHTSAVRGIDIRSISDDTKSMQLQMISG 244

Query: 179 SKDGLIKIWDL------KVQQCIETH--IAHTGECWAMGVHEDLLITSGADTQLKLWNLD 230
            +D ++  W+L      K+ Q I  H  +   G   + G H++L+ TSG D  ++  +L 
Sbjct: 245 GRDDVVNYWELDNKKKCKLLQTIPAHQQVEQCGFIASPG-HKNLIYTSGGDAIMQFISL- 302

Query: 231 FSKEAGSKLIEKGVYDKQSKQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRIRREEEISK 290
                     EKG   K+SK+          P    F           V  I + E++  
Sbjct: 303 ----------EKGSIVKKSKK----------PIEELFI--------IGVLPISQGEKLIS 334

Query: 291 AXXXXXXXXXXXGMTDE-----EIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNT 345
                        M+D+     +++ N+K +    + +   +  +   I  + F  V   
Sbjct: 335 V------------MSDQSLHYLDVESNLKATNEEELTYESALAGNHGTIADMVF--VGPK 380

Query: 346 KLEFVVTTSSNSIEYYSIPYEKRDPTSPAPTRLYTIEL---PGHRTDIRSVDISDDDKLL 402
                + T+S ++     P    D ++     L  I++    GH   + +VD ++D   L
Sbjct: 381 FQHLALATNSPTLRIIPTPL---DDSTVDTNNLLPIDVDMYEGHEDLLNAVDATEDGLWL 437

Query: 403 ATAS-NGLLKVWNL-----KTKACIRVFDCGYALTCKFLPGGTL------VIVGTREGSL 450
           ATAS +    VW       K K   +      ++T   LP   L      ++  + + ++
Sbjct: 438 ATASKDKTAIVWRYDDETAKFKPYAKFIGHSSSVTAVGLPNVMLRHWPEFLLTASNDLTI 497

Query: 451 QLFDLASST-------LLENKE---DAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQV 500
           + +++   +       L++  E    AHE  I +L ++ +     T S DKT K W+ + 
Sbjct: 498 KKWNIPKPSDKMEGIHLIKGSEYTRRAHEKDINALSVSPNDSVFATASYDKTSKIWDLET 557

Query: 501 EEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMK 560
            E                +  T       +  V     DK LA    D T+K++ LD+  
Sbjct: 558 GE----------------LTATLANHKRGLWDVSFCQYDKLLATCSGDKTIKIWSLDTFS 601

Query: 561 FFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFL 620
              +L GH   V           +++S AD  IKIW    G+C K+L  H + I  +   
Sbjct: 602 VVRTLEGHTNAVQRCHFINKQTQLVSSGADGLIKIWDCSSGECVKTLDGHANRIWALTIQ 661

Query: 621 PESHNFFSSSKDGLVKYW 638
            +     S+  DG+ ++W
Sbjct: 662 RDGELIASADADGVFQFW 679

 Score = 68.9 bits (167), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 98/227 (43%), Gaps = 11/227 (4%)

Query: 65  LPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITV 124
           L  GS   + +   +++ L      ++ A    D T K+WDL +  +  T   HK  +  
Sbjct: 514 LIKGSEYTRRAHEKDINALSVSPNDSVFATASYDKTSKIWDLETGELTATLANHKRGLWD 573

Query: 125 MKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGEDWLVSTSKDGL 183
           + F      L + S D  I +W L +   +  L  H +A+    +   +  LVS+  DGL
Sbjct: 574 VSFCQYDKLLATCSGDKTIKIWSLDTFSVVRTLEGHTNAVQRCHFINKQTQLVSSGADGL 633

Query: 184 IKIWDLKVQQCIETHIAHTGECWAMGVHED--LLITSGADTQLKLWNLDFSKEAGSKLIE 241
           IKIWD    +C++T   H    WA+ +  D  L+ ++ AD   + W  D S++   + +E
Sbjct: 634 IKIWDCSSGECVKTLDGHANRIWALTIQRDGELIASADADGVFQFWT-DCSEQQREQDLE 692

Query: 242 KG---VYDKQSKQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRIRRE 285
           +    V  +QS Q  L    +      AF      D    +F + R+
Sbjct: 693 REKELVEQEQSLQNYL----ANEDWANAFLLAITLDHPMRLFNVLRQ 735

 Score = 62.4 bits (150), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 85/191 (44%), Gaps = 8/191 (4%)

Query: 321 IMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSNSIEYYSIPYEKRDPTSPAPTRLYT 380
           I  P   ++  + IK   +T  ++ K    ++ S N   + +  Y+K        T   T
Sbjct: 502 IPKPSDKMEGIHLIKGSEYTRRAHEKDINALSVSPNDSVFATASYDKTSKIWDLETGELT 561

Query: 381 IELPGHRTDIRSVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFD--CGYALTCKFLPG 437
             L  H+  +  V     DKLLAT S +  +K+W+L T + +R  +        C F+  
Sbjct: 562 ATLANHKRGLWDVSFCQYDKLLATCSGDKTIKIWSLDTFSVVRTLEGHTNAVQRCHFINK 621

Query: 438 GTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWN 497
            T ++    +G ++++D +S   ++   D H   IW+L I  DG  + +  AD   +FW 
Sbjct: 622 QTQLVSSGADGLIKIWDCSSGECVKTL-DGHANRIWALTIQRDGELIASADADGVFQFWT 680

Query: 498 ----FQVEEDL 504
                Q E+DL
Sbjct: 681 DCSEQQREQDL 691

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 71/147 (48%), Gaps = 14/147 (9%)

Query: 49  IWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLS 108
           IWD++TGEL + L++               +VS+  Y     LLA    D TIK+W L +
Sbjct: 552 IWDLETGELTATLAN---------HKRGLWDVSFCQY---DKLLATCSGDKTIKIWSLDT 599

Query: 109 KSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIW 168
            SV+ T  GH +A+    F    T+L+S   D  I +WD  S   +  L  H + I  + 
Sbjct: 600 FSVVRTLEGHTNAVQRCHFINKQTQLVSSGADGLIKIWDCSSGECVKTLDGHANRIWALT 659

Query: 169 CEGEDWLVSTS-KDGLIKIW-DLKVQQ 193
            + +  L++++  DG+ + W D   QQ
Sbjct: 660 IQRDGELIASADADGVFQFWTDCSEQQ 686

 Score = 40.4 bits (93), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 38/179 (21%), Positives = 76/179 (42%), Gaps = 12/179 (6%)

Query: 514 PVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVL 573
           P  + +   + E  +++ +++++ + K+L  +     +K+  + + K   S+     P  
Sbjct: 77  PTRQKLQTISNEDEQEITALKLTADGKYLCFTSQAQLLKIVEVATGKVMRSMKISS-PSY 135

Query: 574 SIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHN----FFSS 629
            +D    S L+     D +I +  ++ G    S   H  +I  +KF  E+++      S 
Sbjct: 136 IMDSEATSTLVAVGGTDGSIIVVDIENGYVTHSFKGHGGTISCLKFFGEANSNVWLLASG 195

Query: 630 SKDGLVKYWDGDKFECIQKLAAHQSEVWSIAI--TSDGT-----SVISASHDHSLRVWE 681
             +G++K W+    +C   +  H S V  I I   SD T      +IS   D  +  WE
Sbjct: 196 DTNGMIKVWNLVTRKCTHTVQEHTSAVRGIDIRSISDDTKSMQLQMISGGRDDVVNYWE 254

>Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score =  131 bits (330), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 162/653 (24%), Positives = 271/653 (41%), Gaps = 131/653 (20%)

Query: 65  LPAGSIDVKSSKPAEVSYLHYHDETN-LLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAIT 123
           L  G I V+S K +  SY+   D T+ LLA G  DG+I + D+ +  +  +  GH   I+
Sbjct: 90  LKTGRI-VRSLKISSPSYILDTDPTSTLLAVGGTDGSIVIVDIENGYITHSLKGHGGTIS 148

Query: 124 VMKF----DVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGEDW---- 174
            +KF    D     L SG  +  + VWDLV    L  L+ H  A+ G+   EGE      
Sbjct: 149 SLKFYGQLDSETWLLASGDTNGMVKVWDLVKRKCLLTLQEHSSAVRGLDIIEGESGDGSS 208

Query: 175 --LVSTSKDGLIKIWD------------LKVQQCIETHIAHTGECWAMGVHED--LLITS 218
             L+S  +D ++ +WD            L V Q +E+       C  +  H+   ++ T+
Sbjct: 209 LKLLSGGRDDIVNVWDFDMKKKCKLVKTLPVNQQVES-------CGFLKNHDGKRIIYTA 261

Query: 219 GADTQLKLWNLDFSKEAGSKLIEKGVYDKQSKQRGLDIKFSVAP--NGTAFFYIQNADKT 276
           G D   +L +L    E+G+      V  + +K         V P  N +  F +  +D+T
Sbjct: 262 GGDAIFQLIDL----ESGT------VLKRTNKPIEELFIIGVLPIMNDSEMFLVM-SDQT 310

Query: 277 TEVFRIRREEEISKAXXXXXXXXXXXGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKS 336
            ++  I                        EE+ +N  ++ ++       +  +   I  
Sbjct: 311 LQLINI------------------------EEVLENENDTINA----RSTIAGNNGIIAD 342

Query: 337 VSFTTVSNTKLEFVVTTSSNSIEYYSIP-YEKRDPTSPAPTRLYTIELPGHRTDIRSVDI 395
           + F      KL   + T+S S+    IP     D + P    +Y     GH   + S+D 
Sbjct: 343 MRFVGPELNKL--ALATNSPSLRIIPIPDLSGADASLPLDVEIY----EGHEDLLNSLDA 396

Query: 396 SDDDKLLATAS---NGLLKVWNLKTKACIRVFDCGYALTCKFLPGGTLVIVGTREGSLQL 452
           ++D   +ATAS     +L  +N +T      FD  YA   K++   + V           
Sbjct: 397 TEDGLWIATASKDNTAILWKYNERTSK----FDI-YA---KYIGHSSAV----------- 437

Query: 453 FDLASSTLLENKEDAHETAIWSLDITSDG--RRLVTGSADKTIKFWNFQVEEDLVP-GTA 509
                            TA+   ++   G    L+T S D TIK W        VP  T+
Sbjct: 438 -----------------TAVGLPNVMPKGYPEFLLTASNDLTIKKWK-------VPKPTS 473

Query: 510 DKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHK 569
              + ++K+   T     +D+ ++ +SP D   A +  D T K++ L++ +   +L  HK
Sbjct: 474 IMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWSLENGELEATLANHK 533

Query: 570 LPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSS 629
             +  +      KL+ TSS DK +KIW LD     K+L  H +++    F+ +     S 
Sbjct: 534 RGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHSNAVQRCSFINKQKQLVSC 593

Query: 630 SKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWEE 682
             DGL+K WD    EC+  L  H + +W++   +DG  ++SA  D   + W++
Sbjct: 594 GADGLIKIWDCSSGECLNTLDGHNNRLWALNTMNDGDMIVSADADGVFQFWKD 646

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 86/182 (47%), Gaps = 11/182 (6%)

Query: 510 DKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHK 569
           D  L   K++H  + E  +++ ++R++P+ ++LA       +K+F L + +   SL    
Sbjct: 44  DLTLGCRKILHKISNEDEQEITALRLTPDGQYLAYVSQAQLLKIFQLKTGRIVRSLKISS 103

Query: 570 LPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFL----PESHN 625
            P   +D    S L+     D +I I  ++ G    SL  H  +I ++KF      E+  
Sbjct: 104 -PSYILDTDPTSTLLAVGGTDGSIVIVDIENGYITHSLKGHGGTISSLKFYGQLDSETWL 162

Query: 626 FFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAI----TSDGTS--VISASHDHSLRV 679
             S   +G+VK WD  K +C+  L  H S V  + I    + DG+S  ++S   D  + V
Sbjct: 163 LASGDTNGMVKVWDLVKRKCLLTLQEHSSAVRGLDIIEGESGDGSSLKLLSGGRDDIVNV 222

Query: 680 WE 681
           W+
Sbjct: 223 WD 224

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 63/140 (45%), Gaps = 13/140 (9%)

Query: 49  IWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLS 108
           IW ++ GEL + L++               +VS+  Y     LLA    D T+K+W L +
Sbjct: 517 IWSLENGELEATLAN---------HKRGLWDVSFCQYD---KLLATSSGDKTVKIWSLDT 564

Query: 109 KSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIW 168
            SV+ T  GH +A+    F     +L+S   D  I +WD  S   L  L  H + +  + 
Sbjct: 565 FSVMKTLEGHSNAVQRCSFINKQKQLVSCGADGLIKIWDCSSGECLNTLDGHNNRLWALN 624

Query: 169 CEGE-DWLVSTSKDGLIKIW 187
              + D +VS   DG+ + W
Sbjct: 625 TMNDGDMIVSADADGVFQFW 644

>NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {ON}
           Anc_8.435
          Length = 857

 Score =  130 bits (328), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 153/656 (23%), Positives = 270/656 (41%), Gaps = 125/656 (19%)

Query: 72  VKSSKPAEVSYLHYHDETN-LLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKF--- 127
           +K+ K +  SY+   D T+ L+A G  DG+I V D+ +  +  +F GH   I+ +KF   
Sbjct: 112 IKTLKLSSPSYIMDCDSTSTLVAVGGTDGSIIVVDIENGFITHSFKGHGGTISSVKFYGN 171

Query: 128 -DVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGED--------WLVST 178
            D     L SG  +  + +WDLV    ++ L+ H  A+ G+               L+S 
Sbjct: 172 NDTNCWLLCSGDTNGMVKIWDLVKRSCIHTLQEHNSAVRGLDVRSVSKENDNVVLQLLSG 231

Query: 179 SKDGLIKIWD------------LKVQQCIETHIAHTGECWAMGVH----EDLLITSGADT 222
           S+D ++ +W+            L V Q +E+       C  +  H    +D++ T+G + 
Sbjct: 232 SRDNIVNLWEFNLRKLCKLLKTLPVNQQVES-------CGFIHDHDNELQDIIYTAGGEA 284

Query: 223 QLKLWNLDFSKEAGSKLIEKGVYDKQSKQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRI 282
             +L +L     +   +I++ V   +       + F+ A N     YI  +D+T ++  +
Sbjct: 285 IFQLISL-----SKGSVIKRTVKPTEELFIIGTLPFT-ATNNDLNSYIVMSDQTLQMINL 338

Query: 283 RREEEISKAXXXXXXXXXXXGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTV 342
            +                   ++  E+   I E  S I         +   I  + F   
Sbjct: 339 TK------------------ALSPTELSNPIIEIESCI-------AGNHGTIADMKFVGQ 373

Query: 343 SNTKLEFVVTTSSNSIEYYSIPYEKRDPTSP--------APTRLYTIELPGHRTDIRSVD 394
              KL   + T+S ++    +P   ++   P         P  + T E  GH   + S+ 
Sbjct: 374 DLNKL--ALATNSPTLRIIPVPSTMKEAADPNTQDNSADLPINMETYE--GHTDLLNSLA 429

Query: 395 ISDDDKLLATASNGLLKV-WNLKTKACIRVFDCGYALTCKFLPGGTLVIVGTREGSLQLF 453
            ++D + LATAS     + W   ++   R F   YA   KF+                  
Sbjct: 430 ATEDGQWLATASKDHTSILWKYSSETS-RFF--AYA---KFI------------------ 465

Query: 454 DLASSTLLENKEDAHETAIWSLDITSDGRR-----LVTGSADKTIKFWNFQV--EEDLVP 506
                         H +++ ++ + +   R     L+T S D TIK W      +E    
Sbjct: 466 -------------GHSSSVTAVGLPNVLLRGYPEFLITASNDLTIKKWKIPTPSKERSDD 512

Query: 507 GTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLY 566
            + DK   ++K+   T    ++D+ S+ ISP D  +A    D + K++ LDS +   +L 
Sbjct: 513 ESKDKT-HIIKVSEYTRHAHDKDINSISISPNDSLIATGSYDKSCKLWNLDSGELVATLN 571

Query: 567 GHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNF 626
            HK  +  +      KLI T S DK IK+W LD     K+   H +++    F+ +    
Sbjct: 572 NHKRGIWDVSFCQFDKLIATCSGDKTIKLWSLDTFAVLKTFAGHTNAVQRCTFINKQKQL 631

Query: 627 FSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWEE 682
            SS  DGL+K WD    +C++ L  H + +W++   +DG  ++SA  D  L+ W +
Sbjct: 632 VSSGADGLIKIWDCTTGDCLKTLDGHDNRIWALTTWNDGELIVSADADGVLQFWND 687

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 73/153 (47%), Gaps = 19/153 (12%)

Query: 49  IWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLS 108
           +W++ +GEL++ L++               +VS+  +     L+A    D TIK+W L +
Sbjct: 558 LWNLDSGELVATLNN---------HKRGIWDVSFCQFD---KLIATCSGDKTIKLWSLDT 605

Query: 109 KSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI- 167
            +VL TF GH +A+    F     +L+S   D  I +WD  +   L  L  H + I  + 
Sbjct: 606 FAVLKTFAGHTNAVQRCTFINKQKQLVSSGADGLIKIWDCTTGDCLKTLDGHDNRIWALT 665

Query: 168 -WCEGEDWLVSTSKDGLIKIWDLKVQQCIETHI 199
            W +GE  +VS   DG+++ W+     C E  I
Sbjct: 666 TWNDGE-LIVSADADGVLQFWN----DCTELEI 693

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 86/195 (44%), Gaps = 24/195 (12%)

Query: 511 KYLPVMKLIHDTTMEVNEDVLSVRISPEDKFL-AISLLDNTVKVFYLDSMKFFLSLYGHK 569
           K  P+ + +   T    +++  ++++P+ KFL +I+L    +K++ L +++   ++   +
Sbjct: 47  KLSPLQERLTTITNNDEQEITCLKLTPDGKFLISIALQSQALKIYNLTAIEGETTMNTKQ 106

Query: 570 L------------PVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNV 617
                        P   +D    S L+     D +I +  ++ G    S   H  +I +V
Sbjct: 107 QSLQPIKTLKLSSPSYIMDCDSTSTLVAVGGTDGSIIVVDIENGFITHSFKGHGGTISSV 166

Query: 618 KFLPESHN----FFSSSKDGLVKYWDGDKFECIQKLAAHQS-----EVWSIAITSDGT-- 666
           KF   +        S   +G+VK WD  K  CI  L  H S     +V S++  +D    
Sbjct: 167 KFYGNNDTNCWLLCSGDTNGMVKIWDLVKRSCIHTLQEHNSAVRGLDVRSVSKENDNVVL 226

Query: 667 SVISASHDHSLRVWE 681
            ++S S D+ + +WE
Sbjct: 227 QLLSGSRDNIVNLWE 241

>YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON}
           UTP13Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 817

 Score =  130 bits (326), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 137/589 (23%), Positives = 250/589 (42%), Gaps = 79/589 (13%)

Query: 124 VMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGE----DWLVSTS 179
           ++  D T T L  G  D +IIV D+ +    +  + H   IS +   G+     WL+++ 
Sbjct: 107 ILDADSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLNSKIWLLASG 166

Query: 180 -KDGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDL--------LITSGADTQLKLWNLD 230
             +G++K+WDL  ++C+ T   HT     + + E          L++ G D  + LW  D
Sbjct: 167 DTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDIIEVPDNDEPSLNLLSGGRDDIINLW--D 224

Query: 231 FSKEAGSKLIEKGVYDKQSKQRGL-----DIKFSVAPNGTAFFYIQNADKTTEVFRIRRE 285
           F+ +   KL++    ++Q +  G        +      G A F + +++  + + R  + 
Sbjct: 225 FNMKKKCKLLKTLPVNQQVESCGFLKDGDGKRIIYTAGGDAIFQLIDSESGSVLKRTNKP 284

Query: 286 EE---ISKAXXXXXXXXXXXGMTDEEIQQ-NIKESYSS---IIMHPFQVIKSQYKIKSVS 338
            E   I               ++D+ +Q  N++E   +    I     +  +   I  + 
Sbjct: 285 IEELFIIGVLPILSNSQMFLVLSDQTLQLINVEEDLKNDEDTIQVTSSIAGNHGIIADMR 344

Query: 339 FTTVSNTKLEFVVTTSSNSIEYYSIPYEKRDPTSPAPTRLYTIEL-PGHRTDIRSVDISD 397
           +      KL   + T+S S+    +P    D + P  +    +E+  GH   + S+D ++
Sbjct: 345 YVGPELNKL--ALATNSPSLRIIPVP----DLSGPEASLPLDVEIYEGHEDLLNSLDATE 398

Query: 398 DDKLLATAS-NGLLKVWNLKTKACIRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLA 456
           D   +ATAS +    VW     +C                                FD+ 
Sbjct: 399 DGLWIATASKDNTAIVWRYNENSC-------------------------------KFDIY 427

Query: 457 SSTLLENKEDAHETAIWSLDITSDG--RRLVTGSADKTIKFWNFQVEEDLVP-GTADKYL 513
           +  +      A  TA+   +I S G    L+T S D TIK W       ++P  TA   +
Sbjct: 428 AKYI---GHSAAVTAVGLPNIVSKGYPEFLLTASNDLTIKKW-------IIPKPTASMDV 477

Query: 514 PVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVL 573
            ++K+   T     +D+ ++ +SP D   A +  D T K++ L++ +   +L  HK  + 
Sbjct: 478 QIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLANHKRGLW 537

Query: 574 SIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDG 633
            +      KL+ TSS DK +KIW LD     K+L  H +++    F+ +     S   DG
Sbjct: 538 DVSFCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADG 597

Query: 634 LVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWEE 682
           L+K WD    EC++ L  H + +W+++  +DG  ++SA  D   + W++
Sbjct: 598 LIKIWDCSSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFWKD 646

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 77/174 (44%), Gaps = 12/174 (6%)

Query: 66  PAGSIDVKSSKPAEVSYLHYHDETNLL---------AAGYMDGTIKVWDLLSKSVLLTFN 116
           P  S+DV+  K +E +   +  + N L         A    D T K+W+L +  +  T  
Sbjct: 471 PTASMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLA 530

Query: 117 GHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGEDWL 175
            HK  +  + F      L + S D  + +W L +   +  L  H +A+    +   +  L
Sbjct: 531 NHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQL 590

Query: 176 VSTSKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHE--DLLITSGADTQLKLW 227
           +S   DGLIKIWD    +C++T   H    WA+      D+++++ AD   + W
Sbjct: 591 ISCGADGLIKIWDCSSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFW 644

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 64/140 (45%), Gaps = 13/140 (9%)

Query: 49  IWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLS 108
           IW+++ GEL + L++               +VS+  Y     LLA    D T+K+W L +
Sbjct: 517 IWNLENGELEATLAN---------HKRGLWDVSFCQYD---KLLATSSGDKTVKIWSLDT 564

Query: 109 KSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIW 168
            SV+ T  GH +A+    F     +LIS   D  I +WD  S   L  L  H + +  + 
Sbjct: 565 FSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWDCSSGECLKTLDGHNNRLWALS 624

Query: 169 CEGE-DWLVSTSKDGLIKIW 187
              + D +VS   DG+ + W
Sbjct: 625 TMNDGDMIVSADADGVFQFW 644

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/189 (22%), Positives = 85/189 (44%), Gaps = 18/189 (9%)

Query: 503 DLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFF 562
           DL PG+        K++H  + E  +++ +++++P+ ++L        +K+F+L + K  
Sbjct: 44  DLTPGSR-------KILHKISNEDEQEITALKLTPDGQYLTYVSQAQLLKIFHLKTGKVV 96

Query: 563 LSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE 622
            S+     P   +D    S L+     D +I +  ++ G    S   H  +I ++KF  +
Sbjct: 97  RSMKISS-PSYILDADSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQ 155

Query: 623 SHN----FFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAIT------SDGTSVISAS 672
            ++      S   +G+VK WD  K +C+  L  H S V  + I           +++S  
Sbjct: 156 LNSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDIIEVPDNDEPSLNLLSGG 215

Query: 673 HDHSLRVWE 681
            D  + +W+
Sbjct: 216 RDDIINLWD 224

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 40/79 (50%), Gaps = 10/79 (12%)

Query: 80  VSYLHYHDETN----LLAAGYMDGTIKVWDLLSKSVLLTFNGHKSA------ITVMKFDV 129
           +S L ++ + N    LLA+G  +G +KVWDL+ +  L T   H SA      I V   D 
Sbjct: 147 ISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDIIEVPDNDE 206

Query: 130 TGTRLISGSRDSNIIVWDL 148
               L+SG RD  I +WD 
Sbjct: 207 PSLNLLSGGRDDIINLWDF 225

>CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON}
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222c
          Length = 816

 Score =  130 bits (326), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 158/636 (24%), Positives = 264/636 (41%), Gaps = 109/636 (17%)

Query: 73  KSSKPAEVSYLHYHDETN-LLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKF-DVT 130
           +S K +  SY+   D T+ L+A G  DG+I V D+ +  +  +F GH   I+ +KF    
Sbjct: 98  RSLKVSSPSYVMTCDPTSTLVAIGGTDGSITVIDIENGYIAHSFKGHGGTISSLKFYGEL 157

Query: 131 GTRL-ISGSRDSNII--VWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVSTSKDGLIKIW 187
           GT + + GS D+N +  VWDLV+    + ++ H  AI GI     D+  +  KD L    
Sbjct: 158 GTNIWLLGSGDTNGMAKVWDLVTRKCKFTVQEHSSAIRGI-----DFTKNDDKDVLN--- 209

Query: 188 DLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKEAGSKLIEKGVYDK 247
                                      LIT G D  L LW  +  K   SKL++      
Sbjct: 210 ---------------------------LITGGRDNVLNLWRFNI-KGKSSKLVKTIPAHL 241

Query: 248 QSKQRGL----DIKFSVAPNGTAFFYIQNADKTTEVFRIRREEE---ISKAXXXXXXXXX 300
           Q +  G     D  F+    G A F I + ++++ V   ++  E   I+           
Sbjct: 242 QIEACGFITHNDETFAYTAGGDAVFQIIDLNESSVVKCTKKPIEELFITGVIPINQGNQF 301

Query: 301 XXGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSN----TKLEFVVTTSSN 356
              ++D+ IQ  + +  S I     + I+ Q  I   +  TV++    TK +  +  ++N
Sbjct: 302 YAVLSDQTIQ--LLQPNSEIFSSKSEFIQIQEYIAG-NHGTVADLCLVTKNKDCIALATN 358

Query: 357 SIEYYSIPYEKRDPTS-----PAPTRLYTIELPGHRTDIRSVDISDDDKLLATAS---NG 408
           S     IP  K D  +     P    LY     GH   + S+  ++D + LATAS     
Sbjct: 359 SPSLRIIPLPKIDADTQDTDLPIEVNLY----EGHSDLLNSLACTEDGQWLATASKDKTA 414

Query: 409 LLKVWNLKTKACIRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAH 468
           +L  WN  +K              +F    T V               S+  L N  + +
Sbjct: 415 ILWHWNNTSK--------------RFYIYATFVGHAAS---------VSAVCLPNVMEKN 451

Query: 469 ETAIWSLDITSDGRRLVTGSADKTIKFWNF-QVEEDLVPGTADKYLPVMKLIHDTTMEVN 527
                        + ++T S D T+K W    ++ DL        +P +      T   +
Sbjct: 452 YP-----------KYIITASNDLTVKKWEIPPMKNDL------NEVPFIVKSSIYTRHAH 494

Query: 528 E-DVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIIT 586
           E D+ ++ ++P D   A +  D T K++ +D+ +   +L  HK  +  +      K I T
Sbjct: 495 EKDINAISMAPNDSIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFCESEKWIAT 554

Query: 587 SSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECI 646
            S DK +KIW L+     K+L  H +++    F+ +     S+  DGL+K WD    +CI
Sbjct: 555 CSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDIASGDCI 614

Query: 647 QKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWEE 682
           + L  H + +W++++  DG  +ISA  D   + W++
Sbjct: 615 KNLDGHSNRIWALSVLEDGDLIISADADSVFQFWKD 650

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 66/275 (24%), Positives = 117/275 (42%), Gaps = 17/275 (6%)

Query: 18  STNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISVLSD-----GLPAGSIDV 72
           S +A C+   P   + N P  +IT++    N   +K  E+  + +D      +   SI  
Sbjct: 438 SVSAVCL---PNVMEKNYPKYIITAS----NDLTVKKWEIPPMKNDLNEVPFIVKSSIYT 490

Query: 73  KSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGT 132
           + +   +++ +      ++ A    D T K+W++ +   + T   HK  +  + F  +  
Sbjct: 491 RHAHEKDINAISMAPNDSIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFCESEK 550

Query: 133 RLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGEDWLVSTSKDGLIKIWDLKV 191
            + + S D  + +W L S   L  L  H +A+    +   +  LVS   DGLIK+WD+  
Sbjct: 551 WIATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDIAS 610

Query: 192 QQCIETHIAHTGECWAMGVHE--DLLITSGADTQLKLWNLDFSKEAGSKLIEKGVYDKQS 249
             CI+    H+   WA+ V E  DL+I++ AD+  + W      E    L E  V  +Q 
Sbjct: 611 GDCIKNLDGHSNRIWALSVLEDGDLIISADADSVFQFWKDCTEAEIQGALEENKVRVEQ- 669

Query: 250 KQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRIRR 284
            ++ L    +      AF      D    +F + R
Sbjct: 670 -EQSLTNYMNNGEWSNAFLLALQLDHPMRLFNVLR 703

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/176 (21%), Positives = 81/176 (46%), Gaps = 4/176 (2%)

Query: 332 YKIKSVSFTTVSNTKLEFVVTTSSNSIEYYSIPYEKRDPTSPAPTRLYTIELPGHRTDIR 391
           + +KS  +T  ++ K    ++ + N   + +  Y+K        T      L  H+  + 
Sbjct: 482 FIVKSSIYTRHAHEKDINAISMAPNDSIFATASYDKTCKLWNVDTGEPVATLANHKRGLW 541

Query: 392 SVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFD--CGYALTCKFLPGGTLVIVGTREG 448
            V   + +K +AT S +  +K+W+L++   ++  +        C F+     ++    +G
Sbjct: 542 DVSFCESEKWIATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADG 601

Query: 449 SLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDL 504
            ++++D+AS   ++N  D H   IW+L +  DG  +++  AD   +FW    E ++
Sbjct: 602 LIKVWDIASGDCIKNL-DGHSNRIWALSVLEDGDLIISADADSVFQFWKDCTEAEI 656

 Score = 40.4 bits (93), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 39/179 (21%), Positives = 74/179 (41%), Gaps = 9/179 (5%)

Query: 511 KYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKL 570
           + +P  KL+H       +++  + ++P+ K+L        VK+  +++     SL     
Sbjct: 46  QLIPNRKLLHSIDNADEQEITGISLTPDGKYLIYVSQSQLVKIVNVETGVITRSLKVSS- 104

Query: 571 PVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE-SHNFF-- 627
           P   +     S L+     D +I +  ++ G    S   H  +I ++KF  E   N +  
Sbjct: 105 PSYVMTCDPTSTLVAIGGTDGSITVIDIENGYIAHSFKGHGGTISSLKFYGELGTNIWLL 164

Query: 628 -SSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAIT----SDGTSVISASHDHSLRVWE 681
            S   +G+ K WD    +C   +  H S +  I  T     D  ++I+   D+ L +W 
Sbjct: 165 GSGDTNGMAKVWDLVTRKCKFTVQEHSSAIRGIDFTKNDDKDVLNLITGGRDNVLNLWR 223

 Score = 32.3 bits (72), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 46/98 (46%), Gaps = 17/98 (17%)

Query: 373 PAPTRLYTIELPGHRTDIRSVDISDDDK------------LLATASNGLLKVWNLKTKAC 420
           P    +  I+L  +R  + S+D +D+ +            L+  + + L+K+ N++T   
Sbjct: 37  PVLDEINIIQLIPNRKLLHSIDNADEQEITGISLTPDGKYLIYVSQSQLVKIVNVETGVI 96

Query: 421 IR---VFDCGYALTCKFLPGGTLVIVGTREGSLQLFDL 455
            R   V    Y +TC   P  TLV +G  +GS+ + D+
Sbjct: 97  TRSLKVSSPSYVMTCD--PTSTLVAIGGTDGSITVIDI 132

>Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {ON}
           YLR222C (REAL)
          Length = 818

 Score =  129 bits (325), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 140/590 (23%), Positives = 249/590 (42%), Gaps = 80/590 (13%)

Query: 124 VMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGE----DWLVSTS 179
           ++  D T T L  G  D +IIV D+ +    + L+ H   IS +   G+     WL+++ 
Sbjct: 107 ILDTDSTSTLLAVGGTDGSIIVVDIENGYITHSLKGHGGTISSLKFYGQLDSKVWLLASG 166

Query: 180 -KDGLIKIWDLKVQQCIETHIAHTGECWAMGVHED---------LLITSGADTQLKLWNL 229
             +G++K+WDL  ++C+ T   HT     + + E           LI+ G D  +  W+ 
Sbjct: 167 DTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDITEVENNDGPSHLKLISGGRDDIVNFWDF 226

Query: 230 DFSKEAGSKLIEKGVYDKQSKQRGL----DIKFSV-APNGTAFFYIQNADKTTEVFRIRR 284
           D  K+   KLI+    ++Q +  G     D K  +    G A F + + +  + + R  +
Sbjct: 227 DMKKKC--KLIKTLPVNQQVESCGFLNTRDGKHIIYTAGGDAIFQLIDLESGSMLKRTNK 284

Query: 285 EEE---ISKAXXXXXXXXXXXGMTDEEIQQ-NIKESYSS---IIMHPFQVIKSQYKIKSV 337
             E   I               M+D+ +Q  NI+E+  S   II     +  +   I  +
Sbjct: 285 PIEELYIIGVLPIMSDSKMFLVMSDQTLQLINIEEALESKEEIIQAESSIAGNHGIIADM 344

Query: 338 SFTTVSNTKLEFVVTTSSNSIEYYSIPYEKRDPTSPAPTRLYTIEL-PGHRTDIRSVDIS 396
            F      KL   + T+S ++    IP    D TS   +    +E+  GH   + S+D +
Sbjct: 345 RFVGPELNKL--ALATNSPALRIIPIP----DLTSTESSLPLDVEIYEGHEDLLNSLDAT 398

Query: 397 DDDKLLATAS-NGLLKVWNLKTKACIRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDL 455
           +D   +ATAS +    VW              + +  K++   + V              
Sbjct: 399 EDGLWIATASKDNSAIVWKYNNDTS------KFDIYAKYIGHSSAV-------------- 438

Query: 456 ASSTLLENKEDAHETAIWSLDITSDG--RRLVTGSADKTIKFWNFQVEEDLVP-GTADKY 512
                         TA+   ++   G    L+T S D TIK W        +P  T+   
Sbjct: 439 --------------TAVGLPNVMPKGYPEFLLTASNDLTIKKWK-------IPKPTSTND 477

Query: 513 LPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPV 572
           + ++K+   T     +D+ ++ +SP D   A +  D T K++ L++ +   +L  HK  +
Sbjct: 478 VQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLANHKRGL 537

Query: 573 LSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKD 632
             +      KL+ T S DK +KIW L+     K+L  H +++    F+ +     S   D
Sbjct: 538 WDVSFCQYDKLLATCSGDKTVKIWSLETFSVMKTLEGHTNAVQRCSFINKQKQLVSCGAD 597

Query: 633 GLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWEE 682
           GL+K WD    EC++ L  H + +W++   +DG +++SA  D   + W++
Sbjct: 598 GLIKIWDCYSGECLKTLDGHNNRLWALNTMNDGDTIVSADADGIFQFWKD 647

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 75/174 (43%), Gaps = 12/174 (6%)

Query: 66  PAGSIDVKSSKPAEVSYLHYHDETNLL---------AAGYMDGTIKVWDLLSKSVLLTFN 116
           P  + DV+  K +E +   +  + N L         A    D T K+W+L +  +  T  
Sbjct: 472 PTSTNDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLA 531

Query: 117 GHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGEDWL 175
            HK  +  + F      L + S D  + +W L +   +  L  H +A+    +   +  L
Sbjct: 532 NHKRGLWDVSFCQYDKLLATCSGDKTVKIWSLETFSVMKTLEGHTNAVQRCSFINKQKQL 591

Query: 176 VSTSKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHE--DLLITSGADTQLKLW 227
           VS   DGLIKIWD    +C++T   H    WA+      D ++++ AD   + W
Sbjct: 592 VSCGADGLIKIWDCYSGECLKTLDGHNNRLWALNTMNDGDTIVSADADGIFQFW 645

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 105/496 (21%), Positives = 197/496 (39%), Gaps = 102/496 (20%)

Query: 91  LLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGT---------RLISGSRDS 141
           LLA+G  +G +KVWDL+ +  L T   H SA  V   D+T           +LISG RD 
Sbjct: 162 LLASGDTNGMVKVWDLVKRKCLHTLQEHTSA--VRGLDITEVENNDGPSHLKLISGGRDD 219

Query: 142 NIIVW--DLVSEVGLYKLRSHKDAISGIWC------EGEDWLVSTSKDGLIKIWDLKVQQ 193
            +  W  D+  +  L K       +    C      +G+  + +   D + ++ DL+   
Sbjct: 220 IVNFWDFDMKKKCKLIKTLPVNQQVES--CGFLNTRDGKHIIYTAGGDAIFQLIDLESGS 277

Query: 194 CIETHIAHTGECWAMGV----HEDLLITSGADTQLKLWNLDFSKEAGSKLIE-----KGV 244
            ++       E + +GV     +  +    +D  L+L N++ + E+  ++I+      G 
Sbjct: 278 MLKRTNKPIEELYIIGVLPIMSDSKMFLVMSDQTLQLINIEEALESKEEIIQAESSIAGN 337

Query: 245 YDKQSKQR--GLDI-KFSVAPNGTAFFYIQNADKTTEVFRIRREEEISKAXXXXXXXXXX 301
           +   +  R  G ++ K ++A N  A   I   D T+    +  + EI +           
Sbjct: 338 HGIIADMRFVGPELNKLALATNSPALRIIPIPDLTSTESSLPLDVEIYEGHEDLLNSLDA 397

Query: 302 XGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKI------KSVSFTTVSNTKL------EF 349
              T++ +        +S I+  +    S++ I       S + T V    +      EF
Sbjct: 398 ---TEDGLWIATASKDNSAIVWKYNNDTSKFDIYAKYIGHSSAVTAVGLPNVMPKGYPEF 454

Query: 350 VVTTSSN-SIEYYSIPYEKRDPTSPAPTRLYTIE---LPGHRTDIRSVDISDDDKLLATA 405
           ++T S++ +I+ + IP     PTS    ++  +       H  DI ++ +S +D + ATA
Sbjct: 455 LLTASNDLTIKKWKIP----KPTSTNDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATA 510

Query: 406 S-----------NGLL--------------------------------KVWNLKTKACIR 422
           S           NG L                                K+W+L+T + ++
Sbjct: 511 SYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKLLATCSGDKTVKIWSLETFSVMK 570

Query: 423 VFD--CGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSD 480
             +        C F+     ++    +G ++++D  S   L+   D H   +W+L+  +D
Sbjct: 571 TLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCYSGECLKTL-DGHNNRLWALNTMND 629

Query: 481 GRRLVTGSADKTIKFW 496
           G  +V+  AD   +FW
Sbjct: 630 GDTIVSADADGIFQFW 645

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 97/216 (44%), Gaps = 26/216 (12%)

Query: 477 ITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRIS 536
           ++ DG+ L T   D          E +++  TAD      K++H  + E  +++ +++++
Sbjct: 25  VSEDGKILATPILD----------EINIIDLTADS----RKILHKISNEDEQEITALQLT 70

Query: 537 PEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW 596
           P+ ++L        +K+F L + K   S+     P   +D    S L+     D +I + 
Sbjct: 71  PDGQYLTYVSQAQLLKIFQLKTGKVVRSMKISS-PSYILDTDSTSTLLAVGGTDGSIIVV 129

Query: 597 GLDFGDCHKSLFAHQDSIMNVKFLPESHN----FFSSSKDGLVKYWDGDKFECIQKLAAH 652
            ++ G    SL  H  +I ++KF  +  +      S   +G+VK WD  K +C+  L  H
Sbjct: 130 DIENGYITHSLKGHGGTISSLKFYGQLDSKVWLLASGDTNGMVKVWDLVKRKCLHTLQEH 189

Query: 653 QSEVWSIAIT----SDGTS---VISASHDHSLRVWE 681
            S V  + IT    +DG S   +IS   D  +  W+
Sbjct: 190 TSAVRGLDITEVENNDGPSHLKLISGGRDDIVNFWD 225

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 64/140 (45%), Gaps = 13/140 (9%)

Query: 49  IWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLS 108
           IW+++ GEL + L++               +VS+  Y     LLA    D T+K+W L +
Sbjct: 518 IWNLENGELEATLAN---------HKRGLWDVSFCQYD---KLLATCSGDKTVKIWSLET 565

Query: 109 KSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIW 168
            SV+ T  GH +A+    F     +L+S   D  I +WD  S   L  L  H + +  + 
Sbjct: 566 FSVMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCYSGECLKTLDGHNNRLWALN 625

Query: 169 CEGE-DWLVSTSKDGLIKIW 187
              + D +VS   DG+ + W
Sbjct: 626 TMNDGDTIVSADADGIFQFW 645

>Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score =  126 bits (316), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 141/596 (23%), Positives = 247/596 (41%), Gaps = 93/596 (15%)

Query: 124 VMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGE----DWLVSTS 179
           ++  D T T L  G  D +IIV D+ +    +  + H   IS +   G+     WL+++ 
Sbjct: 107 ILDADSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLDSKIWLLASG 166

Query: 180 -KDGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDL--------LITSGADTQLKLWNLD 230
             +G++K+WDL  ++C+ T   H+     + + E          L++ G D  + +W  D
Sbjct: 167 DTNGMVKVWDLVKRKCLHTLQEHSSAVRGLDIVEVQNSDEPFLKLLSGGRDDIINIW--D 224

Query: 231 FSKEAGSKLIEKGVYDKQSKQRGL-----DIKFSVAPNGTAFFYIQNADKTTEVFRIRRE 285
           F+ +   KLI+    ++Q +  G      D        G A F + + +    + +  + 
Sbjct: 225 FNMKKTCKLIKTLPVNQQVESCGFLRYHDDKHLIYTAGGDAIFQLIDLESGIMIKKTNKP 284

Query: 286 EE---ISKAXXXXXXXXXXXGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTV 342
            E   I               M+D+ +Q          +++  +VIKS+ +I  VS T  
Sbjct: 285 IEELFIIGVLPIVSSSKMFLVMSDQTLQ----------LINVEEVIKSENEIIEVSSTIA 334

Query: 343 SN----TKLEFV--------VTTSSNSIEYYSIPYEKRDPTSPAPTRLYTIELPGHRTDI 390
            N      + FV        + T+S S+    IP +    T+  P  +   E  GH   +
Sbjct: 335 GNHGIIADMRFVGPELNKLALATNSPSLRIIPIP-DLAGTTASLPLDVEIYE--GHEDLL 391

Query: 391 RSVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFDCGYALTCKFLPGGTLVIVGTREGS 449
            S+D ++D   +ATAS +    VW  K     R F+    +  K++   + V        
Sbjct: 392 NSLDATEDGLWIATASKDNSAIVW--KYNENTRKFE----VYSKYIGHSSAV-------- 437

Query: 450 LQLFDLASSTLLENKEDAHETAIWSLDITSDG--RRLVTGSADKTIKFWNFQVEEDLVPG 507
                               TA+    I   G    L+T S D TIK W        +P 
Sbjct: 438 --------------------TAVGLPKIMPKGYPEFLLTASNDLTIKKWK-------IPK 470

Query: 508 TADKY-LPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLY 566
               + +  +K+   T     +D+ ++ ISP D   A +  D T K++ L++ +   +L 
Sbjct: 471 PTFPFDVQTIKVSEYTRHAHEKDINALSISPNDSIFATASYDKTCKIWNLENGELEATLS 530

Query: 567 GHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNF 626
            HK  +  +      KL+ T S DK +KIW LD     K+L  H +++    F+ +    
Sbjct: 531 NHKRGLWDVTFCQYDKLLATCSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQL 590

Query: 627 FSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWEE 682
            S   DGL+K WD    EC++ L  H + +W++   +DG  ++SA  D   + W++
Sbjct: 591 VSCGADGLIKIWDCSSGECLKTLDGHNNRLWALNTMNDGDIIVSADADGVFQFWKD 646

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 140/581 (24%), Positives = 226/581 (38%), Gaps = 131/581 (22%)

Query: 91  LLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAIT------VMKFDVTGTRLISGSRDSNII 144
           LLA+G  +G +KVWDL+ +  L T   H SA+       V   D    +L+SG RD  I 
Sbjct: 162 LLASGDTNGMVKVWDLVKRKCLHTLQEHSSAVRGLDIVEVQNSDEPFLKLLSGGRDDIIN 221

Query: 145 VWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVSTSKDGLIKIWDLKVQQCIETHIAHTGE 204
           +WD       + ++          C+            LIK   L V Q +E+       
Sbjct: 222 IWD-------FNMKKT--------CK------------LIKT--LPVNQQVES------- 245

Query: 205 CWAMGVHED--LLITSGADTQLKLWNLDFSKEAGSKLIEKGVYDKQSKQ--RGLDIKFSV 260
           C  +  H+D  L+ T+G D   +L +L           E G+  K++ +    L I   +
Sbjct: 246 CGFLRYHDDKHLIYTAGGDAIFQLIDL-----------ESGIMIKKTNKPIEELFIIGVL 294

Query: 261 APNGTAFFYIQNADKTTEVFRIRREEEISKAXXXXXXXXXXXGMTDEEIQQNIKESYSSI 320
               ++  ++  +D+T ++  +   EE+ K+                  +  I E  S+I
Sbjct: 295 PIVSSSKMFLVMSDQTLQLINV---EEVIKS------------------ENEIIEVSSTI 333

Query: 321 IMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSNSIEYYSIPYEKRDPTSPAPTRLYT 380
                    +   I  + F      KL   + T+S S+    IP +    T+  P  +  
Sbjct: 334 -------AGNHGIIADMRFVGPELNKL--ALATNSPSLRIIPIP-DLAGTTASLPLDVEI 383

Query: 381 IELPGHRTDIRSVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFDC-----GY--ALTC 432
            E  GH   + S+D ++D   +ATAS +    VW  K     R F+      G+  A+T 
Sbjct: 384 YE--GHEDLLNSLDATEDGLWIATASKDNSAIVW--KYNENTRKFEVYSKYIGHSSAVTA 439

Query: 433 ----KFLPGGTLVIVGTREGSLQL-----------FDLASSTLLENKEDAHETAIWSLDI 477
               K +P G    + T    L +           FD+ +  + E    AHE  I +L I
Sbjct: 440 VGLPKIMPKGYPEFLLTASNDLTIKKWKIPKPTFPFDVQTIKVSEYTRHAHEKDINALSI 499

Query: 478 TSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISP 537
           + +     T S DKT K WN +  E                +  T       +  V    
Sbjct: 500 SPNDSIFATASYDKTCKIWNLENGE----------------LEATLSNHKRGLWDVTFCQ 543

Query: 538 EDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWG 597
            DK LA    D TVK++ LD+     +L GH   V         K +++  AD  IKIW 
Sbjct: 544 YDKLLATCSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWD 603

Query: 598 LDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYW 638
              G+C K+L  H + +  +  + +     S+  DG+ ++W
Sbjct: 604 CSSGECLKTLDGHNNRLWALNTMNDGDIIVSADADGVFQFW 644

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 77/174 (44%), Gaps = 12/174 (6%)

Query: 66  PAGSIDVKSSKPAEVSYLHYHDETNLL---------AAGYMDGTIKVWDLLSKSVLLTFN 116
           P    DV++ K +E +   +  + N L         A    D T K+W+L +  +  T +
Sbjct: 471 PTFPFDVQTIKVSEYTRHAHEKDINALSISPNDSIFATASYDKTCKIWNLENGELEATLS 530

Query: 117 GHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGEDWL 175
            HK  +  + F      L + S D  + +W L +   +  L  H +A+    +   +  L
Sbjct: 531 NHKRGLWDVTFCQYDKLLATCSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQL 590

Query: 176 VSTSKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHE--DLLITSGADTQLKLW 227
           VS   DGLIKIWD    +C++T   H    WA+      D+++++ AD   + W
Sbjct: 591 VSCGADGLIKIWDCSSGECLKTLDGHNNRLWALNTMNDGDIIVSADADGVFQFW 644

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 84/189 (44%), Gaps = 18/189 (9%)

Query: 503 DLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFF 562
           DL PG+ +       +IH  + E  +++ +++++P+ ++L        +K+F+L + K  
Sbjct: 44  DLTPGSRN-------IIHRISNEDEQEITALKLTPDGQYLTYVSQAQLLKIFHLKTGKVV 96

Query: 563 LSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE 622
            S+     P   +D    S L+     D +I +  ++ G    S   H  +I ++KF  +
Sbjct: 97  RSMKISS-PSYILDADSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQ 155

Query: 623 SHN----FFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTS------VISAS 672
             +      S   +G+VK WD  K +C+  L  H S V  + I     S      ++S  
Sbjct: 156 LDSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHSSAVRGLDIVEVQNSDEPFLKLLSGG 215

Query: 673 HDHSLRVWE 681
            D  + +W+
Sbjct: 216 RDDIINIWD 224

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 64/140 (45%), Gaps = 13/140 (9%)

Query: 49  IWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLS 108
           IW+++ GEL + LS+               +V++  Y     LLA    D T+K+W L +
Sbjct: 517 IWNLENGELEATLSN---------HKRGLWDVTFCQYD---KLLATCSGDKTVKIWSLDT 564

Query: 109 KSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIW 168
            SV+ T  GH +A+    F     +L+S   D  I +WD  S   L  L  H + +  + 
Sbjct: 565 FSVMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCSSGECLKTLDGHNNRLWALN 624

Query: 169 CEGE-DWLVSTSKDGLIKIW 187
              + D +VS   DG+ + W
Sbjct: 625 TMNDGDIIVSADADGVFQFW 644

>Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222C
           (UTP13) - Protein required for cell viability [contig
           27] FULL
          Length = 823

 Score =  123 bits (308), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 147/630 (23%), Positives = 258/630 (40%), Gaps = 94/630 (14%)

Query: 101 IKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSH 160
           ++++ L SK ++ +     S + VM  D + T +  G  D ++ V D+ +    +  + H
Sbjct: 84  LRIYKLSSKKIIRSMKV-SSPVYVMDCDSSSTLVALGGTDGSVTVVDIENGYVTHSFKGH 142

Query: 161 KDAISGIWCEGED----W-LVSTSKDGLIKIWDLKVQQCIETHIAHTGECWAM------- 208
              IS +   GE     W L S    G++K+WDL  + CI T   H      +       
Sbjct: 143 GATISSVKFHGEQSGSIWRLASGDTSGMVKVWDLVRRNCIHTIQEHAAAVRGLDFRLSPA 202

Query: 209 --GVHEDLLITSGADTQLKLWNLDFSKEAGSKLIEKGVYDKQSKQRGL-----DIKFSVA 261
             GV E  L+T G D  + L+ L+ +K+  +KL+      +Q +  G      D      
Sbjct: 203 DDGVLE--LLTGGRDDIVNLFQLNSTKK--AKLMRTIPVHQQIEACGFIRDSPDGSLFYT 258

Query: 262 PNGTAFFYIQNADKTTEVFRIRREEE---ISKAXXXXXXXXXXXGMTDEEI-QQNIKESY 317
             G A F I +    +   R ++  E   I               ++D+ +   N+  S 
Sbjct: 259 AGGDAVFQILSFTSASVAKRTKKPIEELFIIGVLPIMQGSKVYLVLSDQTLFLVNLSASL 318

Query: 318 SS-----IIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSNSIEYYSIPYEKRD--- 369
           S      +I H  ++  +   +  + F      KL   + T+S ++   + P  K +   
Sbjct: 319 SKDGDEIVIEH--KIAGNHGTVADMRFVGKELDKL--ALATNSPALRVITAPVTKHNAAE 374

Query: 370 ----PTS--------PAPTRLYTIELPGHRTDIRSVDISDDDKLLATAS-NGLLKVWNLK 416
               PTS        P    LY     GH   + S+D S++ + LAT S +  + +W L 
Sbjct: 375 KEDEPTSKVDIQNCLPLEVELY----EGHTDLLNSLDSSENGEWLATCSKDHTVILWKLN 430

Query: 417 TKACIRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLD 476
                       A + KF P            ++ L ++  +T  E              
Sbjct: 431 ------------ADSEKFKPYARFTGHAGPVTAVGLPNVMRNTWPE-------------- 464

Query: 477 ITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRIS 536
                  ++T S D TIK W+        P + D  +  +K+   T     +D+ ++ IS
Sbjct: 465 ------FIITASNDLTIKKWSVPK-----PTSNDVDMHNIKVSDYTRRAHEKDINALSIS 513

Query: 537 PEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW 596
           P D   A +  D T K++ +DS +   +L  HK  +  +      KL+ T S DK IK+W
Sbjct: 514 PNDSVFATASYDKTCKIWNVDSGELEGTLANHKRGLWDVTFCQYDKLLATCSGDKTIKVW 573

Query: 597 GLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEV 656
            L+     K+L  H +++    F+  +    S+  DGL+K WD    ECI+ L AH + +
Sbjct: 574 SLESMSVVKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKVWDLSTGECIRTLDAHSNRI 633

Query: 657 WSIAITSDGTSVISASHDHSLRVWEETDDQ 686
           W++++ SDG   ++A  D   + W++  ++
Sbjct: 634 WALSVLSDGKEFVTADADGVFQFWKDCSEE 663

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 147/627 (23%), Positives = 254/627 (40%), Gaps = 124/627 (19%)

Query: 72  VKSSKPAEVSYLHYHDETN-LLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKF--D 128
           ++S K +   Y+   D ++ L+A G  DG++ V D+ +  V  +F GH + I+ +KF  +
Sbjct: 95  IRSMKVSSPVYVMDCDSSSTLVALGGTDGSVTVVDIENGYVTHSFKGHGATISSVKFHGE 154

Query: 129 VTGT--RLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVSTSKDGLIKI 186
            +G+  RL SG     + VWDLV    ++ ++ H  A+ G+     D+ +S + DG+++ 
Sbjct: 155 QSGSIWRLASGDTSGMVKVWDLVRRNCIHTIQEHAAAVRGL-----DFRLSPADDGVLE- 208

Query: 187 WDLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKEAGSKLIEKGVYD 246
                                       L+T G D  + L+ L+ +K+A  KL+      
Sbjct: 209 ----------------------------LLTGGRDDIVNLFQLNSTKKA--KLMRTIPVH 238

Query: 247 KQSKQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRIRREEEISKAXXXXXXXXXXXGMTD 306
           +Q +  G       +P+G+  FY    D    VF+I      S A            +  
Sbjct: 239 QQIEACGF---IRDSPDGS-LFYTAGGDA---VFQILSFTSASVAKRTKKPIEELFIIGV 291

Query: 307 EEIQQNIK------------ESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKL------E 348
             I Q  K             + S+ +      I  ++KI   +  TV++ +       +
Sbjct: 292 LPIMQGSKVYLVLSDQTLFLVNLSASLSKDGDEIVIEHKIAG-NHGTVADMRFVGKELDK 350

Query: 349 FVVTTSSNSIEYYSIPYEKR-------DPTS--------PAPTRLYTIELPGHRTDIRSV 393
             + T+S ++   + P  K        +PTS        P    LY     GH   + S+
Sbjct: 351 LALATNSPALRVITAPVTKHNAAEKEDEPTSKVDIQNCLPLEVELY----EGHTDLLNSL 406

Query: 394 DISDDDKLLATAS-NGLLKVWNL-----KTKACIRVFDCGYALTCKFLPG------GTLV 441
           D S++ + LAT S +  + +W L     K K   R       +T   LP          +
Sbjct: 407 DSSENGEWLATCSKDHTVILWKLNADSEKFKPYARFTGHAGPVTAVGLPNVMRNTWPEFI 466

Query: 442 IVGTREGSLQLFDLASST----------LLENKEDAHETAIWSLDITSDGRRLVTGSADK 491
           I  + + +++ + +   T          + +    AHE  I +L I+ +     T S DK
Sbjct: 467 ITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDINALSISPNDSVFATASYDK 526

Query: 492 TIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTV 551
           T K WN  V+   + GT   +                 +  V     DK LA    D T+
Sbjct: 527 TCKIWN--VDSGELEGTLANH--------------KRGLWDVTFCQYDKLLATCSGDKTI 570

Query: 552 KVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQ 611
           KV+ L+SM    +L GH   V        +K I+++ AD  IK+W L  G+C ++L AH 
Sbjct: 571 KVWSLESMSVVKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKVWDLSTGECIRTLDAHS 630

Query: 612 DSIMNVKFLPESHNFFSSSKDGLVKYW 638
           + I  +  L +   F ++  DG+ ++W
Sbjct: 631 NRIWALSVLSDGKEFVTADADGVFQFW 657

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 101/235 (42%), Gaps = 21/235 (8%)

Query: 20  NANCVWMSPESKKSNSPGSVITSALENI--NIWD---IKTGELISVLSDGLP---AGSID 71
           NA+     P ++ +   G V    L N+  N W    I     +++    +P   +  +D
Sbjct: 430 NADSEKFKPYARFTGHAGPVTAVGLPNVMRNTWPEFIITASNDLTIKKWSVPKPTSNDVD 489

Query: 72  VKSSKPAEVSYLHYHDETNLL---------AAGYMDGTIKVWDLLSKSVLLTFNGHKSAI 122
           + + K ++ +   +  + N L         A    D T K+W++ S  +  T   HK  +
Sbjct: 490 MHNIKVSDYTRRAHEKDINALSISPNDSVFATASYDKTCKIWNVDSGELEGTLANHKRGL 549

Query: 123 TVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGEDWLVSTSKD 181
             + F      L + S D  I VW L S   +  L  H +A+    +      +VST  D
Sbjct: 550 WDVTFCQYDKLLATCSGDKTIKVWSLESMSVVKTLEGHTNAVQRCSFINRNKQIVSTGAD 609

Query: 182 GLIKIWDLKVQQCIETHIAHTGECWAMGVHED--LLITSGADTQLKLWNLDFSKE 234
           GLIK+WDL   +CI T  AH+   WA+ V  D    +T+ AD   + W  D S+E
Sbjct: 610 GLIKVWDLSTGECIRTLDAHSNRIWALSVLSDGKEFVTADADGVFQFWK-DCSEE 663

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 63/124 (50%), Gaps = 4/124 (3%)

Query: 383 LPGHRTDIRSVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFD--CGYALTCKFLPGGT 439
           L  H+  +  V     DKLLAT S +  +KVW+L++ + ++  +        C F+    
Sbjct: 542 LANHKRGLWDVTFCQYDKLLATCSGDKTIKVWSLESMSVVKTLEGHTNAVQRCSFINRNK 601

Query: 440 LVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQ 499
            ++    +G ++++DL++   +    DAH   IW+L + SDG+  VT  AD   +FW   
Sbjct: 602 QIVSTGADGLIKVWDLSTGECIRTL-DAHSNRIWALSVLSDGKEFVTADADGVFQFWKDC 660

Query: 500 VEED 503
            EE+
Sbjct: 661 SEEE 664

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 64/147 (43%), Gaps = 5/147 (3%)

Query: 514 PVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVL 573
           P  +LIH    +  +++ +++++P  ++L        ++++ L S K   S+     PV 
Sbjct: 47  PTKRLIHTIENDDEQEITALKLTPNGEYLCFVSQAQLLRIYKLSSKKIIRSMKVSS-PVY 105

Query: 574 SIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHN----FFSS 629
            +D    S L+     D ++ +  ++ G    S   H  +I +VKF  E         S 
Sbjct: 106 VMDCDSSSTLVALGGTDGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSIWRLASG 165

Query: 630 SKDGLVKYWDGDKFECIQKLAAHQSEV 656
              G+VK WD  +  CI  +  H + V
Sbjct: 166 DTSGMVKVWDLVRRNCIHTIQEHAAAV 192

>KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {ON}
           Anc_8.435 YLR222C
          Length = 783

 Score =  122 bits (306), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 136/595 (22%), Positives = 241/595 (40%), Gaps = 79/595 (13%)

Query: 124 VMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGE----DWLV-ST 178
           ++  D T T +  G  D +++V D+ +    + L+ H   IS +   GE     WL+ S 
Sbjct: 75  IIDCDKTSTLVTIGGTDGSVVVIDIENGYITHSLKGHGGTISSLKFFGELNSNIWLLCSG 134

Query: 179 SKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHED-------LLITSGADTQLKLWNLDF 231
             +G++KIWDL  ++CI T   HT     + + E         L+T G D  +  W  + 
Sbjct: 135 DTNGMVKIWDLVKRKCIHTVQEHTSPVRGVDIVESENDTDVLQLVTGGRDNIVNFWEFNL 194

Query: 232 SKEAGSKLIEKGVYDKQSKQRG-LDIKFSVAPNGTAFFYIQNADKTTEVFRIRREEE--- 287
            K+    L++     +Q +  G ++  F       A F + +      + R R+  E   
Sbjct: 195 KKKC--TLVKTIPAHQQIESSGFINHDFIYTAGSDAVFQVISLKNGQVIKRTRKPIEELF 252

Query: 288 ISKAXXXXXXXXXXXGMTDE-----EIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTV 342
           I               M+D+     ++Q  ++E    +I     +  +   I  ++F  V
Sbjct: 253 IIGVLPILNGTEYYLVMSDQSLNLIDVQGALEEEEDELISSKSCIAGNHGIIADMTF--V 310

Query: 343 SNTKLEFVVTTSSNSIEYYSIPYEKRDPTS------PAPTRLYTIELPGHRTDIRSVDIS 396
                   + T+S ++    +P   +   +      P    +Y     GH   + ++D +
Sbjct: 311 GPDLKHLALATNSPTLRLIPVPNTNKSDGNEDESFLPIDVDMY----EGHEDLLNAIDST 366

Query: 397 DDDKLLATAS-NGLLKVWNLKTKACIRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDL 455
           +D   +ATAS +    VW   T                         +  +      F  
Sbjct: 367 EDGLWIATASKDHSAIVWKYNT-------------------------IKQKFTQYARFSG 401

Query: 456 ASSTLLENKEDAHETAIWSLDIT--SDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYL 513
            SS++         TA+   ++   S    L+T S D TIK W         P   D+ +
Sbjct: 402 HSSSV---------TAVGLPNVMPKSYPEYLLTASNDLTIKKWKIP-----KPSAGDEEV 447

Query: 514 PVMKL-IHDTTMEVNE-DVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLP 571
               + I + T   +E D+ ++ ISP D   A +  D T K++ L++ +   +L  HK  
Sbjct: 448 EFHDVKISEYTRRAHEKDINALSISPNDSIFATASYDKTCKIWDLETGESVATLSNHKRG 507

Query: 572 VLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSK 631
           +  +      K+I T S DK IKIW LD     K+L  H +++    F+ + +   S+  
Sbjct: 508 LWDVSFCQFDKIIATCSGDKTIKIWSLDTFSVIKTLEGHTNAVQKCSFINKQNQLVSTGA 567

Query: 632 DGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWEETDDQ 686
           DGL+K WD    ECI  L  H + +W++ + +DG  ++SA  D   + W +  D+
Sbjct: 568 DGLIKIWDISNGECISTLDGHNNRIWALCVQNDGDLIVSADADGVFQFWRDCTDE 622

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/218 (25%), Positives = 97/218 (44%), Gaps = 9/218 (4%)

Query: 73  KSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGT 132
           + +   +++ L      ++ A    D T K+WDL +   + T + HK  +  + F     
Sbjct: 459 RRAHEKDINALSISPNDSIFATASYDKTCKIWDLETGESVATLSNHKRGLWDVSFCQFDK 518

Query: 133 RLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGEDWLVSTSKDGLIKIWDLKV 191
            + + S D  I +W L +   +  L  H +A+    +   ++ LVST  DGLIKIWD+  
Sbjct: 519 IIATCSGDKTIKIWSLDTFSVIKTLEGHTNAVQKCSFINKQNQLVSTGADGLIKIWDISN 578

Query: 192 QQCIETHIAHTGECWAMGVHE--DLLITSGADTQLKLWN--LDFSKEAGSKLIEKGVYDK 247
            +CI T   H    WA+ V    DL++++ AD   + W    D  +E      ++ +  +
Sbjct: 579 GECISTLDGHNNRIWALCVQNDGDLIVSADADGVFQFWRDCTDEQREEDMAKEKERIEQE 638

Query: 248 QSKQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRIRRE 285
           QS Q  L+ +        AF    + D    +F + RE
Sbjct: 639 QSLQNYLNERDWT----NAFLLAISLDHPMRLFNVLRE 672

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 67/140 (47%), Gaps = 13/140 (9%)

Query: 49  IWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLS 108
           IWD++TGE ++ LS+               +VS+  +     ++A    D TIK+W L +
Sbjct: 489 IWDLETGESVATLSN---------HKRGLWDVSFCQFD---KIIATCSGDKTIKIWSLDT 536

Query: 109 KSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIW 168
            SV+ T  GH +A+    F     +L+S   D  I +WD+ +   +  L  H + I  + 
Sbjct: 537 FSVIKTLEGHTNAVQKCSFINKQNQLVSTGADGLIKIWDISNGECISTLDGHNNRIWALC 596

Query: 169 CEGE-DWLVSTSKDGLIKIW 187
            + + D +VS   DG+ + W
Sbjct: 597 VQNDGDLIVSADADGVFQFW 616

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 81/177 (45%), Gaps = 10/177 (5%)

Query: 514 PVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVL 573
           PV K++H  +    +++ +++++P+ K+L        +K+  + + K   S+     P  
Sbjct: 16  PVKKILHTISNNDEQEITALKVTPDGKYLIFVSQAQLLKIVNVSTGKIIKSMKVSS-PSY 74

Query: 574 SIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHN----FFSS 629
            ID    S L+     D ++ +  ++ G    SL  H  +I ++KF  E ++      S 
Sbjct: 75  IIDCDKTSTLVTIGGTDGSVVVIDIENGYITHSLKGHGGTISSLKFFGELNSNIWLLCSG 134

Query: 630 SKDGLVKYWDGDKFECIQKLAAHQSEVWSIAIT-----SDGTSVISASHDHSLRVWE 681
             +G+VK WD  K +CI  +  H S V  + I      +D   +++   D+ +  WE
Sbjct: 135 DTNGMVKIWDLVKRKCIHTVQEHTSPVRGVDIVESENDTDVLQLVTGGRDNIVNFWE 191

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 82/180 (45%), Gaps = 8/180 (4%)

Query: 332 YKIKSVSFTTVSNTKLEFVVTTSSNSIEYYSIPYEKRDPTSPAPTRLYTIELPGHRTDIR 391
           + +K   +T  ++ K    ++ S N   + +  Y+K        T      L  H+  + 
Sbjct: 450 HDVKISEYTRRAHEKDINALSISPNDSIFATASYDKTCKIWDLETGESVATLSNHKRGLW 509

Query: 392 SVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFD--CGYALTCKFLPGGTLVIVGTREG 448
            V     DK++AT S +  +K+W+L T + I+  +        C F+     ++    +G
Sbjct: 510 DVSFCQFDKIIATCSGDKTIKIWSLDTFSVIKTLEGHTNAVQKCSFINKQNQLVSTGADG 569

Query: 449 SLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFW----NFQVEEDL 504
            ++++D+++   +    D H   IW+L + +DG  +V+  AD   +FW    + Q EED+
Sbjct: 570 LIKIWDISNGECISTL-DGHNNRIWALCVQNDGDLIVSADADGVFQFWRDCTDEQREEDM 628

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 86/172 (50%), Gaps = 14/172 (8%)

Query: 72  VKSSKPAEVSYLHYHDETN-LLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKF--- 127
           +KS K +  SY+   D+T+ L+  G  DG++ V D+ +  +  +  GH   I+ +KF   
Sbjct: 64  IKSMKVSSPSYIIDCDKTSTLVTIGGTDGSVVVIDIENGYITHSLKGHGGTISSLKFFGE 123

Query: 128 -DVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGED-----WLVSTSK 180
            +     L SG  +  + +WDLV    ++ ++ H   + G+   E E+      LV+  +
Sbjct: 124 LNSNIWLLCSGDTNGMVKIWDLVKRKCIHTVQEHTSPVRGVDIVESENDTDVLQLVTGGR 183

Query: 181 DGLIKIWDLKV-QQC--IETHIAHTGECWAMGVHEDLLITSGADTQLKLWNL 229
           D ++  W+  + ++C  ++T  AH     +  ++ D + T+G+D   ++ +L
Sbjct: 184 DNIVNFWEFNLKKKCTLVKTIPAHQQIESSGFINHDFIYTAGSDAVFQVISL 235

 Score = 40.4 bits (93), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 61/142 (42%), Gaps = 11/142 (7%)

Query: 80  VSYLHYHDETN----LLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKF-----DVT 130
           +S L +  E N    LL +G  +G +K+WDL+ +  + T   H S +  +       D  
Sbjct: 115 ISSLKFFGELNSNIWLLCSGDTNGMVKIWDLVKRKCIHTVQEHTSPVRGVDIVESENDTD 174

Query: 131 GTRLISGSRDSNIIVW--DLVSEVGLYKLRSHKDAISGIWCEGEDWLVSTSKDGLIKIWD 188
             +L++G RD+ +  W  +L  +  L K       I        D++ +   D + ++  
Sbjct: 175 VLQLVTGGRDNIVNFWEFNLKKKCTLVKTIPAHQQIESSGFINHDFIYTAGSDAVFQVIS 234

Query: 189 LKVQQCIETHIAHTGECWAMGV 210
           LK  Q I+       E + +GV
Sbjct: 235 LKNGQVIKRTRKPIEELFIIGV 256

>TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.717
           YOR269W
          Length = 848

 Score =  119 bits (298), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 162/699 (23%), Positives = 275/699 (39%), Gaps = 105/699 (15%)

Query: 35  SPGSVI-TSALENINIWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLA 93
           S GS++ T  L+ INI  +K  +  S L D       +V +    E++ L    +   L 
Sbjct: 27  SDGSILATPILDEINI--VKFIDNNSYLLD-------NVSNDDEQEITALQLSPDGKYLC 77

Query: 94  AGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVG 153
               +  +K+++++ K  + +     S   VM  D T T L  G  D ++ V D+ +   
Sbjct: 78  YASTNQLLKIYNIVEKKFVKSLK-ISSPSYVMSIDQTSTLLAVGGTDGSVTVIDIENSYI 136

Query: 154 LYKLRSHKDAISGI-------WCEGEDWLV-STSKDGLIKIWDLKVQQCIETHIAHTGEC 205
            +  + H   IS +           E WL+ S    G+IK+ D+  ++C+ T   HT   
Sbjct: 137 THSFKGHGATISAVKFYSDASTQNNEGWLLFSGDTAGMIKVCDMVKRRCLYTFQEHTSAI 196

Query: 206 WAMGVH---------EDLL--ITSGADTQLKLWNLDFSKEAGSKLIE------------- 241
             + +          E LL  ++ G D  + LW  +  ++  SKLI+             
Sbjct: 197 RGLDIRLSPSHVENDEPLLQLLSGGRDDIVNLWEFNLRRK--SKLIKTIPVYQQVEACGF 254

Query: 242 -KGVYDKQSKQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRIRREEEISKAXXXXXXXXX 300
             G Y+      G D  F +    +     +      E+F I     +  +         
Sbjct: 255 LNGNYEDLIYTGGSDAIFQILSISSNKILKKTLKPIEELFIIGVLPILDNSKFYLVLSDQ 314

Query: 301 XXGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKS-----VSFTTVSNTKLEFVVTTSS 355
              + D E      E+ S  + H   +IK +  I            V  T  +  + T+S
Sbjct: 315 TLLLVDVEENMAEDENPSEYVDH--TIIKIENSIAGNHGTIADMRVVDPTLSKLALATNS 372

Query: 356 NSIEYYSIP-----YEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLL 410
            ++    I       + +D  S  P  +   E  GH   + S+D ++D   +ATAS    
Sbjct: 373 PTLRIIPISEANEEADSKDALSRIPIDVDMYE--GHTDLLNSLDSTEDSLWIATAS---- 426

Query: 411 KVWNLKTKACI-----RVFDCGYALTCKFLP-GGTLVIVGTREGSLQLFDLASSTLLENK 464
                K  +CI      V +  Y +  KFL    ++  VG             + L +N 
Sbjct: 427 -----KDNSCILWRYNAVLE-KYQIYAKFLGHASSVTAVGL-----------PNVLTKNY 469

Query: 465 EDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLP-VMKLIHDTT 523
            D                 ++T S D TIK W        +    D + P  +KL   T 
Sbjct: 470 PD----------------YVITASNDSTIKKWKVPKPTKNLDNN-DSFKPHEVKLSEYTR 512

Query: 524 MEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKL 583
              ++D+ ++ ISP D   A +  D T K++ L+S     +L  HK  +  +      K 
Sbjct: 513 RAHDKDINALSISPNDSIFATASYDKTCKIWDLESGDLKATLVNHKRGLWDVSFCQYDKF 572

Query: 584 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKF 643
           I+T+S DK IK+W LD     K+   H +++   +F+ +     S   DGL+K WD    
Sbjct: 573 IVTASGDKTIKMWSLDTFTVVKTFEGHSNAVQRCQFINKQKQLVSCGADGLIKIWDCSSG 632

Query: 644 ECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWEE 682
           ECI+ L  H + +W++++ +DG  +ISA  D   + W +
Sbjct: 633 ECIKTLDGHSNRIWALSVINDGDVIISADADGVFQFWRD 671

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 72/277 (25%), Positives = 114/277 (41%), Gaps = 32/277 (11%)

Query: 28  PESKKSNSPGSVITSALEN-INIWDIKTGELISVLSDGLPAGSIDVKSS-KPAEVSYLHY 85
           P     N P  VIT++ ++ I  W +             P  ++D   S KP EV    Y
Sbjct: 462 PNVLTKNYPDYVITASNDSTIKKWKVPK-----------PTKNLDNNDSFKPHEVKLSEY 510

Query: 86  ----HDET----------NLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTG 131
               HD+           ++ A    D T K+WDL S  +  T   HK  +  + F    
Sbjct: 511 TRRAHDKDINALSISPNDSIFATASYDKTCKIWDLESGDLKATLVNHKRGLWDVSFCQYD 570

Query: 132 TRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGEDWLVSTSKDGLIKIWDLK 190
             +++ S D  I +W L +   +     H +A+    +   +  LVS   DGLIKIWD  
Sbjct: 571 KFIVTASGDKTIKMWSLDTFTVVKTFEGHSNAVQRCQFINKQKQLVSCGADGLIKIWDCS 630

Query: 191 VQQCIETHIAHTGECWAMGV--HEDLLITSGADTQLKLWNLDFSKEAGSKLIEKGVYDKQ 248
             +CI+T   H+   WA+ V    D++I++ AD   + W  D + E   K +EK    K 
Sbjct: 631 SGECIKTLDGHSNRIWALSVINDGDVIISADADGVFQFWR-DCTGENREKDLEKERL-KV 688

Query: 249 SKQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRIRRE 285
            +++ L    +      AF      D    +F + R+
Sbjct: 689 EQEQSLQNYLANEDWTNAFLLAMTLDHPLRLFNVLRK 725

>SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]
           {ON} highly similar to uniprot|Q05946 Saccharomyces
           cerevisiae YLR222C UTP13 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 841

 Score =  109 bits (272), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 101/199 (50%), Gaps = 5/199 (2%)

Query: 484 LVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLA 543
           L++ S D TIK W     ED         + V+K    T     +D+ ++ +SP D   A
Sbjct: 486 LLSASNDLTIKKWAVPKPED-----GKDTVHVVKASEYTRRAHEKDINALAVSPNDSVFA 540

Query: 544 ISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDC 603
            +  D T K++ LD+ +   +L  HK  +  ++     KL+ T S DK +KIW LD    
Sbjct: 541 TASYDKTCKIWSLDTGELEATLANHKRGLWDVNFCQYDKLLATCSGDKTVKIWSLDTYSV 600

Query: 604 HKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITS 663
            K+L  H +++    F+ ++    SS  DGLVK WD    EC++ L AH + +W++++  
Sbjct: 601 MKTLEGHTNAVQRCSFISKNKQLVSSGADGLVKLWDCSTGECVKTLDAHNNRIWALSVLK 660

Query: 664 DGTSVISASHDHSLRVWEE 682
           DG  +++A  D   + W++
Sbjct: 661 DGDIIVTADADGVFQFWKD 679

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 73/158 (46%), Gaps = 3/158 (1%)

Query: 73  KSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGT 132
           + +   +++ L      ++ A    D T K+W L +  +  T   HK  +  + F     
Sbjct: 520 RRAHEKDINALAVSPNDSVFATASYDKTCKIWSLDTGELEATLANHKRGLWDVNFCQYDK 579

Query: 133 RLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGEDWLVSTSKDGLIKIWDLKV 191
            L + S D  + +W L +   +  L  H +A+    +      LVS+  DGL+K+WD   
Sbjct: 580 LLATCSGDKTVKIWSLDTYSVMKTLEGHTNAVQRCSFISKNKQLVSSGADGLVKLWDCST 639

Query: 192 QQCIETHIAHTGECWAMGVHE--DLLITSGADTQLKLW 227
            +C++T  AH    WA+ V +  D+++T+ AD   + W
Sbjct: 640 GECVKTLDAHNNRIWALSVLKDGDIIVTADADGVFQFW 677

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 77/168 (45%), Gaps = 4/168 (2%)

Query: 332 YKIKSVSFTTVSNTKLEFVVTTSSNSIEYYSIPYEKRDPTSPAPTRLYTIELPGHRTDIR 391
           + +K+  +T  ++ K    +  S N   + +  Y+K        T      L  H+  + 
Sbjct: 511 HVVKASEYTRRAHEKDINALAVSPNDSVFATASYDKTCKIWSLDTGELEATLANHKRGLW 570

Query: 392 SVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFD--CGYALTCKFLPGGTLVIVGTREG 448
            V+    DKLLAT S +  +K+W+L T + ++  +        C F+     ++    +G
Sbjct: 571 DVNFCQYDKLLATCSGDKTVKIWSLDTYSVMKTLEGHTNAVQRCSFISKNKQLVSSGADG 630

Query: 449 SLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFW 496
            ++L+D ++   ++   DAH   IW+L +  DG  +VT  AD   +FW
Sbjct: 631 LVKLWDCSTGECVKTL-DAHNNRIWALSVLKDGDIIVTADADGVFQFW 677

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 89/185 (48%), Gaps = 21/185 (11%)

Query: 65  LPAGSIDVKSSKPAEVSYLHYHDETN-LLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAIT 123
           LP+  I V+S K +   Y+   D T+ LLA G  DG++ + D+ +  V  +F GH   I+
Sbjct: 109 LPSKKI-VRSMKVSSPVYVMECDVTSTLLAIGGTDGSVSIIDIENGYVTHSFKGHGGTIS 167

Query: 124 VMKF----DVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISG----IWCEGED-- 173
            +KF    +    RL SG     + +WDLV    L+ ++ H  A+ G    +  E ED  
Sbjct: 168 SVKFHGELNSNVWRLASGDTTGVVKIWDLVKRKCLHTVQEHTMAVRGLDFRVLDEDEDQM 227

Query: 174 WLVSTSKDGLIKIWDLKVQ-QC-------IETHIAHTGECWAMGVHEDLLITSGADTQLK 225
            L+S  +D +I ++    + +C       I   +   G     GV ++ + T+G+D   +
Sbjct: 228 QLISGGRDNIINLYQFDSRKKCKLLKTLPIHQQVESCGFINTGGV-QNCVYTAGSDAVYQ 286

Query: 226 LWNLD 230
           + +LD
Sbjct: 287 IVSLD 291

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 78/174 (44%), Gaps = 10/174 (5%)

Query: 517 KLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSID 576
           +++H    +  +++ ++RI+P+ +FL        ++V++L S K   S+     PV  ++
Sbjct: 70  QVVHIIENDDEQEITALRITPDGQFLCFVSQAQLLRVYHLPSKKIVRSMKVSS-PVYVME 128

Query: 577 ISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHN----FFSSSKD 632
               S L+     D ++ I  ++ G    S   H  +I +VKF  E ++      S    
Sbjct: 129 CDVTSTLLAIGGTDGSVSIIDIENGYVTHSFKGHGGTISSVKFHGELNSNVWRLASGDTT 188

Query: 633 GLVKYWDGDKFECIQKLAAHQSEVWSIAIT-----SDGTSVISASHDHSLRVWE 681
           G+VK WD  K +C+  +  H   V  +         D   +IS   D+ + +++
Sbjct: 189 GVVKIWDLVKRKCLHTVQEHTMAVRGLDFRVLDEDEDQMQLISGGRDNIINLYQ 242

>AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR222C (UTP13)
          Length = 806

 Score =  106 bits (265), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 66/239 (27%), Positives = 114/239 (47%), Gaps = 11/239 (4%)

Query: 484 LVTGSADKTIKFWNFQVEEDLVPGTADKY---LPVMKLIHDTTMEVNE-DVLSVRISPED 539
           L+T S D TIK W        VP   D+    LP +    + T   +E D+ ++ +SP D
Sbjct: 448 LLTASNDLTIKRWK-------VPNPNDRKAIELPHIVKASEYTRRAHEKDINAISMSPND 500

Query: 540 KFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLD 599
              A +  D T K++ +D+ +   +L  HK  +  +       L+ T S D++I +W L+
Sbjct: 501 SIFATASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEYDWLLATCSGDRSINLWSLE 560

Query: 600 FGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSI 659
                K+L  H +++  V F+  +    S+  DGLVK WD    EC++ L AH + +W++
Sbjct: 561 SFTVLKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIWDCSTGECVRTLDAHNNRIWAL 620

Query: 660 AITSDGTSVISASHDHSLRVWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGSGDDAF 718
           A+ +DG  +I+A  D   + WE+  ++                 +L   + EG  ++AF
Sbjct: 621 AVANDGQLIITADADGVFQFWEDNSEEEHERNIEQEKLRVEQEQSLQNYISEGDWNNAF 679

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/205 (29%), Positives = 94/205 (45%), Gaps = 6/205 (2%)

Query: 90  NLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLV 149
           ++ A    D T K+W++ +  V  T   HK  +  + F      L + S D +I +W L 
Sbjct: 501 SIFATASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEYDWLLATCSGDRSINLWSLE 560

Query: 150 SEVGLYKLRSHKDAISGI-WCEGEDWLVSTSKDGLIKIWDLKVQQCIETHIAHTGECWAM 208
           S   L  L  H +A+  + +  G   LVST  DGL+KIWD    +C+ T  AH    WA+
Sbjct: 561 SFTVLKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIWDCSTGECVRTLDAHNNRIWAL 620

Query: 209 GVHED--LLITSGADTQLKLWNLDFSKEAGSKLIEKGVYDKQSKQRGLDIKFSVAPNGTA 266
            V  D  L+IT+ AD   + W  D S+E   + IE+    +  +++ L    S      A
Sbjct: 621 AVANDGQLIITADADGVFQFWE-DNSEEEHERNIEQEKL-RVEQEQSLQNYISEGDWNNA 678

Query: 267 FFYIQNADKTTEVFRIRREEEISKA 291
           F      D    ++ +  E  I+KA
Sbjct: 679 FLLAMTLDHPMRLYHV-LERAIAKA 702

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 87/182 (47%), Gaps = 29/182 (15%)

Query: 72  VKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKF---- 127
           +K S PA V  L   + + LLA G  DG++ V+D+ +  V  +  GH + I+ +KF    
Sbjct: 98  MKISSPAYV--LDCDESSTLLAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEV 155

Query: 128 DVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCE----GEDWLVSTSKDGL 183
           D     L SG  +  + +WDLV    ++ ++ H  A+ G+        E  L+S  +D +
Sbjct: 156 DSGMWLLASGDTNGMVKIWDLVKRRCIHTVQEHTAAVRGLDIRVQEGAESLLLSGGRDDV 215

Query: 184 IKI--WDLK----------VQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDF 231
           + +  +D+K          V++ IE+       C  +G +  L+ T+G D   ++ +L+ 
Sbjct: 216 VHVHHFDMKKKCKLLQTIPVKRQIES-------CGFIGDNTSLIYTAGGDAVYQIISLES 268

Query: 232 SK 233
            K
Sbjct: 269 GK 270

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 69/148 (46%), Gaps = 5/148 (3%)

Query: 518 LIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDI 577
           +IH    E  +DV ++R++P+ ++L  +  +  ++ + L++ +   S+     P   +D 
Sbjct: 51  IIHKIENEDEQDVTALRLTPDGRYLCYASQNQLLRFYDLETKRTTRSMKISS-PAYVLDC 109

Query: 578 SFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHN----FFSSSKDG 633
              S L+     D ++ ++ +  G    SL  H  +I +VKF  E  +      S   +G
Sbjct: 110 DESSTLLAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGMWLLASGDTNG 169

Query: 634 LVKYWDGDKFECIQKLAAHQSEVWSIAI 661
           +VK WD  K  CI  +  H + V  + I
Sbjct: 170 MVKIWDLVKRRCIHTVQEHTAAVRGLDI 197

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 40/182 (21%), Positives = 85/182 (46%), Gaps = 6/182 (3%)

Query: 326 QVIKSQYKIKSVSFTTVSNTKLEFVVTTSSNSIEYYSIPYEKRDPTSPAPTRLYTIELPG 385
           + I+  + +K+  +T  ++ K    ++ S N   + +  Y+K        T      L  
Sbjct: 469 KAIELPHIVKASEYTRRAHEKDINAISMSPNDSIFATASYDKTCKIWNVDTGEVEATLAN 528

Query: 386 HRTDIRSVDISDDDKLLATASNGL-LKVWNLKTKACIRVFDCGYALTCK---FLPGGTLV 441
           H+  +  V   + D LLAT S    + +W+L++   ++  + G+    +   F+ G   +
Sbjct: 529 HKRGLWGVAFCEYDWLLATCSGDRSINLWSLESFTVLKTLE-GHTNAVQRVSFINGNKQL 587

Query: 442 IVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVE 501
           +    +G ++++D ++   +    DAH   IW+L + +DG+ ++T  AD   +FW    E
Sbjct: 588 VSTGADGLVKIWDCSTGECVRTL-DAHNNRIWALAVANDGQLIITADADGVFQFWEDNSE 646

Query: 502 ED 503
           E+
Sbjct: 647 EE 648

 Score = 40.0 bits (92), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 59/118 (50%), Gaps = 11/118 (9%)

Query: 389 DIRSVDISDDDKLLATAS-NGLLKVWNLKTKACIR---VFDCGYALTCKFLPGGTLVIVG 444
           D+ ++ ++ D + L  AS N LL+ ++L+TK   R   +    Y L C      TL+ VG
Sbjct: 62  DVTALRLTPDGRYLCYASQNQLLRFYDLETKRTTRSMKISSPAYVLDCD--ESSTLLAVG 119

Query: 445 TREGSLQLFDLASSTLLENKEDAHETAIWSL----DITSDGRRLVTGSADKTIKFWNF 498
             +GS+ +FD+A+  +  + +  H   I S+    ++ S    L +G  +  +K W+ 
Sbjct: 120 GTDGSVNVFDIANGYVTHSLK-GHGATISSVKFYGEVDSGMWLLASGDTNGMVKIWDL 176

>KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 826

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 103/203 (50%), Gaps = 5/203 (2%)

Query: 484 LVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLA 543
           ++T S D TIK W         PG       V+K+   T    ++D+ ++ ISP D   A
Sbjct: 469 IITASNDLTIKKWTVPK-----PGHETAEPHVVKVSDYTRRAHDKDINALSISPNDSTFA 523

Query: 544 ISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDC 603
            +  D T KV+ +DS +   +L  HK  +  +      KL+ T S DK +K+W LD    
Sbjct: 524 TASYDKTCKVWDVDSGELQGTLANHKRGLWDVSFCQYDKLLATCSGDKTVKVWSLDTLSV 583

Query: 604 HKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITS 663
            K+L  H +++    F+ ++    S+  DGL+K WD    EC++ L AH++ +W++++  
Sbjct: 584 VKTLEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDLSTGECVRTLDAHENRIWALSVLH 643

Query: 664 DGTSVISASHDHSLRVWEETDDQ 686
           DG   ++A  D   + W++  ++
Sbjct: 644 DGDEFVTADADGVFQFWKDCSEE 666

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 84/194 (43%), Gaps = 5/194 (2%)

Query: 92  LAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSE 151
            A    D T KVWD+ S  +  T   HK  +  + F      L + S D  + VW L + 
Sbjct: 522 FATASYDKTCKVWDVDSGELQGTLANHKRGLWDVSFCQYDKLLATCSGDKTVKVWSLDTL 581

Query: 152 VGLYKLRSHKDAISGI-WCEGEDWLVSTSKDGLIKIWDLKVQQCIETHIAHTGECWAMGV 210
             +  L  H +A+    +      LVST  DGLIK+WDL   +C+ T  AH    WA+ V
Sbjct: 582 SVVKTLEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDLSTGECVRTLDAHENRIWALSV 641

Query: 211 -HE-DLLITSGADTQLKLWNLDFSKEAGSKLIEKGVYDKQSKQRGLDIKFSVAPNGTAFF 268
            H+ D  +T+ AD   + W  D S+E   + +E     K  + + L    S      AF 
Sbjct: 642 LHDGDEFVTADADGVFQFWK-DCSEEQEKENLENH-KRKVEQDQSLQNYMSQGDWTNAFL 699

Query: 269 YIQNADKTTEVFRI 282
                D    ++R+
Sbjct: 700 LAMTLDHPMRLYRV 713

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 60/123 (48%), Gaps = 4/123 (3%)

Query: 383 LPGHRTDIRSVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFD--CGYALTCKFLPGGT 439
           L  H+  +  V     DKLLAT S +  +KVW+L T + ++  +        C F+    
Sbjct: 545 LANHKRGLWDVSFCQYDKLLATCSGDKTVKVWSLDTLSVVKTLEGHTNAVQRCSFINKNK 604

Query: 440 LVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQ 499
            ++    +G ++L+DL++   +    DAHE  IW+L +  DG   VT  AD   +FW   
Sbjct: 605 QLVSTGADGLIKLWDLSTGECVRTL-DAHENRIWALSVLHDGDEFVTADADGVFQFWKDC 663

Query: 500 VEE 502
            EE
Sbjct: 664 SEE 666

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 76/164 (46%), Gaps = 29/164 (17%)

Query: 89  TNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKF----DVTGTRLISGSRDSNII 144
           + L+A G  DG++ V D+ +  V  +  GH + I+ +KF    + T  RL SG  +  + 
Sbjct: 113 STLVALGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFFGELNSTTWRLGSGDTNGVVK 172

Query: 145 VWDLVSEVGLYKLRSHKDAISGIWCEGEDW------LVSTSKDGLIKIWDL------KVQ 192
           VWDLV    L+ ++ H  A+ G+     D       L+S  +D ++ ++ L      K+ 
Sbjct: 173 VWDLVRRSCLHTIQEHAAAVRGLDFRVSDADDDVLELLSGGRDDIVNLYQLGSTKKVKLV 232

Query: 193 QCIETH-------IAHTGECWAMGVHEDLLITSGADTQLKLWNL 229
           + I  H         H GE      H+DL  T+G D   ++ +L
Sbjct: 233 KTIPVHQQIEACGFIHDGE------HQDLFYTAGGDAVYQILSL 270

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 64/140 (45%), Gaps = 13/140 (9%)

Query: 49  IWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLS 108
           +WD+ +GEL          G++        +VS+  Y     LLA    D T+KVW L +
Sbjct: 533 VWDVDSGEL---------QGTLANHKRGLWDVSFCQY---DKLLATCSGDKTVKVWSLDT 580

Query: 109 KSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIW 168
            SV+ T  GH +A+    F     +L+S   D  I +WDL +   +  L +H++ I  + 
Sbjct: 581 LSVVKTLEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDLSTGECVRTLDAHENRIWALS 640

Query: 169 C-EGEDWLVSTSKDGLIKIW 187
                D  V+   DG+ + W
Sbjct: 641 VLHDGDEFVTADADGVFQFW 660

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 32/147 (21%), Positives = 70/147 (47%), Gaps = 5/147 (3%)

Query: 514 PVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVL 573
           P  +++H    +  +++ +++++P+ ++L        +++++L S +   S+     PV 
Sbjct: 47  PTKRVLHRIENDDEQEITALKLTPDGEYLCYVSQAQLLRIYHLRSKRVVRSMKVSS-PVY 105

Query: 574 SIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHN----FFSS 629
            ID    S L+     D ++ +  ++ G    SL  H  +I +VKF  E ++      S 
Sbjct: 106 VIDCDPSSTLVALGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFFGELNSTTWRLGSG 165

Query: 630 SKDGLVKYWDGDKFECIQKLAAHQSEV 656
             +G+VK WD  +  C+  +  H + V
Sbjct: 166 DTNGVVKVWDLVRRSCLHTIQEHAAAV 192

 Score = 40.0 bits (92), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 89/190 (46%), Gaps = 16/190 (8%)

Query: 374 APTR--LYTIELPGHRTDIRSVDISDDDKLLATASNG-LLKVWNLKTKACIRVFDCG--- 427
           APT+  L+ IE    + +I ++ ++ D + L   S   LL++++L++K  +R        
Sbjct: 46  APTKRVLHRIENDDEQ-EITALKLTPDGEYLCYVSQAQLLRIYHLRSKRVVRSMKVSSPV 104

Query: 428 YALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSL----DITSDGRR 483
           Y + C   P  TLV +G  +GS+ + D+ +  +  + +  H   I S+    ++ S   R
Sbjct: 105 YVIDCD--PSSTLVALGGTDGSVSVIDIENGYVTHSLK-GHGATISSVKFFGELNSTTWR 161

Query: 484 LVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLA 543
           L +G  +  +K W+      L   T  ++   ++ +     + ++DVL +     D  + 
Sbjct: 162 LGSGDTNGVVKVWDLVRRSCL--HTIQEHAAAVRGLDFRVSDADDDVLELLSGGRDDIVN 219

Query: 544 ISLLDNTVKV 553
           +  L +T KV
Sbjct: 220 LYQLGSTKKV 229

>Kpol_1031.49 s1031
           (132811..133005,133055..133063,133288..133320,
           133324..133428,133432..135372) [2283 bp, 760 aa] {ON}
           (132811..133005,133055..133063,133288..133320,
           133324..133428,133432..135372) [2283 nt, 761 aa]
          Length = 760

 Score =  103 bits (256), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 101/204 (49%), Gaps = 2/204 (0%)

Query: 484 LVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLA 543
           ++T S D T+K W  +V         D  + ++K+   T     +D+ ++ I+P D   A
Sbjct: 396 IITSSNDFTVKKW--KVPSPTKKSDNDDDMHLIKVSEYTRRAHEKDINALSIAPNDSIFA 453

Query: 544 ISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDC 603
            +  D T K++ LDS +   +L  HK  +  +      K I T+S DK IKIW L+    
Sbjct: 454 TASYDKTCKIWDLDSGELMATLANHKRGLWDVSFCQYDKYIATASGDKTIKIWSLETFKV 513

Query: 604 HKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITS 663
             +L  H +++    F+ +     S+  DGL+K WD    EC++ L  H + +W++ +  
Sbjct: 514 VNTLEGHTNAVQRCSFINKQKQIVSTGADGLIKIWDCSSGECLKTLDGHANRIWALCVLR 573

Query: 664 DGTSVISASHDHSLRVWEETDDQV 687
           DG  +I+A  D   + W++  ++V
Sbjct: 574 DGDMIITADADGVFQFWKDCTEEV 597

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 115/532 (21%), Positives = 202/532 (37%), Gaps = 72/532 (13%)

Query: 155 YKLRSHKDAISGI--WCEGED--WLVSTSKDGLIKIWDLKVQQCIETHIAHTGECWAMGV 210
           + L+ H   IS +  + E ED  WL+++    ++K+WDL  ++CI T   H+     +  
Sbjct: 83  HSLKGHGATISSLKFYGESEDSVWLLASGDTNMVKVWDLVKRKCIHTLQEHSSAVRGIDF 142

Query: 211 HE-----DL--LITSGADTQLKLWNLDFSKEAGSKLIEKGVYDKQSKQRGL-----DIKF 258
            +     D+  L+T G D  +  W +   K    KLI      +Q +  G      D   
Sbjct: 143 KQSSTDSDIIHLVTGGRDNIINHWTISGLKNF--KLIRTFPVHQQVEACGFIKSTEDDNC 200

Query: 259 SVAPNGTAFFYIQNADKTTEVFRIRREEE---ISKAXXXXXXXXXXXGMTDEEIQQ---- 311
                G A F I +    + + + ++  E   I               ++D+ +Q     
Sbjct: 201 IYTAGGDAVFQILSLSNGSVIKKTKKPTEELFIIGVLPIKNFTKLYLVLSDQTLQLIDLI 260

Query: 312 NIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSNSIEYYSIPYEKRDPT 371
           +  E  S II     +  +   I  +    V        + T+S ++    +  E     
Sbjct: 261 DTFEEDSEIITIKSSIAGNHGTIADMRL--VGPELKSIALATNSPTLRIIPVISEDNKNN 318

Query: 372 SPAPTRLYTIELPGHRTDIRSVDISDDDKLLATAS-NGLLKVWNL-----KTKACIRVFD 425
            P    LY     GH   + S+D ++D   +ATAS +    +W       K K   +   
Sbjct: 319 IPLGVELY----DGHEDLLNSLDATEDGLWIATASKDNTAMLWRFNDSENKFKKYAQFIG 374

Query: 426 CGYALTCKFLPG------GTLVIVGTREGSLQLFDLASSTLLENKED------------- 466
              ++T   LP          +I  + + +++ + + S T   + +D             
Sbjct: 375 HASSVTSVSLPNVINNGWPEFIITSSNDFTVKKWKVPSPTKKSDNDDDMHLIKVSEYTRR 434

Query: 467 AHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEV 526
           AHE  I +L I  +     T S DKT K W+    E +                 T    
Sbjct: 435 AHEKDINALSIAPNDSIFATASYDKTCKIWDLDSGELMA----------------TLANH 478

Query: 527 NEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIIT 586
              +  V     DK++A +  D T+K++ L++ K   +L GH   V         K I++
Sbjct: 479 KRGLWDVSFCQYDKYIATASGDKTIKIWSLETFKVVNTLEGHTNAVQRCSFINKQKQIVS 538

Query: 587 SSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYW 638
           + AD  IKIW    G+C K+L  H + I  +  L +     ++  DG+ ++W
Sbjct: 539 TGADGLIKIWDCSSGECLKTLDGHANRIWALCVLRDGDMIITADADGVFQFW 590

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 82/173 (47%), Gaps = 4/173 (2%)

Query: 73  KSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGT 132
           + +   +++ L      ++ A    D T K+WDL S  ++ T   HK  +  + F     
Sbjct: 433 RRAHEKDINALSIAPNDSIFATASYDKTCKIWDLDSGELMATLANHKRGLWDVSFCQYDK 492

Query: 133 RLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGEDWLVSTSKDGLIKIWDLKV 191
            + + S D  I +W L +   +  L  H +A+    +   +  +VST  DGLIKIWD   
Sbjct: 493 YIATASGDKTIKIWSLETFKVVNTLEGHTNAVQRCSFINKQKQIVSTGADGLIKIWDCSS 552

Query: 192 QQCIETHIAHTGECWAMGVHE--DLLITSGADTQLKLWNLDFSKEAGSKLIEK 242
            +C++T   H    WA+ V    D++IT+ AD   + W  D ++E   + +EK
Sbjct: 553 GECLKTLDGHANRIWALCVLRDGDMIITADADGVFQFWK-DCTEEVKEQDLEK 604

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 58/123 (47%), Gaps = 4/123 (3%)

Query: 383 LPGHRTDIRSVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFD--CGYALTCKFLPGGT 439
           L  H+  +  V     DK +ATAS +  +K+W+L+T   +   +        C F+    
Sbjct: 475 LANHKRGLWDVSFCQYDKYIATASGDKTIKIWSLETFKVVNTLEGHTNAVQRCSFINKQK 534

Query: 440 LVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQ 499
            ++    +G ++++D +S   L+   D H   IW+L +  DG  ++T  AD   +FW   
Sbjct: 535 QIVSTGADGLIKIWDCSSGECLKTL-DGHANRIWALCVLRDGDMIITADADGVFQFWKDC 593

Query: 500 VEE 502
            EE
Sbjct: 594 TEE 596

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 64/143 (44%), Gaps = 19/143 (13%)

Query: 49  IWDIKTGELISVLSD---GLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWD 105
           IWD+ +GEL++ L++   GL             +VS+  Y      +A    D TIK+W 
Sbjct: 463 IWDLDSGELMATLANHKRGL------------WDVSFCQYD---KYIATASGDKTIKIWS 507

Query: 106 LLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAIS 165
           L +  V+ T  GH +A+    F     +++S   D  I +WD  S   L  L  H + I 
Sbjct: 508 LETFKVVNTLEGHTNAVQRCSFINKQKQIVSTGADGLIKIWDCSSGECLKTLDGHANRIW 567

Query: 166 GIWC-EGEDWLVSTSKDGLIKIW 187
            +      D +++   DG+ + W
Sbjct: 568 ALCVLRDGDMIITADADGVFQFW 590

 Score = 35.0 bits (79), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 38/83 (45%), Gaps = 8/83 (9%)

Query: 606 SLFAHQDSIMNVKFLPESHN---FFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSI--- 659
           SL  H  +I ++KF  ES +     +S    +VK WD  K +CI  L  H S V  I   
Sbjct: 84  SLKGHGATISSLKFYGESEDSVWLLASGDTNMVKVWDLVKRKCIHTLQEHSSAVRGIDFK 143

Query: 660 --AITSDGTSVISASHDHSLRVW 680
             +  SD   +++   D+ +  W
Sbjct: 144 QSSTDSDIIHLVTGGRDNIINHW 166

>KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA
          Length = 814

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 69/238 (28%), Positives = 111/238 (46%), Gaps = 10/238 (4%)

Query: 484 LVTGSADKTIKFWNFQVEEDLVPG-TADKY--LPVMKLIHDTTMEVNEDVLSVRISPEDK 540
           ++T S D TIK W        VP  T+D+   L ++K    T     +D+ ++ ISP D 
Sbjct: 456 IITASNDLTIKKWK-------VPKVTSDEPEDLILVKTSEYTRRAHEKDINAISISPNDS 508

Query: 541 FLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600
             A +  D T K++ LD  +F  +L  HK  +  +      KL+ T S DK IKIW L+ 
Sbjct: 509 LFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLES 568

Query: 601 GDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIA 660
               K+L  H +++    F+ ++    S+  DGLV  WD    E ++ L AH + +W++A
Sbjct: 569 YAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNRIWALA 628

Query: 661 ITSDGTSVISASHDHSLRVWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGSGDDAF 718
           + +DG S ++A  D     W +  ++                 +L   L EG   +AF
Sbjct: 629 VMNDGESFVTADADGFFEFWRDNSEEEHERNLEQEKLKIEQEQSLQNYLSEGDWTNAF 686

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 84/199 (42%), Gaps = 5/199 (2%)

Query: 90  NLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLV 149
           +L A    D T K+W+L       T   HK  +  + F      L + S D  I +W L 
Sbjct: 508 SLFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLE 567

Query: 150 SEVGLYKLRSHKDAISGI-WCEGEDWLVSTSKDGLIKIWDLKVQQCIETHIAHTGECWAM 208
           S   +  L  H +A+    +      L+ST  DGL+ IWDL   + ++T  AH    WA+
Sbjct: 568 SYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNRIWAL 627

Query: 209 GVHED--LLITSGADTQLKLWNLDFSKEAGSKLIEKGVYDKQSKQRGLDIKFSVAPNGTA 266
            V  D    +T+ AD   + W  D S+E   + +E+    K  +++ L    S      A
Sbjct: 628 AVMNDGESFVTADADGFFEFWR-DNSEEEHERNLEQEKL-KIEQEQSLQNYLSEGDWTNA 685

Query: 267 FFYIQNADKTTEVFRIRRE 285
           F      D    ++ + R+
Sbjct: 686 FLLAMTLDHPMRLYNVLRQ 704

 Score = 64.7 bits (156), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 114/523 (21%), Positives = 205/523 (39%), Gaps = 108/523 (20%)

Query: 78  AEVSYLHYHDETNL----LAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVT--- 130
           A +S + +H E N     LA+G  +G IKVWDL+ ++   T   H +A+  + F VT   
Sbjct: 144 ATISSVKFHGELNSEIWKLASGDTNGMIKVWDLVKRNCQCTIQEHTTAVRGLDFRVTDEE 203

Query: 131 -GT-RLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI----WCEGEDWLVSTSKDGLI 184
            GT +L+SG RD+ + +++  S    YKL      I  +    + +  D + S     + 
Sbjct: 204 KGTLQLLSGGRDNILNLFEFNS-TKKYKLLKTIPVIEQVESCGFTQDPDVVYSAGGGAIY 262

Query: 185 KIWDLKVQQCIETHIAHTGECWAMGVHEDLLITSG-------ADTQLKLWNLDFSKEAGS 237
           ++  L   + ++       E + +G    L I +G       +D  L L +++ + ++ S
Sbjct: 263 QLVSLSTGRVLKKTAKPIEELFIIGT---LCILNGTKQYLVFSDQTLFLIDVESALQSES 319

Query: 238 KLIEKGVYDKQSKQRGL--DIKF--------SVAPNGTAFFYIQNADKTTEVFRIRREEE 287
           ++IE  V +K +   G   DI+F        ++A N      I     + E F     +E
Sbjct: 320 EVIE--VENKIAGNHGTIADIRFVGPKRDKLALATNSPTLRIIPTPTSSEEEFENGENKE 377

Query: 288 I----SKAXXXXXXXXXXXGMTDEEIQQNIKESYSSIIM----------HPF-QVIKSQY 332
                 K              T + +         S+I+          +P+ + +    
Sbjct: 378 TFPIEVKMYEGHTDLLNSLDATADGLWVATASKDHSVILWRYHAKYEDFYPYTKFVGHVG 437

Query: 333 KIKSVSFTTVSNTKLEFVVTTSSN--SIEYYSIPYEKRDPTSPAPTRLYTIELP-----G 385
            + +V    V        + T+SN  +I+ + +P      TS  P  L  ++        
Sbjct: 438 SVNAVGLPNVMPRSWPEFIITASNDLTIKKWKVP----KVTSDEPEDLILVKTSEYTRRA 493

Query: 386 HRTDIRSVDISDDDKLLATAS-----------------------NGL------------- 409
           H  DI ++ IS +D L ATAS                        GL             
Sbjct: 494 HEKDINAISISPNDSLFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLA 553

Query: 410 -------LKVWNLKTKACIRVFD--CGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTL 460
                  +K+W+L++ A ++  +        C F+     +I    +G + ++DL++   
Sbjct: 554 TCSGDKTIKIWSLESYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGES 613

Query: 461 LENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEED 503
           ++   DAH   IW+L + +DG   VT  AD   +FW    EE+
Sbjct: 614 VKTL-DAHNNRIWALAVMNDGESFVTADADGFFEFWRDNSEEE 655

 Score = 64.7 bits (156), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 73/177 (41%), Gaps = 16/177 (9%)

Query: 462 ENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHD 521
           E    AHE  I ++ I+ +     T S DKT K WN    E                   
Sbjct: 488 EYTRRAHEKDINAISISPNDSLFATASYDKTCKIWNLDDGE----------------FQA 531

Query: 522 TTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDS 581
           T       +  V     DK LA    D T+K++ L+S     +L GH   V        +
Sbjct: 532 TLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLESYAVVKTLEGHTNAVQRCSFINKN 591

Query: 582 KLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYW 638
           K +I++ AD  + IW L  G+  K+L AH + I  +  + +  +F ++  DG  ++W
Sbjct: 592 KQLISTGADGLVIIWDLSTGESVKTLDAHNNRIWALAVMNDGESFVTADADGFFEFW 648

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 65/141 (46%), Gaps = 15/141 (10%)

Query: 49  IWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLS 108
           IW++  GE  + L++               +V++  Y     LLA    D TIK+W L S
Sbjct: 521 IWNLDDGEFQATLAN---------HKRGLWDVAFCQYD---KLLATCSGDKTIKIWSLES 568

Query: 109 KSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAI--SG 166
            +V+ T  GH +A+    F     +LIS   D  +I+WDL +   +  L +H + I    
Sbjct: 569 YAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNRIWALA 628

Query: 167 IWCEGEDWLVSTSKDGLIKIW 187
           +  +GE + V+   DG  + W
Sbjct: 629 VMNDGESF-VTADADGFFEFW 648

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/214 (21%), Positives = 91/214 (42%), Gaps = 25/214 (11%)

Query: 477 ITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRIS 536
           ++ DGR L T   DK           ++V   + +     +++H    E  +D+ ++ ++
Sbjct: 25  VSEDGRLLATSVVDKI----------NIVSLDSPR-----RVLHSVDTEDEQDITALHLT 69

Query: 537 PEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW 596
           P+  +L        ++V+ L   +   S+     PV  ++    S L+     D ++ + 
Sbjct: 70  PDGSYLCFVSQAQLLRVYSLKQERIIRSMKISS-PVYVMNCDQTSTLLAIGGTDGSVSVI 128

Query: 597 GLDFGDCHKSLFAHQDSIMNVKFLPESHN----FFSSSKDGLVKYWDGDKFECIQKLAAH 652
            ++ G    SL  H  +I +VKF  E ++      S   +G++K WD  K  C   +  H
Sbjct: 129 DIENGYVTHSLKGHGATISSVKFHGELNSEIWKLASGDTNGMIKVWDLVKRNCQCTIQEH 188

Query: 653 QSEV----WSIAITSDGT-SVISASHDHSLRVWE 681
            + V    + +     GT  ++S   D+ L ++E
Sbjct: 189 TTAVRGLDFRVTDEEKGTLQLLSGGRDNILNLFE 222

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 61/120 (50%), Gaps = 10/120 (8%)

Query: 72  VKSSKPAEVSYLHYHDETN-LLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKF--- 127
           ++S K +   Y+   D+T+ LLA G  DG++ V D+ +  V  +  GH + I+ +KF   
Sbjct: 95  IRSMKISSPVYVMNCDQTSTLLAIGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFHGE 154

Query: 128 -DVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVSTSKDGLIKI 186
            +    +L SG  +  I VWDLV       ++ H  A+ G+     D+ V+  + G +++
Sbjct: 155 LNSEIWKLASGDTNGMIKVWDLVKRNCQCTIQEHTTAVRGL-----DFRVTDEEKGTLQL 209

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 75/167 (44%), Gaps = 16/167 (9%)

Query: 41  TSALENINIWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGT 100
           TS ++ INI        +S+ S      S+D +  +  +++ LH   + + L        
Sbjct: 34  TSVVDKINI--------VSLDSPRRVLHSVDTEDEQ--DITALHLTPDGSYLCFVSQAQL 83

Query: 101 IKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSH 160
           ++V+ L  + ++ +     S + VM  D T T L  G  D ++ V D+ +    + L+ H
Sbjct: 84  LRVYSLKQERIIRSMK-ISSPVYVMNCDQTSTLLAIGGTDGSVSVIDIENGYVTHSLKGH 142

Query: 161 KDAISGIWCEGE----DW-LVSTSKDGLIKIWDLKVQQCIETHIAHT 202
              IS +   GE     W L S   +G+IK+WDL  + C  T   HT
Sbjct: 143 GATISSVKFHGELNSEIWKLASGDTNGMIKVWDLVKRNCQCTIQEHT 189

>KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {ON}
           Anc_8.544 YBR198C
          Length = 817

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 71/295 (24%), Positives = 131/295 (44%), Gaps = 40/295 (13%)

Query: 389 DIRSVDISDDDKLLATA-SNGLLKVWNLKTKACIRVFDCGYALTCKFLPGGTLVIVGTRE 447
           D+ S++ SDD +L A    +  +K+W+L           G +L    +P         + 
Sbjct: 484 DMTSLEFSDDSRLAAAGFQDSYIKLWSLD----------GSSLISNKIPS-------YKR 526

Query: 448 GSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPG 507
             ++  D A+STL+      H  +++S   + D R L++GS DKT++ W+      LV  
Sbjct: 527 KEMETTDPATSTLI-----GHSGSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALV-- 579

Query: 508 TADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYG 567
                         +    N  V  V+ SP   + A +  D T +++  D +       G
Sbjct: 580 --------------SYKGHNHPVWDVKFSPLGHYFATASHDQTARLWSCDHIYPLRIFAG 625

Query: 568 HKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFF 627
           H   V ++    +   + T S+DK  ++W +  GD  +  + H   I++    P+     
Sbjct: 626 HLSDVDTVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRYFWVHTAPILSTVVTPDGRWLC 685

Query: 628 SSSKDGLVKYWDGDKFECIQKLAAH-QSEVWSIAITSDGTSVISASHDHSLRVWE 681
           + S DGL+  WD    + I+++  H ++ V S+ +  +G  ++S   DHS+RVW+
Sbjct: 686 TGSDDGLINLWDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVWD 740

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 84/192 (43%), Gaps = 24/192 (12%)

Query: 516 MKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFL------------ 563
           M   H+T    N D+ S+  S + +  A    D+ +K++ LD                  
Sbjct: 475 MYTFHNT----NRDMTSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLISNKIPSYKRKEME 530

Query: 564 -------SLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMN 616
                  +L GH   V S   S DS+ +++ S DK +++W LD      S   H   + +
Sbjct: 531 TTDPATSTLIGHSGSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHNHPVWD 590

Query: 617 VKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHS 676
           VKF P  H F ++S D   + W  D    ++  A H S+V +++   +G  V + S D +
Sbjct: 591 VKFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKT 650

Query: 677 LRVWE-ETDDQV 687
            R+W+  T D V
Sbjct: 651 CRMWDISTGDSV 662

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 61/142 (42%), Gaps = 4/142 (2%)

Query: 92  LAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSE 151
            A    D T ++W       L  F GH S +  + F   G  + +GS D    +WD+ + 
Sbjct: 600 FATASHDQTARLWSCDHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDISTG 659

Query: 152 VGLYKLRSHKDAI-SGIWCEGEDWLVSTSKDGLIKIWDLKVQQCIETHIAHTGEC---WA 207
             +     H   I S +      WL + S DGLI +WD+   + I+    H         
Sbjct: 660 DSVRYFWVHTAPILSTVVTPDGRWLCTGSDDGLINLWDIGTGKRIKQMRGHGKNAVHSLT 719

Query: 208 MGVHEDLLITSGADTQLKLWNL 229
           +    ++L++ GAD  +++W+L
Sbjct: 720 LNKEGNVLLSGGADHSVRVWDL 741

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 77/159 (48%), Gaps = 9/159 (5%)

Query: 375 PTRLYTIELPGHRTDIRSVDISDDDKLLAT-ASNGLLKVWNLKTKACIRVF--DCGYALT 431
           P R++     GH +D+ +V    +   + T +S+   ++W++ T   +R F       L+
Sbjct: 619 PLRIFA----GHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRYFWVHTAPILS 674

Query: 432 CKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADK 491
               P G  +  G+ +G + L+D+ +   ++      + A+ SL +  +G  L++G AD 
Sbjct: 675 TVVTPDGRWLCTGSDDGLINLWDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADH 734

Query: 492 TIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDV 530
           +++ W+ +   +  PG   +  P +  I D T  +N+DV
Sbjct: 735 SVRVWDLKKATN-EPGLEPEQ-PFIGHIGDVTASINQDV 771

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/173 (19%), Positives = 67/173 (38%), Gaps = 22/173 (12%)

Query: 79  EVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVL-------------------LTFNGHK 119
           +++ L + D++ L AAG+ D  IK+W L   S++                    T  GH 
Sbjct: 484 DMTSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLISNKIPSYKRKEMETTDPATSTLIGHS 543

Query: 120 SAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGEDWLVST 178
            ++    F      L+SGS D  + +W L +   L   + H   +  + +     +  + 
Sbjct: 544 GSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHNHPVWDVKFSPLGHYFATA 603

Query: 179 SKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHED--LLITSGADTQLKLWNL 229
           S D   ++W       +     H  +   +  H +   + T  +D   ++W++
Sbjct: 604 SHDQTARLWSCDHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDI 656

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 56/115 (48%), Gaps = 2/115 (1%)

Query: 78  AEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISG 137
           ++V  + +H     +  G  D T ++WD+ +   +  F  H + I        G  L +G
Sbjct: 628 SDVDTVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRYFWVHTAPILSTVVTPDGRWLCTG 687

Query: 138 SRDSNIIVWDLVSEVGLYKLRSH-KDAISGIWCEGE-DWLVSTSKDGLIKIWDLK 190
           S D  I +WD+ +   + ++R H K+A+  +    E + L+S   D  +++WDLK
Sbjct: 688 SDDGLINLWDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVWDLK 742

 Score = 33.1 bits (74), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 11/60 (18%)

Query: 47  INIWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDL 106
           IN+WDI TG+ I  +           +      V  L  + E N+L +G  D +++VWDL
Sbjct: 693 INLWDIGTGKRIKQM-----------RGHGKNAVHSLTLNKEGNVLLSGGADHSVRVWDL 741

>TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8.435
           YLR222C
          Length = 835

 Score =  100 bits (250), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 62/202 (30%), Positives = 97/202 (48%), Gaps = 10/202 (4%)

Query: 484 LVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDT--TMEVNE-DVLSVRISPEDK 540
           L+T S D T+K W        VP   D++   +  I  +  T   +E D+  + ISP D 
Sbjct: 471 LITASNDLTVKKWK-------VPKPTDRFDIEIYSISSSEYTRRAHEKDINMLSISPNDS 523

Query: 541 FLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600
             A +  D T K++ L++ +   +L  HK  +  +      K I T+S DK +KIW LD 
Sbjct: 524 IFATASYDKTCKIWDLETGELKATLNNHKRGLWDVSFCQYDKFIATASGDKTVKIWSLDT 583

Query: 601 GDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIA 660
               K+L  H +++    F  +     S+  DGLVK WD    ECI  L  H + +W++ 
Sbjct: 584 FTVVKTLEGHSNAVQRCSFFNKQKQLVSTGADGLVKLWDCSTGECINTLDGHDNRIWALN 643

Query: 661 ITSDGTSVISASHDHSLRVWEE 682
           +  DG  VI+A  D   + W++
Sbjct: 644 VIKDGDIVITADADGVFQFWKD 665

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 83/173 (47%), Gaps = 4/173 (2%)

Query: 73  KSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGT 132
           + +   +++ L      ++ A    D T K+WDL +  +  T N HK  +  + F     
Sbjct: 506 RRAHEKDINMLSISPNDSIFATASYDKTCKIWDLETGELKATLNNHKRGLWDVSFCQYDK 565

Query: 133 RLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGEDWLVSTSKDGLIKIWDLKV 191
            + + S D  + +W L +   +  L  H +A+    +   +  LVST  DGL+K+WD   
Sbjct: 566 FIATASGDKTVKIWSLDTFTVVKTLEGHSNAVQRCSFFNKQKQLVSTGADGLVKLWDCST 625

Query: 192 QQCIETHIAHTGECWAMGVHE--DLLITSGADTQLKLWNLDFSKEAGSKLIEK 242
            +CI T   H    WA+ V +  D++IT+ AD   + W  D ++EA  + IEK
Sbjct: 626 GECINTLDGHDNRIWALNVIKDGDIVITADADGVFQFWK-DRTEEAREEDIEK 677

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 81/189 (42%), Gaps = 19/189 (10%)

Query: 450 LQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTA 509
           ++++ ++SS   E    AHE  I  L I+ +     T S DKT K W+ +  E       
Sbjct: 494 IEIYSISSS---EYTRRAHEKDINMLSISPNDSIFATASYDKTCKIWDLETGE------- 543

Query: 510 DKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHK 569
                    +  T       +  V     DKF+A +  D TVK++ LD+     +L GH 
Sbjct: 544 ---------LKATLNNHKRGLWDVSFCQYDKFIATASGDKTVKIWSLDTFTVVKTLEGHS 594

Query: 570 LPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSS 629
             V         K ++++ AD  +K+W    G+C  +L  H + I  +  + +     ++
Sbjct: 595 NAVQRCSFFNKQKQLVSTGADGLVKLWDCSTGECINTLDGHDNRIWALNVIKDGDIVITA 654

Query: 630 SKDGLVKYW 638
             DG+ ++W
Sbjct: 655 DADGVFQFW 663

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 79/174 (45%), Gaps = 4/174 (2%)

Query: 332 YKIKSVSFTTVSNTKLEFVVTTSSNSIEYYSIPYEKRDPTSPAPTRLYTIELPGHRTDIR 391
           Y I S  +T  ++ K   +++ S N   + +  Y+K        T      L  H+  + 
Sbjct: 497 YSISSSEYTRRAHEKDINMLSISPNDSIFATASYDKTCKIWDLETGELKATLNNHKRGLW 556

Query: 392 SVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFD--CGYALTCKFLPGGTLVIVGTREG 448
            V     DK +ATAS +  +K+W+L T   ++  +        C F      ++    +G
Sbjct: 557 DVSFCQYDKFIATASGDKTVKIWSLDTFTVVKTLEGHSNAVQRCSFFNKQKQLVSTGADG 616

Query: 449 SLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEE 502
            ++L+D ++   + N  D H+  IW+L++  DG  ++T  AD   +FW  + EE
Sbjct: 617 LVKLWDCSTGECI-NTLDGHDNRIWALNVIKDGDIVITADADGVFQFWKDRTEE 669

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 71/139 (51%), Gaps = 14/139 (10%)

Query: 65  LPAGSIDVKSSKPAEVSYLHYHDETN-LLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAIT 123
           L  G I VKS K +  SY+   D T+ LLA G  DG++ V D+ +  +  +  GH + I+
Sbjct: 102 LSTGKI-VKSMKISSPSYVLETDPTSTLLAIGGTDGSVTVIDIENGYITHSLKGHGATIS 160

Query: 124 VMKF---DVTGTRLIS-GSRDSNIIVWDLVSEVGLYKLRSHKDAISGI--------WCEG 171
            +KF     T T L+S G  +  + +WDLVS   ++ L+ H  A+ GI          E 
Sbjct: 161 SLKFYGEQHTNTWLLSSGDTNGMVKIWDLVSRKAIHTLQEHNSAVRGIDFKLIEKKNSED 220

Query: 172 EDWLVSTSKDGLIKIWDLK 190
              L++ ++D +I  W+ K
Sbjct: 221 SLQLITGARDDVINHWEFK 239

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 71/155 (45%), Gaps = 19/155 (12%)

Query: 49  IWDIKTGELISVLSD---GLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWD 105
           IWD++TGEL + L++   GL             +VS+  Y      +A    D T+K+W 
Sbjct: 536 IWDLETGELKATLNNHKRGL------------WDVSFCQYD---KFIATASGDKTVKIWS 580

Query: 106 LLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAIS 165
           L + +V+ T  GH +A+    F     +L+S   D  + +WD  +   +  L  H + I 
Sbjct: 581 LDTFTVVKTLEGHSNAVQRCSFFNKQKQLVSTGADGLVKLWDCSTGECINTLDGHDNRIW 640

Query: 166 GI-WCEGEDWLVSTSKDGLIKIWDLKVQQCIETHI 199
            +   +  D +++   DG+ + W  + ++  E  I
Sbjct: 641 ALNVIKDGDIVITADADGVFQFWKDRTEEAREEDI 675

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/179 (21%), Positives = 76/179 (42%), Gaps = 12/179 (6%)

Query: 517 KLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSID 576
           +++H    +  +++ ++ ++P+ ++L        +K+F L + K   S+     P   ++
Sbjct: 63  QILHKIENDDEQEITALALTPDAQYLCYVSQAQLLKIFKLSTGKIVKSMKISS-PSYVLE 121

Query: 577 ISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHN----FFSSSKD 632
               S L+     D ++ +  ++ G    SL  H  +I ++KF  E H       S   +
Sbjct: 122 TDPTSTLLAIGGTDGSVTVIDIENGYITHSLKGHGATISSLKFYGEQHTNTWLLSSGDTN 181

Query: 633 GLVKYWDGDKFECIQKLAAHQSEVWSIAI-------TSDGTSVISASHDHSLRVWEETD 684
           G+VK WD    + I  L  H S V  I         + D   +I+ + D  +  WE  D
Sbjct: 182 GMVKIWDLVSRKAIHTLQEHNSAVRGIDFKLIEKKNSEDSLQLITGARDDVINHWEFKD 240

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 42/84 (50%), Gaps = 7/84 (8%)

Query: 82  YLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVT-------GTRL 134
           Y   H  T LL++G  +G +K+WDL+S+  + T   H SA+  + F +          +L
Sbjct: 165 YGEQHTNTWLLSSGDTNGMVKIWDLVSRKAIHTLQEHNSAVRGIDFKLIEKKNSEDSLQL 224

Query: 135 ISGSRDSNIIVWDLVSEVGLYKLR 158
           I+G+RD  I  W+      L + +
Sbjct: 225 ITGARDDVINHWEFKDVTNLKRCK 248

>NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363
          Length = 621

 Score = 97.4 bits (241), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 84/315 (26%), Positives = 134/315 (42%), Gaps = 83/315 (26%)

Query: 390 IRSVDISDDDKLLAT-ASNGLLKVWNLKTKACIRVFDCGYALTCKFLPGGTLVIVGTREG 448
           IRS+  S D + LAT A + L+++WN+K +  + V                         
Sbjct: 344 IRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLK----------------------- 380

Query: 449 SLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGT 508
                              HE  I+SLD   DG++LV+GS D++I+ W      DL  G 
Sbjct: 381 ------------------GHEQDIYSLDYFPDGQKLVSGSGDRSIRIW------DLKTGQ 416

Query: 509 ADKYLPVMKLIHDTTMEVNEDVLSVRISP-EDKFLAISLLDNTVKVFYLDSMKFFL---- 563
                         T+ + + V +V +SP E K +A   LD +V+++  DS   FL    
Sbjct: 417 CS-----------LTLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIW--DSSTGFLVERL 463

Query: 564 -----SLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLD-----FGDCHKSLFAHQDS 613
                S  GH+  V S+  + D + +++ S D+ +K+W L       G C  +   H+D 
Sbjct: 464 DSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDF 523

Query: 614 IMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITS----DGTS-- 667
           +++V    +    FS SKD  V  WD D    I  L  H++ V S+A  +    DG +  
Sbjct: 524 VLSVATSNDDKYIFSGSKDRGVIIWDKDSGNPILMLQGHRNSVISVATVNSNVDDGKNYK 583

Query: 668 -VISASHDHSLRVWE 681
              + S D   R+W+
Sbjct: 584 LFATGSGDCKARIWK 598

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 113/232 (48%), Gaps = 15/232 (6%)

Query: 468 HETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEE---DLVPGTADKYLPVMKLIHDTTM 524
           H++ +  +  + DG+ L TG  ++T + ++    E    L+  T +  +      ++ T+
Sbjct: 278 HDSVVCCVKFSQDGKYLATG-CNRTTQIFDVATGELYVKLLDDTVNTAIVTTTTENNETV 336

Query: 525 EVNED--VLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSK 582
               D  + S+  SP+ +FLA    D  ++++ +   K  + L GH+  + S+D   D +
Sbjct: 337 TTTADLYIRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQ 396

Query: 583 LIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSS-SKDGLVKYWDGD 641
            +++ S D++I+IW L  G C  +L + +D +  V   P      ++ S D  V+ WD  
Sbjct: 397 KLVSGSGDRSIRIWDLKTGQCSLTL-SIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDSS 455

Query: 642 KFECIQKL-------AAHQSEVWSIAITSDGTSVISASHDHSLRVWEETDDQ 686
               +++L         HQ  V+S+A T DG  V+S S D ++++W   D Q
Sbjct: 456 TGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQ 507

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 67/245 (27%), Positives = 119/245 (48%), Gaps = 29/245 (11%)

Query: 377 RLYTIELPGHRTDIRSVD-ISDDDKLLATASNGLLKVWNLKTKACIRVFDCGYALTCKFL 435
           R   + L GH  DI S+D   D  KL++ + +  +++W+LKT  C         +T   +
Sbjct: 373 RKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWDLKTGQCSLTLSIEDGVTTVAV 432

Query: 436 -PG-GTLVIVGTREGSLQLFDLASSTLLENKE------DAHETAIWSLDITSDGRRLVTG 487
            P  G L+  G+ + S++++D ++  L+E  +      + H+ +++S+  T DG+ +V+G
Sbjct: 433 SPNEGKLIAAGSLDRSVRIWDSSTGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVVSG 492

Query: 488 SADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLL 547
           S D+T+K WN     D   GT    +        T +   + VLSV  S +DK++     
Sbjct: 493 SLDRTVKLWNLG---DTQSGTGKCEV--------TYIGHKDFVLSVATSNDDKYIFSGSK 541

Query: 548 DNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSAD--KNIKIWGLDFGDCHK 605
           D  V ++  DS    L L GH+  V+S+         + S+ D  KN K++    GDC  
Sbjct: 542 DRGVIIWDKDSGNPILMLQGHRNSVISV-------ATVNSNVDDGKNYKLFATGSGDCKA 594

Query: 606 SLFAH 610
            ++ +
Sbjct: 595 RIWKY 599

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 55/238 (23%), Positives = 104/238 (43%), Gaps = 31/238 (13%)

Query: 23  CVWMSPESKKSNSPGSVITSALENINIWDIKTGELISVLSDGLPAGSIDVKSSKPAE--- 79
           CV  S + K       + T       I+D+ TGEL   L D     +I   +++  E   
Sbjct: 284 CVKFSQDGKY------LATGCNRTTQIFDVATGELYVKLLDDTVNTAIVTTTTENNETVT 337

Query: 80  ------VSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTR 133
                 +  + +  +   LA G  D  I++W++  + +++   GH+  I  + +   G +
Sbjct: 338 TTADLYIRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQK 397

Query: 134 LISGSRDSNIIVWDLVSEVGLYKLR-SHKDAISGIWC---EGEDWLVSTSKDGLIKIWDL 189
           L+SGS D +I +WDL  + G   L  S +D ++ +     EG+  + + S D  ++IWD 
Sbjct: 398 LVSGSGDRSIRIWDL--KTGQCSLTLSIEDGVTTVAVSPNEGK-LIAAGSLDRSVRIWDS 454

Query: 190 KVQQCI-------ETHIAHTGECWAMGVHED--LLITSGADTQLKLWNLDFSKEAGSK 238
                +       E+   H    +++   +D   +++   D  +KLWNL  ++    K
Sbjct: 455 STGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQSGTGK 512

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 84/191 (43%), Gaps = 22/191 (11%)

Query: 10  QASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISVLSDGLPAGS 69
           Q S+   I      V +SP   K  + GS+  S    + IWD  TG L+  L     +G+
Sbjct: 416 QCSLTLSIEDGVTTVAVSPNEGKLIAAGSLDRS----VRIWDSSTGFLVERLDSDNESGN 471

Query: 70  IDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLL-----SKSVLLTFNGHKSAITV 124
               S     V  + +  +   + +G +D T+K+W+L      +    +T+ GHK  +  
Sbjct: 472 GHQDS-----VYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLS 526

Query: 125 MKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWC------EGEDW--LV 176
           +        + SGS+D  +I+WD  S   +  L+ H++++  +        +G+++    
Sbjct: 527 VATSNDDKYIFSGSKDRGVIIWDKDSGNPILMLQGHRNSVISVATVNSNVDDGKNYKLFA 586

Query: 177 STSKDGLIKIW 187
           + S D   +IW
Sbjct: 587 TGSGDCKARIW 597

>AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR198C
           (TAF5)
          Length = 815

 Score = 97.4 bits (241), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 73/294 (24%), Positives = 131/294 (44%), Gaps = 34/294 (11%)

Query: 406 SNGLLKVWNLKTKA---CIRVF-DCGYALTC-KFLPGGTLVIVGTREGSLQLFDLAS--- 457
           S   +K+ NL+T A   C+  F +    +TC +F     LV  G ++  ++L+ L     
Sbjct: 462 SRDAIKMDNLQTSAPSVCMYTFHNTNREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPL 521

Query: 458 -STLLENKEDA--------HETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGT 508
            S L    +DA        H   ++S+  + D R LV+ S DKT++ W+      LV   
Sbjct: 522 ESQLPSKAKDASNTVTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLV--- 578

Query: 509 ADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGH 568
                        +    N  V  V+ SP   + A    D T +++  D +       GH
Sbjct: 579 -------------SYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWSCDHIYPLRIFAGH 625

Query: 569 KLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFS 628
              V  +    +   ++T S+DK  ++W +  GD  +    H  S+++V   P+     +
Sbjct: 626 LNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTT 685

Query: 629 SSKDGLVKYWDGDKFECIQKLAAH-QSEVWSIAITSDGTSVISASHDHSLRVWE 681
            S+DG++  WD    + I+++  H +S V+S++   +G  ++S   D S+RVW+
Sbjct: 686 GSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWD 739

 Score = 91.3 bits (225), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 52/188 (27%), Positives = 91/188 (48%), Gaps = 18/188 (9%)

Query: 516 MKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKF-------------F 562
           M   H+T    N ++  +R S + + +A    D+ +K++ LD                  
Sbjct: 480 MYTFHNT----NREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNT 535

Query: 563 LSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE 622
           ++L GH  PV S+  S D++ ++++S DK +++W LD   C  S   H   + +VKF P 
Sbjct: 536 VTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPL 595

Query: 623 SHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWE- 681
            H F + S D   + W  D    ++  A H ++V  +    +GT V++ S D + R+W+ 
Sbjct: 596 GHYFATGSHDQTARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDI 655

Query: 682 ETDDQVFL 689
           +T D V L
Sbjct: 656 QTGDSVRL 663

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/224 (23%), Positives = 105/224 (46%), Gaps = 23/224 (10%)

Query: 380 TIELPGHRTDIRSVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFDCGYALTC---KFL 435
           T+ L GH   + SV  S D++ L +AS +  +++W+L T  C+  +  G+       KF 
Sbjct: 535 TVTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYK-GHNHPVWDVKFS 593

Query: 436 PGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKF 495
           P G     G+ + + +L+       L      H   +  +    +G  ++TGS+DKT + 
Sbjct: 594 PLGHYFATGSHDQTARLWSCDHIYPLRIFA-GHLNDVDCVTFHPNGTYVLTGSSDKTCRM 652

Query: 496 WNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFY 555
           W+ Q  + +           + L H  +      V+SV +SP+ ++L     D  + V+ 
Sbjct: 653 WDIQTGDSVR----------LFLGHTAS------VVSVAVSPDGRWLTTGSEDGVIIVWD 696

Query: 556 LDSMKFFLSLYGH-KLPVLSIDISFDSKLIITSSADKNIKIWGL 598
           + + K    + GH K  V S+  + +  ++++  AD+++++W L
Sbjct: 697 IGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDL 740

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 58/114 (50%), Gaps = 2/114 (1%)

Query: 79  EVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGS 138
           +V  + +H     +  G  D T ++WD+ +   +  F GH +++  +     G  L +GS
Sbjct: 628 DVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGS 687

Query: 139 RDSNIIVWDLVSEVGLYKLRSH-KDAISGIWCEGE-DWLVSTSKDGLIKIWDLK 190
            D  IIVWD+ +   + ++R H K A+  +    E + LVS   D  +++WDLK
Sbjct: 688 EDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDLK 741

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/281 (18%), Positives = 111/281 (39%), Gaps = 22/281 (7%)

Query: 78  AEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISG 137
             V  + +  +   L +   D T+++W L + + L+++ GH   +  +KF   G    +G
Sbjct: 543 GPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATG 602

Query: 138 SRDSNIIVWDLVSEVGLYKLRSHKDAISGIWC----EGEDWLVSTSKDGLIKIWDLKVQQ 193
           S D    +W   S   +Y LR     ++ + C        ++++ S D   ++WD++   
Sbjct: 603 SHDQTARLW---SCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGD 659

Query: 194 CIETHIAHTGECWAMGVHED--LLITSGADTQLKLWNLDFSKEAGSKLIEKGVYDKQSKQ 251
            +   + HT    ++ V  D   L T   D  + +W++   K             KQ + 
Sbjct: 660 SVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRI-----------KQMRG 708

Query: 252 RGLDIKFSVAPNGTAFFYIQ-NADKTTEVFRIRREEEISKAXXXXXXXXXXXGMTDEEIQ 310
            G    +S++ N      +   AD++  V+ +++      +           G  +  + 
Sbjct: 709 HGKSAVYSLSFNKEGNILVSGGADQSVRVWDLKKFTN-EPSLEPEQPYSGYLGDMEASVN 767

Query: 311 QNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVV 351
           Q++KE      + P Q + + +  K     TV  T+   V+
Sbjct: 768 QDVKEYGRRRTVFPTQDLMASFHTKKTPIYTVKFTRTNLVL 808

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 76/162 (46%), Gaps = 15/162 (9%)

Query: 375 PTRLYTIELPGHRTDIRSVDISDDDK-LLATASNGLLKVWNLKTKACIRVF--DCGYALT 431
           P R++     GH  D+  V    +   +L  +S+   ++W+++T   +R+F       ++
Sbjct: 618 PLRIFA----GHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVS 673

Query: 432 CKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADK 491
               P G  +  G+ +G + ++D+ +   ++      ++A++SL    +G  LV+G AD+
Sbjct: 674 VAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQ 733

Query: 492 TIKFWN---FQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDV 530
           +++ W+   F  E  L P       P    + D    VN+DV
Sbjct: 734 SVRVWDLKKFTNEPSLEPEQ-----PYSGYLGDMEASVNQDV 770

 Score = 40.0 bits (92), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 54/135 (40%), Gaps = 16/135 (11%)

Query: 112 LLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSH-KDAISGIWCE 170
           + TF+     +T ++F      + +G +DS I +W L       +L S  KDA + +   
Sbjct: 480 MYTFHNTNREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLI 539

Query: 171 GED-------------WLVSTSKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHE--DLL 215
           G               +LVS S+D  +++W L    C+ ++  H    W +         
Sbjct: 540 GHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYF 599

Query: 216 ITSGADTQLKLWNLD 230
            T   D   +LW+ D
Sbjct: 600 ATGSHDQTARLWSCD 614

>KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON}
           uniprot|P56094 Kluyveromyces lactis KLLA0F10263g TUP1
           Transcriptional repressor TUP1
          Length = 682

 Score = 97.1 bits (240), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 72/276 (26%), Positives = 127/276 (46%), Gaps = 41/276 (14%)

Query: 428 YALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTG 487
           Y  +  F P G  +  G  +  ++++DL +  ++   +  HE  I+SLD    G +LV+G
Sbjct: 408 YIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLK-GHEQDIYSLDYFPSGNKLVSG 466

Query: 488 SADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISP-EDKFLAISL 546
           S D+T++ W      DL  GT              T+ + + V +V +SP E KF+A   
Sbjct: 467 SGDRTVRIW------DLTTGTC-----------SLTLSIEDGVTTVAVSPGEGKFIAAGS 509

Query: 547 LDNTVKVFYLDSMKFFLSL-------YGHKLPVLSIDISFDSKLIITSSADKNIKIWGLD 599
           LD TV+V+  D+      L        GH+  V S+  + D K +++ S D+++K+W L+
Sbjct: 510 LDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLN 569

Query: 600 -------FGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAH 652
                    +C  +   H+D +++V          S SKD  V +WD      +  L  H
Sbjct: 570 GLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGH 629

Query: 653 QSEVWSIAITSDGTSV-------ISASHDHSLRVWE 681
           ++ V S+ + ++G  +        + S D   R+W+
Sbjct: 630 RNSVISVTV-ANGHPLGPEYGVFATGSGDCKARIWK 664

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 68/271 (25%), Positives = 127/271 (46%), Gaps = 38/271 (14%)

Query: 390 IRSVDISDDDKLLAT-ASNGLLKVWNLKTKACIRVFDCG----YALTCKFLPGGTLVIVG 444
           IRSV  S D K LAT A + L+++W+L+TK  +          Y+L   + P G  ++ G
Sbjct: 409 IRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSL--DYFPSGNKLVSG 466

Query: 445 TREGSLQLFDLASST--LLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEE 502
           + + +++++DL + T  L  + ED   T   S     +G+ +  GS D+T++ W+     
Sbjct: 467 SGDRTVRIWDLTTGTCSLTLSIEDGVTTVAVS---PGEGKFIAAGSLDRTVRVWD----- 518

Query: 503 DLVPGTADKYLPVMKLIHDTTMEVN--EDVLSVRISPEDKFLAISLLDNTVKVFYLDSM- 559
                 +D    V +L  +  +     + V SV  + + K +    LD +VK++ L+ + 
Sbjct: 519 ------SDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLNGLS 572

Query: 560 ------KFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDS 613
                 +  ++  GHK  VLS+  + + + I++ S D+ +  W    G+    L  H++S
Sbjct: 573 GQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNS 632

Query: 614 IMNVKFL------PESHNFFSSSKDGLVKYW 638
           +++V         PE   F + S D   + W
Sbjct: 633 VISVTVANGHPLGPEYGVFATGSGDCKARIW 663

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 105/236 (44%), Gaps = 24/236 (10%)

Query: 376 TRLYTIELPGHRTDIRSVD-ISDDDKLLATASNGLLKVWNLKTKACIRVFDCGYALTCKF 434
           T+   + L GH  DI S+D     +KL++ + +  +++W+L T  C         +T   
Sbjct: 437 TKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLTTGTCSLTLSIEDGVTTVA 496

Query: 435 L-PG-GTLVIVGTREGSLQLFDLASSTLLENKED------AHETAIWSLDITSDGRRLVT 486
           + PG G  +  G+ + +++++D  +  L+E  +        H  +++S+  T DG+ +V+
Sbjct: 497 VSPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVS 556

Query: 487 GSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISL 546
           GS D+++K WN      L    +     V    H       + VLSV  +  D+++    
Sbjct: 557 GSLDRSVKLWNL---NGLSGQKSHAECEVTYTGH------KDFVLSVATTQNDEYILSGS 607

Query: 547 LDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKL------IITSSADKNIKIW 596
            D  V  +   S    L L GH+  V+S+ ++    L        T S D   +IW
Sbjct: 608 KDRGVLFWDTKSGNPLLMLQGHRNSVISVTVANGHPLGPEYGVFATGSGDCKARIW 663

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 75/152 (49%), Gaps = 14/152 (9%)

Query: 91  LLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVS 150
            LA G  D  I++WDL +K +++T  GH+  I  + +  +G +L+SGS D  + +WDL +
Sbjct: 420 FLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLTT 479

Query: 151 EVGLYKLRSHKDAISGIWC---EGEDWLVSTSKDGLIKIWDLKVQQCIET-------HIA 200
                 L S +D ++ +     EG+ ++ + S D  +++WD      +E           
Sbjct: 480 GTCSLTL-SIEDGVTTVAVSPGEGK-FIAAGSLDRTVRVWDSDTGFLVERLDSENELGTG 537

Query: 201 HTGECWAMGVHED--LLITSGADTQLKLWNLD 230
           H    +++    D   +++   D  +KLWNL+
Sbjct: 538 HRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLN 569

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 89/204 (43%), Gaps = 36/204 (17%)

Query: 47  INIWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDL 106
           I IWD++T +++  L                 ++  L Y    N L +G  D T+++WDL
Sbjct: 430 IRIWDLETKKIVMTLK------------GHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDL 477

Query: 107 LSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLR-------- 158
            + +  LT +      TV      G  + +GS D  + VWD  S+ G    R        
Sbjct: 478 TTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWD--SDTGFLVERLDSENELG 535

Query: 159 -SHKDAI-SGIWCEGEDWLVSTSKDGLIKIWDLKVQQCIETH----IAHTGECWAMGVHE 212
             H+D++ S ++      +VS S D  +K+W+L      ++H    + +TG       H+
Sbjct: 536 TGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLNGLSGQKSHAECEVTYTG-------HK 588

Query: 213 DLLITSGADTQLKLWNLDFSKEAG 236
           D ++ S A TQ   + L  SK+ G
Sbjct: 589 DFVL-SVATTQNDEYILSGSKDRG 611

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 60/121 (49%), Gaps = 4/121 (3%)

Query: 570 LPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSS 629
           L + S+  S D K + T + DK I+IW L+      +L  H+  I ++ + P  +   S 
Sbjct: 407 LYIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSG 466

Query: 630 SKDGLVKYWDGDKFECIQKLAAHQSEVWSIAIT-SDGTSVISASHDHSLRVWEETDDQVF 688
           S D  V+ WD     C   L+  +  V ++A++  +G  + + S D ++RVW+   D  F
Sbjct: 467 SGDRTVRIWDLTTGTCSLTLSI-EDGVTTVAVSPGEGKFIAAGSLDRTVRVWDS--DTGF 523

Query: 689 L 689
           L
Sbjct: 524 L 524

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 79/174 (45%), Gaps = 41/174 (23%)

Query: 39  VITSALENINIWDIKTGELISVLS--DGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGY 96
           V  S    + IWD+ TG     LS  DG+   ++      P E  ++         AAG 
Sbjct: 464 VSGSGDRTVRIWDLTTGTCSLTLSIEDGVTTVAV-----SPGEGKFI---------AAGS 509

Query: 97  MDGTIKVWD---------LLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWD 147
           +D T++VWD         L S++ L T  GH+ ++  + F   G  ++SGS D ++ +W+
Sbjct: 510 LDRTVRVWDSDTGFLVERLDSENELGT--GHRDSVYSVVFTRDGKGVVSGSLDRSVKLWN 567

Query: 148 LVSEVGLYKLRSHKDA-----------ISGIWCEGEDWLVSTSKDGLIKIWDLK 190
           L    GL   +SH +            +S    + +++++S SKD  +  WD K
Sbjct: 568 LN---GLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTK 618

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 69/157 (43%), Gaps = 20/157 (12%)

Query: 17  ISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISVL--SDGLPAGSIDVKS 74
           I      V +SP   K  + GS+  +    + +WD  TG L+  L   + L  G  D   
Sbjct: 488 IEDGVTTVAVSPGEGKFIAAGSLDRT----VRVWDSDTGFLVERLDSENELGTGHRD--- 540

Query: 75  SKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKS-------VLLTFNGHKSAITVMKF 127
                V  + +  +   + +G +D ++K+W+L   S         +T+ GHK  +  +  
Sbjct: 541 ----SVYSVVFTRDGKGVVSGSLDRSVKLWNLNGLSGQKSHAECEVTYTGHKDFVLSVAT 596

Query: 128 DVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAI 164
                 ++SGS+D  ++ WD  S   L  L+ H++++
Sbjct: 597 TQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSV 633

>KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.544
           YBR198C
          Length = 814

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 70/295 (23%), Positives = 125/295 (42%), Gaps = 39/295 (13%)

Query: 389 DIRSVDISDDDKLLATA-SNGLLKVWNLKTKACIRVFDCGYALTCKFLPGGTLVIVGTRE 447
           D+  ++ SDD +L AT   +  +K+W+L           G +L    LP         +E
Sbjct: 481 DMSCLEFSDDCRLAATGFQDSFIKIWSLD----------GSSLVTNKLPSYK------KE 524

Query: 448 GSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPG 507
             L   D  SS L+      H  A++S   + D + L++GS DKT++ W+      LV  
Sbjct: 525 EILTTGDETSSLLI-----GHSGAVYSTSFSPDNKFLLSGSEDKTVRLWSMDTHTTLVSY 579

Query: 508 TADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYG 567
                              N  V  V+ SP   + A +  D T +++  D +       G
Sbjct: 580 KGH----------------NHPVWDVKFSPMGHYFATASHDQTARLWSCDHIYPLRIFAG 623

Query: 568 HKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFF 627
           H   V ++    +   + T SADK  ++W +  GD  +    H   ++     P+     
Sbjct: 624 HLNDVETVSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTAPVLTTAVTPDGRWLC 683

Query: 628 SSSKDGLVKYWDGDKFECIQKLAAH-QSEVWSIAITSDGTSVISASHDHSLRVWE 681
           +  +DG++  WD    + ++++  H ++ + S +   +G  +IS   DHS+RVW+
Sbjct: 684 TGGEDGVINVWDIGTGKRLKQMRGHGKNAIHSFSFNKEGNILISGGADHSVRVWD 738

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 85/195 (43%), Gaps = 25/195 (12%)

Query: 516 MKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLS----------- 564
           M   H+T    N+D+  +  S + +  A    D+ +K++ LD      +           
Sbjct: 472 MYTFHNT----NKDMSCLEFSDDCRLAATGFQDSFIKIWSLDGSSLVTNKLPSYKKEEIL 527

Query: 565 ---------LYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 615
                    L GH   V S   S D+K +++ S DK +++W +D      S   H   + 
Sbjct: 528 TTGDETSSLLIGHSGAVYSTSFSPDNKFLLSGSEDKTVRLWSMDTHTTLVSYKGHNHPVW 587

Query: 616 NVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDH 675
           +VKF P  H F ++S D   + W  D    ++  A H ++V +++   +G  V + S D 
Sbjct: 588 DVKFSPMGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVETVSFHPNGCYVFTGSADK 647

Query: 676 SLRVWE-ETDDQVFL 689
           + R+W+  T D V L
Sbjct: 648 TCRMWDISTGDSVRL 662

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 65/143 (45%), Gaps = 6/143 (4%)

Query: 92  LAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSE 151
            A    D T ++W       L  F GH + +  + F   G  + +GS D    +WD+ + 
Sbjct: 598 FATASHDQTARLWSCDHIYPLRIFAGHLNDVETVSFHPNGCYVFTGSADKTCRMWDISTG 657

Query: 152 VGLYKLRSHKDAI--SGIWCEGEDWLVSTSKDGLIKIWDL---KVQQCIETHIAHTGECW 206
             +     H   +  + +  +G  WL +  +DG+I +WD+   K  + +  H  +    +
Sbjct: 658 DSVRLFLGHTAPVLTTAVTPDGR-WLCTGGEDGVINVWDIGTGKRLKQMRGHGKNAIHSF 716

Query: 207 AMGVHEDLLITSGADTQLKLWNL 229
           +     ++LI+ GAD  +++W+L
Sbjct: 717 SFNKEGNILISGGADHSVRVWDL 739

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 54/114 (47%), Gaps = 2/114 (1%)

Query: 79  EVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGS 138
           +V  + +H     +  G  D T ++WD+ +   +  F GH + +        G  L +G 
Sbjct: 627 DVETVSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTAPVLTTAVTPDGRWLCTGG 686

Query: 139 RDSNIIVWDLVSEVGLYKLRSH-KDAISGIWCEGE-DWLVSTSKDGLIKIWDLK 190
            D  I VWD+ +   L ++R H K+AI       E + L+S   D  +++WDLK
Sbjct: 687 EDGVINVWDIGTGKRLKQMRGHGKNAIHSFSFNKEGNILISGGADHSVRVWDLK 740

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 32/153 (20%), Positives = 60/153 (39%), Gaps = 3/153 (1%)

Query: 85  YHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNII 144
           +  +   L +G  D T+++W + + + L+++ GH   +  +KF   G    + S D    
Sbjct: 549 FSPDNKFLLSGSEDKTVRLWSMDTHTTLVSYKGHNHPVWDVKFSPMGHYFATASHDQTAR 608

Query: 145 VWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVST-SKDGLIKIWDLKVQQCIETHIAHTG 203
           +W       L     H + +  +        V T S D   ++WD+     +   + HT 
Sbjct: 609 LWSCDHIYPLRIFAGHLNDVETVSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTA 668

Query: 204 ECWAMGVHED--LLITSGADTQLKLWNLDFSKE 234
                 V  D   L T G D  + +W++   K 
Sbjct: 669 PVLTTAVTPDGRWLCTGGEDGVINVWDIGTGKR 701

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 35/174 (20%), Positives = 66/174 (37%), Gaps = 23/174 (13%)

Query: 79  EVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSV------------LLTFN--------GH 118
           ++S L + D+  L A G+ D  IK+W L   S+            +LT          GH
Sbjct: 481 DMSCLEFSDDCRLAATGFQDSFIKIWSLDGSSLVTNKLPSYKKEEILTTGDETSSLLIGH 540

Query: 119 KSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGEDWLVS 177
             A+    F      L+SGS D  + +W + +   L   + H   +  + +     +  +
Sbjct: 541 SGAVYSTSFSPDNKFLLSGSEDKTVRLWSMDTHTTLVSYKGHNHPVWDVKFSPMGHYFAT 600

Query: 178 TSKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHED--LLITSGADTQLKLWNL 229
            S D   ++W       +     H  +   +  H +   + T  AD   ++W++
Sbjct: 601 ASHDQTARLWSCDHIYPLRIFAGHLNDVETVSFHPNGCYVFTGSADKTCRMWDI 654

>Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {ON}
           similar to Ashbya gossypii AGL234W
          Length = 646

 Score = 95.9 bits (237), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 73/279 (26%), Positives = 128/279 (45%), Gaps = 43/279 (15%)

Query: 428 YALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTG 487
           Y  +  F P G  +  G  +  ++++DL+S  +L   +  HE  I+SLD    G +LV+G
Sbjct: 371 YIRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQ-GHEQDIYSLDYFPAGDKLVSG 429

Query: 488 SADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPED-KFLAISL 546
           S D+T++ W+ +  +  +                 T+ + + V +V +SP D K++A   
Sbjct: 430 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 472

Query: 547 LDNTVKVFYLDSMKFFLS---------LYGHKLPVLSIDISFDSKLIITSSADKNIKIWG 597
           LD TV+V+  DS   FL            GHK  V S+  + D + +++ S D+++K+W 
Sbjct: 473 LDRTVRVW--DSETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLWD 530

Query: 598 L-------DFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLA 650
           L           C  +   H+D +++V    +     S SKD  V +WD      +  L 
Sbjct: 531 LRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQ 590

Query: 651 AHQSEVWSIAITS------DGTSVISASHDHSLRVWEET 683
            H++ V S+A+ +      D     + S D   R+W+ T
Sbjct: 591 GHRNSVISVAVVNGFPLGPDIGVFATGSGDCKARIWKYT 629

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/231 (24%), Positives = 107/231 (46%), Gaps = 24/231 (10%)

Query: 381 IELPGHRTDIRSVD-ISDDDKLLATASNGLLKVWNLKTKACIRVFDCGYALTCKFL-PG- 437
           + L GH  DI S+D     DKL++ + +  +++W+L+T  C         +T   + PG 
Sbjct: 405 MTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGD 464

Query: 438 GTLVIVGTREGSLQLFDLASSTLLENKED------AHETAIWSLDITSDGRRLVTGSADK 491
           G  +  G+ + +++++D  +  L+E  +        H+ +++S+  T DGR +V+GS D+
Sbjct: 465 GKYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDR 524

Query: 492 TIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTV 551
           ++K W      DL      K     ++ +    +    VLSV  + +D+++     D  V
Sbjct: 525 SVKLW------DLRGLNGQKSHATCEVTYTGHKDF---VLSVATTQDDEYILSGSKDRGV 575

Query: 552 KVFYLDSMKFFLSLYGHKLPVLSIDI------SFDSKLIITSSADKNIKIW 596
             +   S    L L GH+  V+S+ +        D  +  T S D   +IW
Sbjct: 576 LFWDTASGNPLLMLQGHRNSVISVAVVNGFPLGPDIGVFATGSGDCKARIW 626

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 57/232 (24%), Positives = 101/232 (43%), Gaps = 37/232 (15%)

Query: 33  SNSPGSVITSALENINIWDIKTGELISVLSDGLPAGSIDVKSS----------------- 75
           SN    + T   +   ++ + TGEL++ LSD   +G  +  SS                 
Sbjct: 302 SNDGEYLATGCNKTTQVYKVSTGELVARLSDDSVSGINNESSSVVAGNGATEKGDESSAT 361

Query: 76  -KPAEVSYLH-----YHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDV 129
            +P   S L+     +  +   LA G  D  I++WDL SK +L+T  GH+  I  + +  
Sbjct: 362 IQPGSSSDLYIRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQGHEQDIYSLDYFP 421

Query: 130 TGTRLISGSRDSNIIVWDLVSEVGLYKLR-SHKDAISGIWCEGED--WLVSTSKDGLIKI 186
            G +L+SGS D  + +WDL    G   L  S +D ++ +     D  ++ + S D  +++
Sbjct: 422 AGDKLVSGSGDRTVRIWDL--RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRV 479

Query: 187 WDLKVQQCIET-------HIAHTGECWAMGVHED--LLITSGADTQLKLWNL 229
           WD +    +E           H    +++    D   +++   D  +KLW+L
Sbjct: 480 WDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLWDL 531

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 56/113 (49%), Gaps = 2/113 (1%)

Query: 570 LPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSS 629
           L + S+  S D K + T + DK I+IW L       +L  H+  I ++ + P      S 
Sbjct: 370 LYIRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQGHEQDIYSLDYFPAGDKLVSG 429

Query: 630 SKDGLVKYWDGDKFECIQKLAAHQSEVWSIAIT-SDGTSVISASHDHSLRVWE 681
           S D  V+ WD    +C   L+  +  V ++A++  DG  + + S D ++RVW+
Sbjct: 430 SGDRTVRIWDLRTGQCSLTLSI-EDGVTTVAVSPGDGKYIAAGSLDRTVRVWD 481

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 73/167 (43%), Gaps = 20/167 (11%)

Query: 7   RFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISVL--SDG 64
           R  Q S+   I      V +SP   K  + GS+       + +WD +TG L+  L   + 
Sbjct: 441 RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLD----RTVRVWDSETGFLVERLDSENE 496

Query: 65  LPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLS-------KSVLLTFNG 117
           L  G  D        V  + +  +   + +G +D ++K+WDL          +  +T+ G
Sbjct: 497 LSTGHKD-------SVYSVVFTRDGRSVVSGSLDRSVKLWDLRGLNGQKSHATCEVTYTG 549

Query: 118 HKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAI 164
           HK  +  +        ++SGS+D  ++ WD  S   L  L+ H++++
Sbjct: 550 HKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNSV 596

>SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 470

 Score = 94.7 bits (234), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 79/299 (26%), Positives = 134/299 (44%), Gaps = 26/299 (8%)

Query: 390 IRSVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFDCGYALTCKFL---PGGTLVIVGT 445
           +  V IS DD ++AT S  G LK+ + +T   I+ FD  +      +   P GT ++ G 
Sbjct: 185 VSQVAISSDDSMVATCSWGGDLKILSTETLEIIKAFDTAHDSKIGGVDWNPDGTALVTGA 244

Query: 446 REGSLQLFDLAS-STLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNF--QVEE 502
             G +++++L + S         HE  +  +     G+ + + S D T + W+   Q+E 
Sbjct: 245 ANGEIRIWNLNNDSESPAGTLTGHENRVARVRFHPSGKYVASASFDMTWRLWDVEKQIEL 304

Query: 503 DLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFF 562
            L  G A                  ++V  V    +   L  + LD+   V+ L S K  
Sbjct: 305 QLQEGHA------------------KEVYCVAFQKDGSLLCSTGLDSVGLVWDLRSGKSI 346

Query: 563 LSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKF-LP 621
           ++L GH  P+  +D S +   I T SAD  I++W +       +L AH   +  VKF   
Sbjct: 347 MALEGHIKPIYGLDWSPNGYDIATGSADGTIRLWDVRKVGILGALPAHNSIVSEVKFDKA 406

Query: 622 ESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVW 680
             H   SSS D  +  + GD +  +  +  H  ++ S+ I++DG+ + S+  D SL+ W
Sbjct: 407 NGHYLVSSSYDKTLNIYSGDNWTKLSVIQGHTDKILSVDISTDGSHLFSSGWDRSLKQW 465

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 86/203 (42%), Gaps = 16/203 (7%)

Query: 34  NSPGSVITSALEN--INIWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNL 91
           N  G+ + +   N  I IW++             PAG++    ++ A V    +H     
Sbjct: 234 NPDGTALVTGAANGEIRIWNLNN-------DSESPAGTLTGHENRVARV---RFHPSGKY 283

Query: 92  LAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSE 151
           +A+   D T ++WD+  +  L    GH   +  + F   G+ L S   DS  +VWDL S 
Sbjct: 284 VASASFDMTWRLWDVEKQIELQLQEGHAKEVYCVAFQKDGSLLCSTGLDSVGLVWDLRSG 343

Query: 152 VGLYKLRSHKDAISGI-WCEGEDWLVSTSKDGLIKIWDLK---VQQCIETHIAHTGECWA 207
             +  L  H   I G+ W      + + S DG I++WD++   +   +  H +   E   
Sbjct: 344 KSIMALEGHIKPIYGLDWSPNGYDIATGSADGTIRLWDVRKVGILGALPAHNSIVSEVKF 403

Query: 208 MGVHEDLLITSGADTQLKLWNLD 230
              +   L++S  D  L +++ D
Sbjct: 404 DKANGHYLVSSSYDKTLNIYSGD 426

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 106/234 (45%), Gaps = 27/234 (11%)

Query: 369 DPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLL-KVWNLKTKACIRVFDCG 427
           D  SPA T      L GH   +  V      K +A+AS  +  ++W+++ +  +++ + G
Sbjct: 257 DSESPAGT------LTGHENRVARVRFHPSGKYVASASFDMTWRLWDVEKQIELQLQE-G 309

Query: 428 YA--LTC-KFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRL 484
           +A  + C  F   G+L+     +    ++DL S   +   E  H   I+ LD + +G  +
Sbjct: 310 HAKEVYCVAFQKDGSLLCSTGLDSVGLVWDLRSGKSIMALE-GHIKPIYGLDWSPNGYDI 368

Query: 485 VTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAI 544
            TGSAD TI+ W+  V +  + G     LP    I     EV  D           +L  
Sbjct: 369 ATGSADGTIRLWD--VRKVGILGA----LPAHNSI---VSEVKFD------KANGHYLVS 413

Query: 545 SLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGL 598
           S  D T+ ++  D+      + GH   +LS+DIS D   + +S  D+++K W L
Sbjct: 414 SSYDKTLNIYSGDNWTKLSVIQGHTDKILSVDISTDGSHLFSSGWDRSLKQWSL 467

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 70/155 (45%), Gaps = 3/155 (1%)

Query: 530 VLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSL-YGHKLPVLSIDISFDSKLIITSS 588
           V  V IS +D  +A       +K+   ++++   +    H   +  +D + D   ++T +
Sbjct: 185 VSQVAISSDDSMVATCSWGGDLKILSTETLEIIKAFDTAHDSKIGGVDWNPDGTALVTGA 244

Query: 589 ADKNIKIWGL--DFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECI 646
           A+  I+IW L  D      +L  H++ +  V+F P      S+S D   + WD +K   +
Sbjct: 245 ANGEIRIWNLNNDSESPAGTLTGHENRVARVRFHPSGKYVASASFDMTWRLWDVEKQIEL 304

Query: 647 QKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWE 681
           Q    H  EV+ +A   DG+ + S   D    VW+
Sbjct: 305 QLQEGHAKEVYCVAFQKDGSLLCSTGLDSVGLVWD 339

 Score = 52.0 bits (123), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 78/168 (46%), Gaps = 6/168 (3%)

Query: 70  IDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDV 129
           + ++     EV  + +  + +LL +  +D    VWDL S   ++   GH   I  + +  
Sbjct: 304 LQLQEGHAKEVYCVAFQKDGSLLCSTGLDSVGLVWDLRSGKSIMALEGHIKPIYGLDWSP 363

Query: 130 TGTRLISGSRDSNIIVWDLVSEVG-LYKLRSHKDAISGIWCEGED--WLVSTSKDGLIKI 186
            G  + +GS D  I +WD V +VG L  L +H   +S +  +  +  +LVS+S D  + I
Sbjct: 364 NGYDIATGSADGTIRLWD-VRKVGILGALPAHNSIVSEVKFDKANGHYLVSSSYDKTLNI 422

Query: 187 WDLKVQQCIETHIAHTGECWAMGVHED--LLITSGADTQLKLWNLDFS 232
           +       +     HT +  ++ +  D   L +SG D  LK W+L  S
Sbjct: 423 YSGDNWTKLSVIQGHTDKILSVDISTDGSHLFSSGWDRSLKQWSLKIS 470

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 82/166 (49%), Gaps = 8/166 (4%)

Query: 74  SSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFN-GHKSAITVMKFDVTGT 132
           SS+P  VS +    + +++A     G +K+    +  ++  F+  H S I  + ++  GT
Sbjct: 181 SSRP--VSQVAISSDDSMVATCSWGGDLKILSTETLEIIKAFDTAHDSKIGGVDWNPDGT 238

Query: 133 RLISGSRDSNIIVWDLV--SEVGLYKLRSHKDAISGI-WCEGEDWLVSTSKDGLIKIWDL 189
            L++G+ +  I +W+L   SE     L  H++ ++ + +     ++ S S D   ++WD+
Sbjct: 239 ALVTGAANGEIRIWNLNNDSESPAGTLTGHENRVARVRFHPSGKYVASASFDMTWRLWDV 298

Query: 190 KVQQCIETHIAHTGECWAMGVHED--LLITSGADTQLKLWNLDFSK 233
           + Q  ++    H  E + +   +D  LL ++G D+   +W+L   K
Sbjct: 299 EKQIELQLQEGHAKEVYCVAFQKDGSLLCSTGLDSVGLVWDLRSGK 344

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 61/124 (49%), Gaps = 5/124 (4%)

Query: 381 IELPGHRTDIRSVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFDCGYALT--CKF-LP 436
           + L GH   I  +D S +   +AT S +G +++W+++    +       ++    KF   
Sbjct: 347 MALEGHIKPIYGLDWSPNGYDIATGSADGTIRLWDVRKVGILGALPAHNSIVSEVKFDKA 406

Query: 437 GGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFW 496
            G  ++  + + +L ++   + T L   +  H   I S+DI++DG  L +   D+++K W
Sbjct: 407 NGHYLVSSSYDKTLNIYSGDNWTKLSVIQ-GHTDKILSVDISTDGSHLFSSGWDRSLKQW 465

Query: 497 NFQV 500
           + ++
Sbjct: 466 SLKI 469

>AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR084C (TUP1)
          Length = 629

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 73/279 (26%), Positives = 127/279 (45%), Gaps = 43/279 (15%)

Query: 428 YALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTG 487
           Y  +  F P G  +  G  +  ++++DL +  +L   +  HE  I+SLD    G +LV+G
Sbjct: 354 YIRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQ-GHEQDIYSLDYFPAGDKLVSG 412

Query: 488 SADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPED-KFLAISL 546
           S D+T++ W+ +  +  +                 T+ + + V +V +SP D K++A   
Sbjct: 413 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 455

Query: 547 LDNTVKVFYLDSMKFFLS---------LYGHKLPVLSIDISFDSKLIITSSADKNIKIWG 597
           LD TV+V+  DS   FL            GHK  V S+  + D + +I+ S D+++K+W 
Sbjct: 456 LDRTVRVW--DSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWD 513

Query: 598 L-------DFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLA 650
           L           C  +   H+D +++V    +     S SKD  V +WD      +  L 
Sbjct: 514 LRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQ 573

Query: 651 AHQSEVWSIAITS------DGTSVISASHDHSLRVWEET 683
            H++ V S+A+ +      D     + S D   R+W+ T
Sbjct: 574 GHRNSVISVAVVNGFPLGPDVGVFATGSGDCKARIWKYT 612

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 100/232 (43%), Gaps = 37/232 (15%)

Query: 33  SNSPGSVITSALENINIWDIKTGELISVLSDGLPAGSIDVKSSKPAE------------- 79
           SN    + T   +   ++ + TGEL++ LSD   AG  +  S+ PA              
Sbjct: 285 SNDGEYLATGCNKTTQVYKVSTGELLARLSDDSVAGVNNEASTGPANNGTADNGGENSAT 344

Query: 80  ----------VSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDV 129
                     +  + +  +   LA G  D  I++WDL +K +L+T  GH+  I  + +  
Sbjct: 345 IQPASSSDLYIRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFP 404

Query: 130 TGTRLISGSRDSNIIVWDLVSEVGLYKLR-SHKDAISGIWCEGED--WLVSTSKDGLIKI 186
            G +L+SGS D  + +WDL    G   L  S +D ++ +     D  ++ + S D  +++
Sbjct: 405 AGDKLVSGSGDRTVRIWDL--RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRV 462

Query: 187 WDLKVQQCIET-------HIAHTGECWAMGVHED--LLITSGADTQLKLWNL 229
           WD +    +E           H    +++    D   +I+   D  +KLW+L
Sbjct: 463 WDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDL 514

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/236 (23%), Positives = 109/236 (46%), Gaps = 24/236 (10%)

Query: 376 TRLYTIELPGHRTDIRSVD-ISDDDKLLATASNGLLKVWNLKTKACIRVFDCGYALTCKF 434
           T+   + L GH  DI S+D     DKL++ + +  +++W+L+T  C         +T   
Sbjct: 383 TKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVA 442

Query: 435 L-PG-GTLVIVGTREGSLQLFDLASSTLLENKED------AHETAIWSLDITSDGRRLVT 486
           + PG G  +  G+ + +++++D  +  L+E  +        H+ +++S+  T DG+ +++
Sbjct: 443 VSPGDGKYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVIS 502

Query: 487 GSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISL 546
           GS D+++K W      DL      K     ++ +    +    VLSV  + +D+++    
Sbjct: 503 GSLDRSVKLW------DLRGLNGQKSHATCEVTYTGHKDF---VLSVATTQDDEYILSGS 553

Query: 547 LDNTVKVFYLDSMKFFLSLYGHKLPVLSIDI------SFDSKLIITSSADKNIKIW 596
            D  V  +   S    L L GH+  V+S+ +        D  +  T S D   +IW
Sbjct: 554 KDRGVLFWDTASGNPLLMLQGHRNSVISVAVVNGFPLGPDVGVFATGSGDCKARIW 609

 Score = 58.9 bits (141), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/215 (23%), Positives = 90/215 (41%), Gaps = 26/215 (12%)

Query: 468 HETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVN 527
           H + +  +  ++DG  L TG  +KT + +     E L            +L  D+   VN
Sbjct: 275 HSSVVCCVRFSNDGEYLATG-CNKTTQVYKVSTGELLA-----------RLSDDSVAGVN 322

Query: 528 EDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITS 587
            +       P +   A +  +N+  +    S   +         + S+  S D K + T 
Sbjct: 323 NEA---STGPANNGTADNGGENSATIQPASSSDLY---------IRSVCFSPDGKYLATG 370

Query: 588 SADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQ 647
           + DK I+IW L       +L  H+  I ++ + P      S S D  V+ WD    +C  
Sbjct: 371 AEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSL 430

Query: 648 KLAAHQSEVWSIAIT-SDGTSVISASHDHSLRVWE 681
            L+  +  V ++A++  DG  + + S D ++RVW+
Sbjct: 431 TLSI-EDGVTTVAVSPGDGKYIAAGSLDRTVRVWD 464

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 73/167 (43%), Gaps = 20/167 (11%)

Query: 7   RFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISVL--SDG 64
           R  Q S+   I      V +SP   K  + GS+       + +WD +TG L+  L   + 
Sbjct: 424 RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLD----RTVRVWDSETGFLVERLDSENE 479

Query: 65  LPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLS-------KSVLLTFNG 117
           L  G  D        V  + +  +   + +G +D ++K+WDL          +  +T+ G
Sbjct: 480 LSTGHKD-------SVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQKSHATCEVTYTG 532

Query: 118 HKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAI 164
           HK  +  +        ++SGS+D  ++ WD  S   L  L+ H++++
Sbjct: 533 HKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNSV 579

>TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {ON}
           Anc_6.363 YCR084C
          Length = 699

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 99/426 (23%), Positives = 168/426 (39%), Gaps = 117/426 (27%)

Query: 353 TSSNSIEYYSIPYEKR-DPTSPAPTRL----------------------YTIELP----- 384
           TS+    +Y +PY++R + T P P  L                      Y   LP     
Sbjct: 284 TSATKESHYLVPYDQRANHTKPIPPFLLDLDSQTIPAGLKKQTDDYYILYNPALPRNIDV 343

Query: 385 ------GHRTDIRSVDISDDDKLLATASNGLLKVWNLKTKACI-RVFDCG---------- 427
                  H + +  V  S+D K LAT  N   +V+N+ +   I R+ D            
Sbjct: 344 ELHKSLDHTSVVCCVRFSNDGKFLATGCNKTTQVYNVASGELIARLSDDSASHITPGQNS 403

Query: 428 -------------------------YALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLE 462
                                    Y  +  F P G  +  G  +  ++++D+A   ++ 
Sbjct: 404 KDSEGGEENNDTTTYSTSATTSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIIM 463

Query: 463 NKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDT 522
             +  HE  I+SLD    G +LV+GS D+T++ W+ +  +  +                 
Sbjct: 464 VLQ-GHEQDIYSLDYFPSGEKLVSGSGDRTVRIWDLRTGQCSL----------------- 505

Query: 523 TMEVNEDVLSVRISPED-KFLAISLLDNTVKVFYLDSMKFFLSLY---------GHKLPV 572
           T+ + + V +V +SPED K++A   LD  V+V+  DS   FL            GHK  V
Sbjct: 506 TLSIEDGVTTVAVSPEDGKYIAAGSLDRAVRVW--DSETGFLVERLDSENELGTGHKDSV 563

Query: 573 LSIDISFDSKLIITSSADKNIKIWGLD-----------FGDCHKSLFAHQDSIMNVKFLP 621
            S+  + D   +++ S D+++K+W L+            G C  +   H+D +++V    
Sbjct: 564 YSVVFTRDGNNVVSGSLDRSVKLWNLNDANNKDLKPNVPGTCEVTYTGHKDFVLSVATTQ 623

Query: 622 ESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSD---GTS---VISASHDH 675
                 S SKD  V +WD      +  L  H++ V S+A+ +    GT      + S D 
Sbjct: 624 GDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVAVANGHPLGTEYGVFATGSGDC 683

Query: 676 SLRVWE 681
             R+W+
Sbjct: 684 KARIWK 689

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 110/243 (45%), Gaps = 28/243 (11%)

Query: 468 HETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEE---DLVPGTADKYLPVMKLIHDTTM 524
           H + +  +  ++DG+ L TG  +KT + +N    E    L   +A    P          
Sbjct: 351 HTSVVCCVRFSNDGKFLATG-CNKTTQVYNVASGELIARLSDDSASHITPGQNSKDSEGG 409

Query: 525 EVNED---------------VLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHK 569
           E N D               + SV  SP+ KFLA    D  ++++ +   K  + L GH+
Sbjct: 410 EENNDTTTYSTSATTSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIIMVLQGHE 469

Query: 570 LPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSS 629
             + S+D     + +++ S D+ ++IW L  G C  +L + +D +  V   PE   + ++
Sbjct: 470 QDIYSLDYFPSGEKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPEDGKYIAA 528

Query: 630 -SKDGLVKYWDGDKFECIQKL-------AAHQSEVWSIAITSDGTSVISASHDHSLRVWE 681
            S D  V+ WD +    +++L         H+  V+S+  T DG +V+S S D S+++W 
Sbjct: 529 GSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWN 588

Query: 682 ETD 684
             D
Sbjct: 589 LND 591

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 102/232 (43%), Gaps = 36/232 (15%)

Query: 33  SNSPGSVITSALENINIWDIKTGELISVLSDGLPAGSIDVKSSKPAE------------- 79
           SN    + T   +   ++++ +GELI+ LSD   +     ++SK +E             
Sbjct: 361 SNDGKFLATGCNKTTQVYNVASGELIARLSDDSASHITPGQNSKDSEGGEENNDTTTYST 420

Query: 80  ---------VSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVT 130
                    +  + +  +   LA G  D  I++WD+  K +++   GH+  I  + +  +
Sbjct: 421 SATTSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIIMVLQGHEQDIYSLDYFPS 480

Query: 131 GTRLISGSRDSNIIVWDLVSEVGLYKLR-SHKDAISGIWCEGED--WLVSTSKDGLIKIW 187
           G +L+SGS D  + +WDL    G   L  S +D ++ +    ED  ++ + S D  +++W
Sbjct: 481 GEKLVSGSGDRTVRIWDL--RTGQCSLTLSIEDGVTTVAVSPEDGKYIAAGSLDRAVRVW 538

Query: 188 DLKVQQCIET-------HIAHTGECWAMGVHEDL--LITSGADTQLKLWNLD 230
           D +    +E           H    +++    D   +++   D  +KLWNL+
Sbjct: 539 DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLN 590

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 52/220 (23%), Positives = 89/220 (40%), Gaps = 47/220 (21%)

Query: 39  VITSALENINIWDIKTGELISVLS--DGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGY 96
           V  S    + IWD++TG+    LS  DG+   ++  +  K               +AAG 
Sbjct: 485 VSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPEDGK--------------YIAAGS 530

Query: 97  MDGTIKVWD---------LLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWD 147
           +D  ++VWD         L S++ L T  GHK ++  + F   G  ++SGS D ++ +W+
Sbjct: 531 LDRAVRVWDSETGFLVERLDSENELGT--GHKDSVYSVVFTRDGNNVVSGSLDRSVKLWN 588

Query: 148 L-----------VSEVGLYKLRSHKD-AISGIWCEGEDWLVSTSKDGLIKIWDLKVQQCI 195
           L           V          HKD  +S    +G+++++S SKD  +  WD K    +
Sbjct: 589 LNDANNKDLKPNVPGTCEVTYTGHKDFVLSVATTQGDEYILSGSKDRGVLFWDTKSGNPL 648

Query: 196 ETHIAH--------TGECWAMGVHEDLLITSGADTQLKLW 227
                H              +G    +  T   D + ++W
Sbjct: 649 LMLQGHRNSVISVAVANGHPLGTEYGVFATGSGDCKARIW 688

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 77/169 (45%), Gaps = 20/169 (11%)

Query: 7   RFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISVLSDGLP 66
           R  Q S+   I      V +SPE  K  + GS+  +    + +WD +TG L+  L     
Sbjct: 499 RTGQCSLTLSIEDGVTTVAVSPEDGKYIAAGSLDRA----VRVWDSETGFLVERLDSENE 554

Query: 67  AGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDL-----------LSKSVLLTF 115
            G+      K +  S +   D  N+++ G +D ++K+W+L           +  +  +T+
Sbjct: 555 LGT----GHKDSVYSVVFTRDGNNVVS-GSLDRSVKLWNLNDANNKDLKPNVPGTCEVTY 609

Query: 116 NGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAI 164
            GHK  +  +        ++SGS+D  ++ WD  S   L  L+ H++++
Sbjct: 610 TGHKDFVLSVATTQGDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSV 658

>CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} similar
           to uniprot|P16649 Saccharomyces cerevisiae YCR084c TUP1
           general transcription repressor
          Length = 643

 Score = 94.4 bits (233), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 86/333 (25%), Positives = 144/333 (43%), Gaps = 64/333 (19%)

Query: 375 PTRLYTIELPGHRTDIR-----SVDISDDDKLLATASNGLLKVWNLKTKACIR--VFDCG 427
           PT+   I++  HRT +       V  S++ + LAT  N   K++ + T   +   V D  
Sbjct: 301 PTQPKDIDIELHRTLLHDSVVCCVKFSNNGEYLATGCNKTTKIFEVATGNLVTELVDDTK 360

Query: 428 --------------YALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIW 473
                         Y  +  F P G  +  G  +  ++++D+A   ++      HE  I+
Sbjct: 361 TGTEDANSASSADLYIRSVCFSPDGKFLATGAEDKLIRIWDIAQRKIVMVLR-GHEQDIY 419

Query: 474 SLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSV 533
           SLD    G +LV+GS D+TI+ W      DL  G               T+ + + V +V
Sbjct: 420 SLDYFQSGNKLVSGSGDRTIRIW------DLHTGQCS-----------LTLSIEDGVTTV 462

Query: 534 RISPED-KFLAISLLDNTVKVFYLDSMKFFL---------SLYGHKLPVLSIDISFDSKL 583
            +SP +  ++A   LD TV+V+  DS   FL         +  GHK  V S+  + D K 
Sbjct: 463 AVSPGNGNYVAAGSLDRTVRVW--DSNSGFLVERLDSEGETGVGHKDSVYSVVFTRDGKN 520

Query: 584 IITSSADKNIKIWGLDF-------------GDCHKSLFAHQDSIMNVKFLPESHNFFSSS 630
           I++ S D+++K+W L               G+C  +   H+D +++V          S S
Sbjct: 521 IVSGSLDRSVKLWNLRNINGASTSPQPKTEGNCEMTYIGHKDFVLSVTTTENDQYILSGS 580

Query: 631 KDGLVKYWDGDKFECIQKLAAHQSEVWSIAITS 663
           KD  V +WD      +  L  H++ V S+A+ +
Sbjct: 581 KDRGVIFWDKVSGVPLLMLQGHRNSVISVAVAN 613

 Score = 87.0 bits (214), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 110/228 (48%), Gaps = 26/228 (11%)

Query: 468 HETAIWSLDITSDGRRLVTGSADKTIKFWNF-------QVEEDLVPGTADKYLPVMKLIH 520
           H++ +  +  +++G  L TG  +KT K +         ++ +D   GT D          
Sbjct: 317 HDSVVCCVKFSNNGEYLATG-CNKTTKIFEVATGNLVTELVDDTKTGTEDA--------- 366

Query: 521 DTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFD 580
           ++    +  + SV  SP+ KFLA    D  ++++ +   K  + L GH+  + S+D    
Sbjct: 367 NSASSADLYIRSVCFSPDGKFLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQS 426

Query: 581 SKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSS-SKDGLVKYWD 639
              +++ S D+ I+IW L  G C  +L + +D +  V   P + N+ ++ S D  V+ WD
Sbjct: 427 GNKLVSGSGDRTIRIWDLHTGQCSLTL-SIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWD 485

Query: 640 GDKFECIQKL-------AAHQSEVWSIAITSDGTSVISASHDHSLRVW 680
            +    +++L         H+  V+S+  T DG +++S S D S+++W
Sbjct: 486 SNSGFLVERLDSEGETGVGHKDSVYSVVFTRDGKNIVSGSLDRSVKLW 533

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 102/213 (47%), Gaps = 16/213 (7%)

Query: 31  KKSNSPGSVITSALENINIWDIKTGELISVLSDGLPAGSIDVKSSKPAE--VSYLHYHDE 88
           K SN+   + T   +   I+++ TG L++ L D    G+ D  S+  A+  +  + +  +
Sbjct: 325 KFSNNGEYLATGCNKTTKIFEVATGNLVTELVDDTKTGTEDANSASSADLYIRSVCFSPD 384

Query: 89  TNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDL 148
              LA G  D  I++WD+  + +++   GH+  I  + +  +G +L+SGS D  I +WDL
Sbjct: 385 GKFLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIWDL 444

Query: 149 VSEVGLYKLR-SHKDAISGIWCE--GEDWLVSTSKDGLIKIWDL-------KVQQCIETH 198
               G   L  S +D ++ +       +++ + S D  +++WD        ++    ET 
Sbjct: 445 --HTGQCSLTLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEGETG 502

Query: 199 IAHTGECWAMGVHEDL--LITSGADTQLKLWNL 229
           + H    +++    D   +++   D  +KLWNL
Sbjct: 503 VGHKDSVYSVVFTRDGKNIVSGSLDRSVKLWNL 535

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 61/236 (25%), Positives = 111/236 (47%), Gaps = 20/236 (8%)

Query: 377 RLYTIELPGHRTDIRSVD-ISDDDKLLATASNGLLKVWNLKTKACIRVFDCGYALTCKFL 435
           R   + L GH  DI S+D     +KL++ + +  +++W+L T  C         +T   +
Sbjct: 405 RKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIWDLHTGQCSLTLSIEDGVTTVAV 464

Query: 436 -PG-GTLVIVGTREGSLQLFDLASSTLLENKED------AHETAIWSLDITSDGRRLVTG 487
            PG G  V  G+ + +++++D  S  L+E  +        H+ +++S+  T DG+ +V+G
Sbjct: 465 SPGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEGETGVGHKDSVYSVVFTRDGKNIVSG 524

Query: 488 SADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNED-VLSVRISPEDKFLAISL 546
           S D+++K WN +     + G +    P  +   + T   ++D VLSV  +  D+++    
Sbjct: 525 SLDRSVKLWNLRN----INGASTSPQPKTEGNCEMTYIGHKDFVLSVTTTENDQYILSGS 580

Query: 547 LDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKL------IITSSADKNIKIW 596
            D  V  +   S    L L GH+  V+S+ ++    L        T S D   KIW
Sbjct: 581 KDRGVIFWDKVSGVPLLMLQGHRNSVISVAVANGKPLGANYNVFATGSGDCKAKIW 636

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 75/179 (41%), Gaps = 23/179 (12%)

Query: 518 LIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLY----------- 566
           L+HD+       V  V+ S   ++LA    + T K+F + +      L            
Sbjct: 315 LLHDSV------VCCVKFSNNGEYLATGC-NKTTKIFEVATGNLVTELVDDTKTGTEDAN 367

Query: 567 ---GHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPES 623
                 L + S+  S D K + T + DK I+IW +        L  H+  I ++ +    
Sbjct: 368 SASSADLYIRSVCFSPDGKFLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSG 427

Query: 624 HNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAIT-SDGTSVISASHDHSLRVWE 681
           +   S S D  ++ WD    +C   L+     V ++A++  +G  V + S D ++RVW+
Sbjct: 428 NKLVSGSGDRTIRIWDLHTGQCSLTLSIEDG-VTTVAVSPGNGNYVAAGSLDRTVRVWD 485

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 87/202 (43%), Gaps = 29/202 (14%)

Query: 10  QASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISVLSDGLPAGS 69
           Q S+   I      V +SP +    + GS+  +    + +WD  +G L+  L      G 
Sbjct: 448 QCSLTLSIEDGVTTVAVSPGNGNYVAAGSLDRT----VRVWDSNSGFLVERLDSEGETGV 503

Query: 70  IDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLS-------------KSVLLTFN 116
                 K +  S +   D  N+++ G +D ++K+W+L +              +  +T+ 
Sbjct: 504 ----GHKDSVYSVVFTRDGKNIVS-GSLDRSVKLWNLRNINGASTSPQPKTEGNCEMTYI 558

Query: 117 GHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCE-----G 171
           GHK  +  +        ++SGS+D  +I WD VS V L  L+ H++++  +        G
Sbjct: 559 GHKDFVLSVTTTENDQYILSGSKDRGVIFWDKVSGVPLLMLQGHRNSVISVAVANGKPLG 618

Query: 172 EDWLV--STSKDGLIKIWDLKV 191
            ++ V  + S D   KIW  + 
Sbjct: 619 ANYNVFATGSGDCKAKIWKFQT 640

>SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {ON}
           similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198C TAF5 Subunit (90 kDa) of TFIID and SAGA
           complexes involved in RNA polymerase II transcription
           initiation and in chromatin modification
          Length = 749

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 78/336 (23%), Positives = 147/336 (43%), Gaps = 50/336 (14%)

Query: 369 DPTSPAPTRLYTIELPGH-----RTDIRSVDISDDDKLLATASNGLLKVWNLKTKA---C 420
           DPT  +P+R  T+ LP       + +I+ V  S D           +K+ NL++ A   C
Sbjct: 365 DPTMESPSR-DTLPLPAKTALDLKLEIQKVRESRD----------AIKLDNLQSAAPSVC 413

Query: 421 IRVF-DCGYALTC-KFLPGGTLVIVGTREGSLQLFDLASSTL---LENKED--------- 466
           +  F +    +TC +F    TL   G ++  ++L+ L  + L   L +K+          
Sbjct: 414 MYTFHNTNRDMTCLEFSDDATLAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTLI 473

Query: 467 AHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEV 526
            H   ++S   + D + L++ S DKT++ W+      LV                +    
Sbjct: 474 GHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLV----------------SYKGH 517

Query: 527 NEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIIT 586
           N  V  V  SP   + A +  D T +++  D +       GH   V  +    +   + T
Sbjct: 518 NHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFT 577

Query: 587 SSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECI 646
            S DK  ++W +  GD  +    H   +++    P+     + S+DG++  WD    + +
Sbjct: 578 GSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRL 637

Query: 647 QKLAAH-QSEVWSIAITSDGTSVISASHDHSLRVWE 681
           +++  H ++ V+S++ + +GT ++S   DHS+RVW+
Sbjct: 638 KQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWD 673

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 83/188 (44%), Gaps = 18/188 (9%)

Query: 516 MKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKF-------------F 562
           M   H+T    N D+  +  S +    A    D+ +K++ LD                  
Sbjct: 414 MYTFHNT----NRDMTCLEFSDDATLAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINN 469

Query: 563 LSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE 622
            +L GH   V S   S D+K ++++S DK +++W +D      S   H   + +V F P 
Sbjct: 470 TTLIGHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPL 529

Query: 623 SHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWE- 681
            H F ++S D   + W  D    ++  A H ++V  ++   +GT V + S D + R+W+ 
Sbjct: 530 GHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDI 589

Query: 682 ETDDQVFL 689
            T D V L
Sbjct: 590 GTGDSVRL 597

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 68/143 (47%), Gaps = 6/143 (4%)

Query: 92  LAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSE 151
            A    D T ++W       L  F GH + +  + F   GT + +GS D    +WD+ + 
Sbjct: 533 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTG 592

Query: 152 VGLYKLRSHKDAI--SGIWCEGEDWLVSTSKDGLIKIWDLKVQQCIETHIAH-TGECWAM 208
             +     H   +  + +  +G  WL + S+DG+I +WD+   + ++    H     +++
Sbjct: 593 DSVRLFLGHTAPVISTAVSPDGR-WLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSL 651

Query: 209 GVHED--LLITSGADTQLKLWNL 229
              ++  +L++ GAD  +++W+L
Sbjct: 652 SYSKEGTVLVSGGADHSVRVWDL 674

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 72/159 (45%), Gaps = 9/159 (5%)

Query: 375 PTRLYTIELPGHRTDIRSVDISDDDKLLATAS-NGLLKVWNLKTKACIRVF--DCGYALT 431
           P R++     GH  D+  V    +   + T S +   ++W++ T   +R+F       ++
Sbjct: 552 PLRIFA----GHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVIS 607

Query: 432 CKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADK 491
               P G  +  G+ +G + ++D+ +   L+      + A++SL  + +G  LV+G AD 
Sbjct: 608 TAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADH 667

Query: 492 TIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDV 530
           +++ W+ +      P T  +  P      D T  VN D+
Sbjct: 668 SVRVWDLK-RSTAEPNTEPEQ-PFTSYFGDATTSVNNDI 704

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 55/114 (48%), Gaps = 2/114 (1%)

Query: 79  EVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGS 138
           +V  + +H     +  G  D T ++WD+ +   +  F GH + +        G  L +GS
Sbjct: 562 DVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGS 621

Query: 139 RDSNIIVWDLVSEVGLYKLRSH-KDAISGIWCEGEDW-LVSTSKDGLIKIWDLK 190
            D  I VWD+ +   L ++R H K+A+  +    E   LVS   D  +++WDLK
Sbjct: 622 EDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDLK 675

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/154 (22%), Positives = 64/154 (41%), Gaps = 10/154 (6%)

Query: 87  DETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVW 146
           D   LL+A   D T+++W + + S L+++ GH   +  + F   G    + S D    +W
Sbjct: 487 DNKYLLSAS-EDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLW 545

Query: 147 DLVSEVGLYKLRSHKDAISGIWC----EGEDWLVSTSKDGLIKIWDLKVQQCIETHIAHT 202
              S   +Y LR     ++ + C        ++ + S D   ++WD+     +   + HT
Sbjct: 546 ---SCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHT 602

Query: 203 GECWAMGVHED--LLITSGADTQLKLWNLDFSKE 234
               +  V  D   L T   D  + +W++   K 
Sbjct: 603 APVISTAVSPDGRWLSTGSEDGIINVWDIGTGKR 636

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/167 (18%), Positives = 61/167 (36%), Gaps = 16/167 (9%)

Query: 79  EVSYLHYHDETNLLAAGYMDGTIKVWDL-------------LSKSVLLTFNGHKSAITVM 125
           +++ L + D+  L AAG+ D  IK+W L               K    T  GH   +   
Sbjct: 423 DMTCLEFSDDATLAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTLIGHSGTVYST 482

Query: 126 KFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGEDWLVSTSKDGLI 184
            F      L+S S D  + +W + +   L   + H   +  + +     +  + S D   
Sbjct: 483 SFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYFATASHDQTA 542

Query: 185 KIWDLKVQQCIETHIAHTGECWAMGVHED--LLITSGADTQLKLWNL 229
           ++W       +     H  +   +  H +   + T   D   ++W++
Sbjct: 543 RLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDI 589

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 28/135 (20%), Positives = 52/135 (38%), Gaps = 16/135 (11%)

Query: 112 LLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRS------------ 159
           + TF+     +T ++F    T   +G +DS I +W L       KL S            
Sbjct: 414 MYTFHNTNRDMTCLEFSDDATLAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTLI 473

Query: 160 -HKDAI-SGIWCEGEDWLVSTSKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHE--DLL 215
            H   + S  +     +L+S S+D  +++W +     + ++  H    W +         
Sbjct: 474 GHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYF 533

Query: 216 ITSGADTQLKLWNLD 230
            T+  D   +LW+ D
Sbjct: 534 ATASHDQTARLWSCD 548

 Score = 33.1 bits (74), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 11/60 (18%)

Query: 47  INIWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDL 106
           IN+WDI TG+ +  +           +      V  L Y  E  +L +G  D +++VWDL
Sbjct: 626 INVWDIGTGKRLKQM-----------RGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDL 674

>Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to
           Ashbya gossypii AEL246C
          Length = 800

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 92/188 (48%), Gaps = 18/188 (9%)

Query: 516 MKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKF-------------F 562
           M   H+T    N D+ S++ S + + +A    D+ +K++ LD                  
Sbjct: 465 MYTFHNT----NRDMTSLQFSEDSRLVAAGFQDSHIKIWSLDGTPLESKLPSKSKEASNT 520

Query: 563 LSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE 622
            +L GH  PV S+  S D++ ++++S DK +++W LD   C  S   H   + +VKF P 
Sbjct: 521 TTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPL 580

Query: 623 SHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWE- 681
            H F + S D   + W  D    ++  A H ++V  +A   +GT V++ S D + R+W+ 
Sbjct: 581 GHYFATVSHDQTARLWSCDHIYPLRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDI 640

Query: 682 ETDDQVFL 689
           +T D V L
Sbjct: 641 QTGDSVRL 648

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 71/295 (24%), Positives = 130/295 (44%), Gaps = 36/295 (12%)

Query: 406 SNGLLKVWNLKTKA---CIRVF-DCGYALTC-KFLPGGTLVIVGTREGSLQLFDLASSTL 460
           S   +K+ NL+T A   C+  F +    +T  +F     LV  G ++  ++++ L   T 
Sbjct: 447 SRDAIKLDNLQTSAPSVCMYTFHNTNRDMTSLQFSEDSRLVAAGFQDSHIKIWSL-DGTP 505

Query: 461 LENKEDA-------------HETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPG 507
           LE+K  +             H   ++S+  + D R LV+ S DKT++ W+      LV  
Sbjct: 506 LESKLPSKSKEASNTTTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLV-- 563

Query: 508 TADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYG 567
                         +    N  V  V+ SP   + A    D T +++  D +       G
Sbjct: 564 --------------SYKGHNHPVWDVKFSPLGHYFATVSHDQTARLWSCDHIYPLRIFAG 609

Query: 568 HKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFF 627
           H   V  +    +   ++T S+DK  ++W +  GD  +    H  S+++V   P+     
Sbjct: 610 HLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLT 669

Query: 628 SSSKDGLVKYWDGDKFECIQKLAAH-QSEVWSIAITSDGTSVISASHDHSLRVWE 681
           + S+DG++  WD    + I+++  H +S V S++   +G  ++S   D S+RVW+
Sbjct: 670 TGSEDGVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWD 724

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 59/114 (51%), Gaps = 2/114 (1%)

Query: 79  EVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGS 138
           +V  + +H     +  G  D T ++WD+ +   +  F GH +++  +     G  L +GS
Sbjct: 613 DVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGS 672

Query: 139 RDSNIIVWDLVSEVGLYKLRSH-KDAISGIWCEGE-DWLVSTSKDGLIKIWDLK 190
            D  IIVWD+ +   + ++R H K A++ +    E + LVS   D  +++WDLK
Sbjct: 673 EDGVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWDLK 726

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 64/136 (47%), Gaps = 4/136 (2%)

Query: 98  DGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKL 157
           D T ++W       L  F GH + +  + F   GT +++GS D    +WD+ +   +   
Sbjct: 590 DQTARLWSCDHIYPLRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLF 649

Query: 158 RSHKDAISGIWCEGED-WLVSTSKDGLIKIWDLKVQQCIETHIAHTGEC---WAMGVHED 213
             H  ++  +    +  WL + S+DG+I +WD+   + I+    H        +     +
Sbjct: 650 LGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGN 709

Query: 214 LLITSGADTQLKLWNL 229
           +L++ GAD  +++W+L
Sbjct: 710 ILVSGGADQSVRVWDL 725

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 103/224 (45%), Gaps = 23/224 (10%)

Query: 380 TIELPGHRTDIRSVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFDCGYALTC---KFL 435
           T  L GH   + SV  S D++ L +AS +  +++W+L T  C+  +  G+       KF 
Sbjct: 520 TTTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYK-GHNHPVWDVKFS 578

Query: 436 PGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKF 495
           P G      + + + +L+       L      H   +  +    +G  ++TGS+DKT + 
Sbjct: 579 PLGHYFATVSHDQTARLWSCDHIYPLRIFA-GHLNDVDCVAFHPNGTYVLTGSSDKTCRM 637

Query: 496 WNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFY 555
           W+ Q  + +           + L H  +      V+SV +SP+ ++L     D  + V+ 
Sbjct: 638 WDIQTGDSVR----------LFLGHTAS------VVSVAVSPDGRWLTTGSEDGVIIVWD 681

Query: 556 LDSMKFFLSLYGH-KLPVLSIDISFDSKLIITSSADKNIKIWGL 598
           + + K    + GH K  V S+  + +  ++++  AD+++++W L
Sbjct: 682 IGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWDL 725

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 53/281 (18%), Positives = 109/281 (38%), Gaps = 22/281 (7%)

Query: 78  AEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISG 137
             V  + +  +   L +   D T+++W L + + L+++ GH   +  +KF   G    + 
Sbjct: 528 GPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPLGHYFATV 587

Query: 138 SRDSNIIVWDLVSEVGLYKLRSHKDAISGIWC----EGEDWLVSTSKDGLIKIWDLKVQQ 193
           S D    +W   S   +Y LR     ++ + C        ++++ S D   ++WD++   
Sbjct: 588 SHDQTARLW---SCDHIYPLRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGD 644

Query: 194 CIETHIAHTGECWAMGVHED--LLITSGADTQLKLWNLDFSKEAGSKLIEKGVYDKQSKQ 251
            +   + HT    ++ V  D   L T   D  + +W++   K             KQ + 
Sbjct: 645 SVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRI-----------KQMRG 693

Query: 252 RGLDIKFSVAPNGTAFFYIQ-NADKTTEVFRIRREEEISKAXXXXXXXXXXXGMTDEEIQ 310
            G     S++ N      +   AD++  V+ +++      A           G  +  + 
Sbjct: 694 HGKSAVNSLSFNKEGNILVSGGADQSVRVWDLKKFTN-EPALEPEQPYSGYSGDMETSVN 752

Query: 311 QNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVV 351
           Q++KE      + P Q + + +  K     TV  T+   V+
Sbjct: 753 QDVKEYGRRRTVFPTQDLVASFHTKKTPIYTVKFTRTNLVL 793

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 74/162 (45%), Gaps = 15/162 (9%)

Query: 375 PTRLYTIELPGHRTDIRSVDISDDDK-LLATASNGLLKVWNLKTKACIRVF--DCGYALT 431
           P R++     GH  D+  V    +   +L  +S+   ++W+++T   +R+F       ++
Sbjct: 603 PLRIFA----GHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVS 658

Query: 432 CKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADK 491
               P G  +  G+ +G + ++D+ +   ++      ++A+ SL    +G  LV+G AD+
Sbjct: 659 VAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQ 718

Query: 492 TIKFWN---FQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDV 530
           +++ W+   F  E  L P       P      D    VN+DV
Sbjct: 719 SVRVWDLKKFTNEPALEPEQ-----PYSGYSGDMETSVNQDV 755

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/167 (19%), Positives = 66/167 (39%), Gaps = 16/167 (9%)

Query: 79  EVSYLHYHDETNLLAAGYMDGTIKVWDL-------------LSKSVLLTFNGHKSAITVM 125
           +++ L + +++ L+AAG+ D  IK+W L                S   T  GH   +  +
Sbjct: 474 DMTSLQFSEDSRLVAAGFQDSHIKIWSLDGTPLESKLPSKSKEASNTTTLIGHSGPVYSV 533

Query: 126 KFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGEDWLVSTSKDGLI 184
            F      L+S S D  + +W L +   L   + H   +  + +     +  + S D   
Sbjct: 534 SFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPLGHYFATVSHDQTA 593

Query: 185 KIWDLKVQQCIETHIAHTG--ECWAMGVHEDLLITSGADTQLKLWNL 229
           ++W       +     H    +C A   +   ++T  +D   ++W++
Sbjct: 594 RLWSCDHIYPLRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDI 640

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 53/135 (39%), Gaps = 16/135 (11%)

Query: 112 LLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRS------------ 159
           + TF+     +T ++F      + +G +DS+I +W L       KL S            
Sbjct: 465 MYTFHNTNRDMTSLQFSEDSRLVAAGFQDSHIKIWSLDGTPLESKLPSKSKEASNTTTLI 524

Query: 160 -HKDAISGI-WCEGEDWLVSTSKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHE--DLL 215
            H   +  + +     +LVS S+D  +++W L    C+ ++  H    W +         
Sbjct: 525 GHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPLGHYF 584

Query: 216 ITSGADTQLKLWNLD 230
            T   D   +LW+ D
Sbjct: 585 ATVSHDQTARLWSCD 599

>TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON}
           Anc_6.363 YCR084C
          Length = 727

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 80/337 (23%), Positives = 143/337 (42%), Gaps = 60/337 (17%)

Query: 386 HRTDIRSVDISDDDKLLATASNGLLKVWNLKTKACIRVFDCG------------------ 427
           H + +  V  S+D + LAT  N   +V+   T   I                        
Sbjct: 397 HPSVVCCVRFSNDGQFLATGCNKTTRVYKTSTGELIATLLVDPQSSNNSNSEQQTNPESS 456

Query: 428 --YALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLV 485
             Y  +  F P G  +  G  +  ++++D+ +  ++   +  HE  I+SLD    G +LV
Sbjct: 457 DLYIRSVCFSPDGKFLAAGAEDKLIRIWDITTKQIVMILK-GHEQDIYSLDYFPSGEKLV 515

Query: 486 TGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPED-KFLAI 544
           +GS DKT++ W      DL  G               T+ + + V +V  SP + KF+A 
Sbjct: 516 SGSGDKTVRIW------DLRTGQCS-----------LTLSIEDGVTTVSSSPNNGKFIAA 558

Query: 545 SLLDNTVKV------FYLDSMKFFLSLY-GHKLPVLSIDISFDSKLIITSSADKNIKIWG 597
             LD + ++      F L  +     L  GHK  + S+  + D K +++ S D+++K+W 
Sbjct: 559 GSLDRSARIWDTETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLWN 618

Query: 598 LDFGD------CHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAA 651
           LD  +      C  +   H+D +++V          S SKD  V +WD +    +  L  
Sbjct: 619 LDTTNNNSNESCEVTFIGHKDFVLSVTTSQNDEYVLSGSKDRGVLFWDTNSGNPLLMLQG 678

Query: 652 HQSEVWSIAITSDGTSV-------ISASHDHSLRVWE 681
           H++ V S+A+ ++G  +        + S D + ++W 
Sbjct: 679 HKNSVISVAV-ANGQPLGPEFGVFSTGSGDFTAKIWR 714

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 110/227 (48%), Gaps = 18/227 (7%)

Query: 467 AHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEV 526
           +H + +  +  ++DG+ L TG  +KT + +     E +     D   P      ++  + 
Sbjct: 396 SHPSVVCCVRFSNDGQFLATG-CNKTTRVYKTSTGELIATLLVD---PQSSNNSNSEQQT 451

Query: 527 NED-----VLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDS 581
           N +     + SV  SP+ KFLA    D  ++++ + + +  + L GH+  + S+D     
Sbjct: 452 NPESSDLYIRSVCFSPDGKFLAAGAEDKLIRIWDITTKQIVMILKGHEQDIYSLDYFPSG 511

Query: 582 KLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSS-SKDGLVKYWDG 640
           + +++ S DK ++IW L  G C  +L + +D +  V   P +  F ++ S D   + WD 
Sbjct: 512 EKLVSGSGDKTVRIWDLRTGQCSLTL-SIEDGVTTVSSSPNNGKFIAAGSLDRSARIWDT 570

Query: 641 DKFECIQKL-------AAHQSEVWSIAITSDGTSVISASHDHSLRVW 680
           +    +++L         H+  ++S++ T DG  ++S S D S+++W
Sbjct: 571 ETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLW 617

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 61/236 (25%), Positives = 109/236 (46%), Gaps = 25/236 (10%)

Query: 376 TRLYTIELPGHRTDIRSVD-ISDDDKLLATASNGLLKVWNLKTKACIRVFDC--GYALTC 432
           T+   + L GH  DI S+D     +KL++ + +  +++W+L+T  C        G     
Sbjct: 488 TKQIVMILKGHEQDIYSLDYFPSGEKLVSGSGDKTVRIWDLRTGQCSLTLSIEDGVTTVS 547

Query: 433 KFLPGGTLVIVGTREGSLQLFDLASSTLLE------NKEDAHETAIWSLDITSDGRRLVT 486
                G  +  G+ + S +++D  +  LL+      + ++ H+ +I+S+  T DG++LV+
Sbjct: 548 SSPNNGKFIAAGSLDRSARIWDTETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVS 607

Query: 487 GSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISL 546
           GS D+++K WN     D     +++   V  + H       + VLSV  S  D+++    
Sbjct: 608 GSLDRSVKLWNL----DTTNNNSNESCEVTFIGH------KDFVLSVTTSQNDEYVLSGS 657

Query: 547 LDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKL------IITSSADKNIKIW 596
            D  V  +  +S    L L GHK  V+S+ ++    L        T S D   KIW
Sbjct: 658 KDRGVLFWDTNSGNPLLMLQGHKNSVISVAVANGQPLGPEFGVFSTGSGDFTAKIW 713

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 99/211 (46%), Gaps = 20/211 (9%)

Query: 49  IWDIKTGELI-SVLSDGLPAGSIDVKSSKPAEVSYLH-----YHDETNLLAAGYMDGTIK 102
           ++   TGELI ++L D   + + + +     E S L+     +  +   LAAG  D  I+
Sbjct: 423 VYKTSTGELIATLLVDPQSSNNSNSEQQTNPESSDLYIRSVCFSPDGKFLAAGAEDKLIR 482

Query: 103 VWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLR-SHK 161
           +WD+ +K +++   GH+  I  + +  +G +L+SGS D  + +WDL    G   L  S +
Sbjct: 483 IWDITTKQIVMILKGHEQDIYSLDYFPSGEKLVSGSGDKTVRIWDL--RTGQCSLTLSIE 540

Query: 162 DAISGIWCEGED--WLVSTSKDGLIKIWDL-------KVQQCIETHIAHTGECWAMGVHE 212
           D ++ +     +  ++ + S D   +IWD        ++    +    H    +++   +
Sbjct: 541 DGVTTVSSSPNNGKFIAAGSLDRSARIWDTETGFLLKRLDSQTDLQNGHKDSIYSVSFTK 600

Query: 213 D--LLITSGADTQLKLWNLDFSKEAGSKLIE 241
           D   L++   D  +KLWNLD +    ++  E
Sbjct: 601 DGKKLVSGSLDRSVKLWNLDTTNNNSNESCE 631

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 76/164 (46%), Gaps = 15/164 (9%)

Query: 7   RFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISVLSDGLP 66
           R  Q S+   I      V  SP + K  + GS+  SA     IWD +TG L+  L     
Sbjct: 529 RTGQCSLTLSIEDGVTTVSSSPNNGKFIAAGSLDRSA----RIWDTETGFLLKRLD---- 580

Query: 67  AGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDL------LSKSVLLTFNGHKS 120
               D+++     +  + +  +   L +G +D ++K+W+L       ++S  +TF GHK 
Sbjct: 581 -SQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLWNLDTTNNNSNESCEVTFIGHKD 639

Query: 121 AITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAI 164
            +  +        ++SGS+D  ++ WD  S   L  L+ HK+++
Sbjct: 640 FVLSVTTSQNDEYVLSGSKDRGVLFWDTNSGNPLLMLQGHKNSV 683

>ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 824

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 61/255 (23%), Positives = 112/255 (43%), Gaps = 29/255 (11%)

Query: 440 LVIVGTREGSLQLFDLASSTLLEN-----KEDA-------HETAIWSLDITSDGRRLVTG 487
           L   G ++  ++LF L  S L         EDA       H   ++S   + D R LV+ 
Sbjct: 510 LAAAGFQDSQIKLFSLDGSPLGNRYDPDLPEDATSKTLVGHSGTVYSTSFSPDNRYLVSS 569

Query: 488 SADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLL 547
           S DKT++ W+      LV                +    N  V  V+ SP   + A +  
Sbjct: 570 SEDKTVRLWSLDTHSALV----------------SYKGHNHPVWDVKFSPLGHYFATASH 613

Query: 548 DNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSL 607
           D+T +++  D +       GH   V  +    +   + T S+DK  ++W +  GDC +  
Sbjct: 614 DHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLF 673

Query: 608 FAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAH-QSEVWSIAITSDGT 666
                 +++    P+     + S+DG++  WD    + ++++  H ++ ++S+A   +G 
Sbjct: 674 LGLTAPVISTCVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLAYCKEGN 733

Query: 667 SVISASHDHSLRVWE 681
           ++IS   DHS+RVW+
Sbjct: 734 ALISGGADHSVRVWD 748

 Score = 78.6 bits (192), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 85/189 (44%), Gaps = 18/189 (9%)

Query: 515 VMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKF------------- 561
            M   H+T    N D+ S+  S + +  A    D+ +K+F LD                 
Sbjct: 488 CMYTFHNT----NRDMTSLEFSDDCRLAAAGFQDSQIKLFSLDGSPLGNRYDPDLPEDAT 543

Query: 562 FLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP 621
             +L GH   V S   S D++ +++SS DK +++W LD      S   H   + +VKF P
Sbjct: 544 SKTLVGHSGTVYSTSFSPDNRYLVSSSEDKTVRLWSLDTHSALVSYKGHNHPVWDVKFSP 603

Query: 622 ESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWE 681
             H F ++S D   + W  D    ++  A H ++V  ++   +G  + + S D + R+W+
Sbjct: 604 LGHYFATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWD 663

Query: 682 -ETDDQVFL 689
             T D V L
Sbjct: 664 IATGDCVRL 672

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 62/143 (43%), Gaps = 6/143 (4%)

Query: 92  LAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSE 151
            A    D T ++W       L  F GH + +  + F   G  L +GS D    +WD+ + 
Sbjct: 608 FATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIATG 667

Query: 152 --VGLYKLRSHKDAISGIWCEGEDWLVSTSKDGLIKIWDLKVQQCIETHIAHTGEC---W 206
             V L+ L      IS        WL + S+DG+I +WD+   + ++    H        
Sbjct: 668 DCVRLF-LGLTAPVISTCVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSL 726

Query: 207 AMGVHEDLLITSGADTQLKLWNL 229
           A     + LI+ GAD  +++W+L
Sbjct: 727 AYCKEGNALISGGADHSVRVWDL 749

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 76/165 (46%), Gaps = 21/165 (12%)

Query: 375 PTRLYTIELPGHRTDIRSVDISDDDKLLAT-ASNGLLKVWNLKTKACIRVFDCGYALTCK 433
           P R++     GH  D+  V    +   L T +S+   ++W++ T  C+R+F     LT  
Sbjct: 627 PLRIFA----GHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLF---LGLTAP 679

Query: 434 FL-----PGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGS 488
            +     P G  +  G+ +G + ++D+ +   L+      + AI+SL    +G  L++G 
Sbjct: 680 VISTCVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLAYCKEGNALISGG 739

Query: 489 ADKTIKFWNFQ---VEEDLVPGTADKYLPVMKLIHDTTMEVNEDV 530
           AD +++ W+ +    E    P  A      +  + D T  +N+D+
Sbjct: 740 ADHSVRVWDLKKATTESGPEPEQA-----FVGYLGDVTGSINQDI 779

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 57/114 (50%), Gaps = 2/114 (1%)

Query: 79  EVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGS 138
           +V  + +H     L  G  D T ++WD+ +   +  F G  + +        G  L +GS
Sbjct: 637 DVDCVSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLFLGLTAPVISTCVSPDGRWLSTGS 696

Query: 139 RDSNIIVWDLVSEVGLYKLRSH-KDAISGI-WCEGEDWLVSTSKDGLIKIWDLK 190
            D  I VWD+ +   L ++R H K+AI  + +C+  + L+S   D  +++WDLK
Sbjct: 697 EDGIINVWDIGTGKRLKQMRGHGKNAIYSLAYCKEGNALISGGADHSVRVWDLK 750

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/167 (19%), Positives = 63/167 (37%), Gaps = 16/167 (9%)

Query: 79  EVSYLHYHDETNLLAAGYMDGTIKVW-------------DLLSKSVLLTFNGHKSAITVM 125
           +++ L + D+  L AAG+ D  IK++             DL   +   T  GH   +   
Sbjct: 498 DMTSLEFSDDCRLAAAGFQDSQIKLFSLDGSPLGNRYDPDLPEDATSKTLVGHSGTVYST 557

Query: 126 KFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGEDWLVSTSKDGLI 184
            F      L+S S D  + +W L +   L   + H   +  + +     +  + S D   
Sbjct: 558 SFSPDNRYLVSSSEDKTVRLWSLDTHSALVSYKGHNHPVWDVKFSPLGHYFATASHDHTA 617

Query: 185 KIWDLKVQQCIETHIAHTGECWAMGVHED--LLITSGADTQLKLWNL 229
           ++W       +     H  +   +  H +   L T  +D   ++W++
Sbjct: 618 RLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDI 664

 Score = 32.7 bits (73), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 11/60 (18%)

Query: 47  INIWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDL 106
           IN+WDI TG+ +  +           +      +  L Y  E N L +G  D +++VWDL
Sbjct: 701 INVWDIGTGKRLKQM-----------RGHGKNAIYSLAYCKEGNALISGGADHSVRVWDL 749

>Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON}
           YCR084C (REAL)
          Length = 713

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 72/288 (25%), Positives = 130/288 (45%), Gaps = 60/288 (20%)

Query: 428 YALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKE-----DAHETAIWSLDITSDGR 482
           Y  +  F P G  +  G  +  ++++D+      EN++       HE  I+SLD    G 
Sbjct: 445 YIRSVCFSPDGKFLATGAEDRLIRIWDI------ENRKIVMILQGHEQDIYSLDYFPSGD 498

Query: 483 RLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPED-KF 541
           +LV+GS D+T++ W+ +  +  +                 T+ + + V +V +SP D K+
Sbjct: 499 KLVSGSGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKY 541

Query: 542 LAISLLDNTVKVFYLDSMKFFL---------SLYGHKLPVLSIDISFDSKLIITSSADKN 592
           +A   LD  V+V+  DS   FL         S  GHK  V S+  + D + +++ S D++
Sbjct: 542 IAAGSLDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRS 599

Query: 593 IKIWGL------------DFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDG 640
           +K+W L            + G C  +   H+D +++V          S SKD  V +WD 
Sbjct: 600 VKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDK 659

Query: 641 DKFECIQKLAAHQSEVWSIAITSDGTSV-------ISASHDHSLRVWE 681
                +  L  H++ V S+A+ ++G+ +        + S D   R+W+
Sbjct: 660 TSGNPLLMLQGHRNSVISVAV-ANGSPLGPEYNVFATGSGDCKARIWK 706

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 108/229 (47%), Gaps = 19/229 (8%)

Query: 383 LPGHRTDIRSVD-ISDDDKLLATASNGLLKVWNLKTKACIRVFDCGYALTCKFL-PG-GT 439
           L GH  DI S+D     DKL++ + +  +++W+L+T  C         +T   + PG G 
Sbjct: 481 LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGK 540

Query: 440 LVIVGTREGSLQLFDLASSTLLENKED------AHETAIWSLDITSDGRRLVTGSADKTI 493
            +  G+ + +++++D  +  L+E  +        H+ +++S+  T DG+ +V+GS D+++
Sbjct: 541 YIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSV 600

Query: 494 KFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKV 553
           K WN Q   +     +D   P       T +   + VLSV  +  D+++     D  V  
Sbjct: 601 KLWNLQNANN----KSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLF 656

Query: 554 FYLDSMKFFLSLYGHKLPVLSIDISFDSKL------IITSSADKNIKIW 596
           +   S    L L GH+  V+S+ ++  S L        T S D   +IW
Sbjct: 657 WDKTSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 705

 Score = 61.2 bits (147), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 70/293 (23%), Positives = 129/293 (44%), Gaps = 53/293 (18%)

Query: 378 LYTIELPGHRTDIRSVDISDDDKLLAT-ASNGLLKVWNLKTKACIRVFDCG----YALTC 432
           L T   P     IRSV  S D K LAT A + L+++W+++ +  + +        Y+L  
Sbjct: 434 LNTSSSPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSL-- 491

Query: 433 KFLPGGTLVIVGTREGSLQLFDLASS--TLLENKEDAHETAIWSLDITSDGRRLVTGSAD 490
            + P G  ++ G+ + +++++DL +   +L  + ED   T   S     DG+ +  GS D
Sbjct: 492 DYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVS---PGDGKYIAAGSLD 548

Query: 491 KTIKFWN----FQVEE---DLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLA 543
           + ++ W+    F VE    +   GT  K                + V SV  + + + + 
Sbjct: 549 RAVRVWDSETGFLVERLDSENESGTGHK----------------DSVYSVVFTRDGQSVV 592

Query: 544 ISLLDNTVKVFYL------------DSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADK 591
              LD +VK++ L            +S    ++  GHK  VLS+  + + + I++ S D+
Sbjct: 593 SGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDR 652

Query: 592 NIKIWGLDFGDCHKSLFAHQDSIMNVKFL------PESHNFFSSSKDGLVKYW 638
            +  W    G+    L  H++S+++V         PE + F + S D   + W
Sbjct: 653 GVLFWDKTSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 705

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 81/171 (47%), Gaps = 17/171 (9%)

Query: 74  SSKPAEVSYLH---YHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVT 130
           SS P+   Y+    +  +   LA G  D  I++WD+ ++ +++   GH+  I  + +  +
Sbjct: 437 SSSPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPS 496

Query: 131 GTRLISGSRDSNIIVWDLVSEVGLYKLR-SHKDAISGIWCEGED--WLVSTSKDGLIKIW 187
           G +L+SGS D  + +WDL    G   L  S +D ++ +     D  ++ + S D  +++W
Sbjct: 497 GDKLVSGSGDRTVRIWDL--RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVW 554

Query: 188 DLKVQQCI-------ETHIAHTGECWAMGVHED--LLITSGADTQLKLWNL 229
           D +    +       E+   H    +++    D   +++   D  +KLWNL
Sbjct: 555 DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNL 605

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/221 (20%), Positives = 82/221 (37%), Gaps = 61/221 (27%)

Query: 530 VLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSA 589
           + SV  SP+ KFLA    D  ++++ +++ K  + L GH+  + S+D       +++ S 
Sbjct: 446 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 505

Query: 590 DKNIKIWGLDFGDC---------------------------------------------- 603
           D+ ++IW L  G C                                              
Sbjct: 506 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERL 565

Query: 604 ---HKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWD------------GDKFECIQK 648
              ++S   H+DS+ +V F  +  +  S S D  VK W+             +   C   
Sbjct: 566 DSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVT 625

Query: 649 LAAHQSEVWSIAITSDGTSVISASHDHSLRVWEETDDQVFL 689
              H+  V S+A T +   ++S S D  +  W++T     L
Sbjct: 626 YIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKTSGNPLL 666

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 56/113 (49%), Gaps = 2/113 (1%)

Query: 570 LPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSS 629
           L + S+  S D K + T + D+ I+IW ++       L  H+  I ++ + P      S 
Sbjct: 444 LYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSG 503

Query: 630 SKDGLVKYWDGDKFECIQKLAAHQSEVWSIAIT-SDGTSVISASHDHSLRVWE 681
           S D  V+ WD    +C   L+  +  V ++A++  DG  + + S D ++RVW+
Sbjct: 504 SGDRTVRIWDLRTGQCSLTLSI-EDGVTTVAVSPGDGKYIAAGSLDRAVRVWD 555

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/216 (23%), Positives = 93/216 (43%), Gaps = 54/216 (25%)

Query: 47  INIWDIKTGELISVLS--DGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVW 104
           + IWD++TG+    LS  DG+   ++      P +  Y         +AAG +D  ++VW
Sbjct: 509 VRIWDLRTGQCSLTLSIEDGVTTVAV-----SPGDGKY---------IAAGSLDRAVRVW 554

Query: 105 DLLSKSVLL---------TFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDL------- 148
           D  S++  L         +  GHK ++  + F   G  ++SGS D ++ +W+L       
Sbjct: 555 D--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKS 612

Query: 149 ---VSEVGLYKLR--SHKD-AISGIWCEGEDWLVSTSKDGLIKIWD-------LKVQ--- 192
                  G  ++    HKD  +S    + +++++S SKD  +  WD       L +Q   
Sbjct: 613 DSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKTSGNPLLMLQGHR 672

Query: 193 -QCIETHIAHTGECWAMGVHEDLLITSGADTQLKLW 227
              I   +A+      +G   ++  T   D + ++W
Sbjct: 673 NSVISVAVANGS---PLGPEYNVFATGSGDCKARIW 705

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 77/170 (45%), Gaps = 21/170 (12%)

Query: 7   RFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISVLSDGLP 66
           R  Q S+   I      V +SP   K  + GS+  +    + +WD +TG L+  L     
Sbjct: 515 RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRA----VRVWDSETGFLVERLDSENE 570

Query: 67  AGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLL------------SKSVLLT 114
           +G+      K +  S +   D  ++++ G +D ++K+W+L             S +  +T
Sbjct: 571 SGT----GHKDSVYSVVFTRDGQSVVS-GSLDRSVKLWNLQNANNKSDSKTPNSGTCEVT 625

Query: 115 FNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAI 164
           + GHK  +  +        ++SGS+D  ++ WD  S   L  L+ H++++
Sbjct: 626 YIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKTSGNPLLMLQGHRNSV 675

>YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}
           TUP1General repressor of transcription, forms complex
           with Cyc8p, involved in the establishment of repressive
           chromatin structure through interactions with histones
           H3 and H4, appears to enhance expression of some genes
          Length = 713

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 129/288 (44%), Gaps = 60/288 (20%)

Query: 428 YALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKE-----DAHETAIWSLDITSDGR 482
           Y  +  F P G  +  G  +  ++++D+      EN++       HE  I+SLD    G 
Sbjct: 445 YIRSVCFSPDGKFLATGAEDRLIRIWDI------ENRKIVMILQGHEQDIYSLDYFPSGD 498

Query: 483 RLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPED-KF 541
           +LV+GS D+T++ W      DL  G               T+ + + V +V +SP D K+
Sbjct: 499 KLVSGSGDRTVRIW------DLRTGQCS-----------LTLSIEDGVTTVAVSPGDGKY 541

Query: 542 LAISLLDNTVKVFYLDSMKFFL---------SLYGHKLPVLSIDISFDSKLIITSSADKN 592
           +A   LD  V+V+  DS   FL         S  GHK  V S+  + D + +++ S D++
Sbjct: 542 IAAGSLDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRS 599

Query: 593 IKIWGL------------DFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDG 640
           +K+W L            + G C  +   H+D +++V          S SKD  V +WD 
Sbjct: 600 VKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDK 659

Query: 641 DKFECIQKLAAHQSEVWSIAITSDGTSV-------ISASHDHSLRVWE 681
                +  L  H++ V S+A+ ++G+ +        + S D   R+W+
Sbjct: 660 KSGNPLLMLQGHRNSVISVAV-ANGSPLGPEYNVFATGSGDCKARIWK 706

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 108/229 (47%), Gaps = 19/229 (8%)

Query: 383 LPGHRTDIRSVD-ISDDDKLLATASNGLLKVWNLKTKACIRVFDCGYALTCKFL-PG-GT 439
           L GH  DI S+D     DKL++ + +  +++W+L+T  C         +T   + PG G 
Sbjct: 481 LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGK 540

Query: 440 LVIVGTREGSLQLFDLASSTLLENKED------AHETAIWSLDITSDGRRLVTGSADKTI 493
            +  G+ + +++++D  +  L+E  +        H+ +++S+  T DG+ +V+GS D+++
Sbjct: 541 YIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSV 600

Query: 494 KFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKV 553
           K WN Q   +     +D   P       T +   + VLSV  +  D+++     D  V  
Sbjct: 601 KLWNLQNANN----KSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLF 656

Query: 554 FYLDSMKFFLSLYGHKLPVLSIDISFDSKL------IITSSADKNIKIW 596
           +   S    L L GH+  V+S+ ++  S L        T S D   +IW
Sbjct: 657 WDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 705

 Score = 61.2 bits (147), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 70/293 (23%), Positives = 129/293 (44%), Gaps = 53/293 (18%)

Query: 378 LYTIELPGHRTDIRSVDISDDDKLLAT-ASNGLLKVWNLKTKACIRVFDCG----YALTC 432
           L T   P     IRSV  S D K LAT A + L+++W+++ +  + +        Y+L  
Sbjct: 434 LNTSSSPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSL-- 491

Query: 433 KFLPGGTLVIVGTREGSLQLFDLASS--TLLENKEDAHETAIWSLDITSDGRRLVTGSAD 490
            + P G  ++ G+ + +++++DL +   +L  + ED   T   S     DG+ +  GS D
Sbjct: 492 DYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVS---PGDGKYIAAGSLD 548

Query: 491 KTIKFWN----FQVEE---DLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLA 543
           + ++ W+    F VE    +   GT  K                + V SV  + + + + 
Sbjct: 549 RAVRVWDSETGFLVERLDSENESGTGHK----------------DSVYSVVFTRDGQSVV 592

Query: 544 ISLLDNTVKVFYL------------DSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADK 591
              LD +VK++ L            +S    ++  GHK  VLS+  + + + I++ S D+
Sbjct: 593 SGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDR 652

Query: 592 NIKIWGLDFGDCHKSLFAHQDSIMNVKFL------PESHNFFSSSKDGLVKYW 638
            +  W    G+    L  H++S+++V         PE + F + S D   + W
Sbjct: 653 GVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 705

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 81/171 (47%), Gaps = 17/171 (9%)

Query: 74  SSKPAEVSYLH---YHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVT 130
           SS P+   Y+    +  +   LA G  D  I++WD+ ++ +++   GH+  I  + +  +
Sbjct: 437 SSSPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPS 496

Query: 131 GTRLISGSRDSNIIVWDLVSEVGLYKLR-SHKDAISGIWCEGED--WLVSTSKDGLIKIW 187
           G +L+SGS D  + +WDL    G   L  S +D ++ +     D  ++ + S D  +++W
Sbjct: 497 GDKLVSGSGDRTVRIWDL--RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVW 554

Query: 188 DLKVQQCI-------ETHIAHTGECWAMGVHED--LLITSGADTQLKLWNL 229
           D +    +       E+   H    +++    D   +++   D  +KLWNL
Sbjct: 555 DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNL 605

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 45/221 (20%), Positives = 81/221 (36%), Gaps = 61/221 (27%)

Query: 530 VLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSA 589
           + SV  SP+ KFLA    D  ++++ +++ K  + L GH+  + S+D       +++ S 
Sbjct: 446 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 505

Query: 590 DKNIKIWGLDFGDC---------------------------------------------- 603
           D+ ++IW L  G C                                              
Sbjct: 506 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERL 565

Query: 604 ---HKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWD------------GDKFECIQK 648
              ++S   H+DS+ +V F  +  +  S S D  VK W+             +   C   
Sbjct: 566 DSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVT 625

Query: 649 LAAHQSEVWSIAITSDGTSVISASHDHSLRVWEETDDQVFL 689
              H+  V S+A T +   ++S S D  +  W++      L
Sbjct: 626 YIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLL 666

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 56/113 (49%), Gaps = 2/113 (1%)

Query: 570 LPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSS 629
           L + S+  S D K + T + D+ I+IW ++       L  H+  I ++ + P      S 
Sbjct: 444 LYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSG 503

Query: 630 SKDGLVKYWDGDKFECIQKLAAHQSEVWSIAIT-SDGTSVISASHDHSLRVWE 681
           S D  V+ WD    +C   L+  +  V ++A++  DG  + + S D ++RVW+
Sbjct: 504 SGDRTVRIWDLRTGQCSLTLSI-EDGVTTVAVSPGDGKYIAAGSLDRAVRVWD 555

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/221 (22%), Positives = 92/221 (41%), Gaps = 48/221 (21%)

Query: 39  VITSALENINIWDIKTGELISVLS--DGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGY 96
           V  S    + IWD++TG+    LS  DG+   ++      P +  Y         +AAG 
Sbjct: 501 VSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAV-----SPGDGKY---------IAAGS 546

Query: 97  MDGTIKVWDLLSKSVLL---------TFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWD 147
           +D  ++VWD  S++  L         +  GHK ++  + F   G  ++SGS D ++ +W+
Sbjct: 547 LDRAVRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWN 604

Query: 148 L----------VSEVGLYKLR--SHKD-AISGIWCEGEDWLVSTSKDGLIKIWDLKVQQC 194
           L              G  ++    HKD  +S    + +++++S SKD  +  WD K    
Sbjct: 605 LQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNP 664

Query: 195 IETHIAHTGECWA--------MGVHEDLLITSGADTQLKLW 227
           +     H     +        +G   ++  T   D + ++W
Sbjct: 665 LLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 705

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 89/203 (43%), Gaps = 28/203 (13%)

Query: 7   RFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISVLSDGLP 66
           R  Q S+   I      V +SP   K  + GS+  +    + +WD +TG L+  L     
Sbjct: 515 RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRA----VRVWDSETGFLVERLDSENE 570

Query: 67  AGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLL------------SKSVLLT 114
           +G+      K +  S +   D  ++++ G +D ++K+W+L             S +  +T
Sbjct: 571 SGT----GHKDSVYSVVFTRDGQSVVS-GSLDRSVKLWNLQNANNKSDSKTPNSGTCEVT 625

Query: 115 FNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCE---- 170
           + GHK  +  +        ++SGS+D  ++ WD  S   L  L+ H++++  +       
Sbjct: 626 YIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSP 685

Query: 171 -GEDWLV--STSKDGLIKIWDLK 190
            G ++ V  + S D   +IW  K
Sbjct: 686 LGPEYNVFATGSGDCKARIWKYK 708

>TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.544
           YBR198C
          Length = 812

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 76/320 (23%), Positives = 140/320 (43%), Gaps = 43/320 (13%)

Query: 369 DPTSPAPTRLYTIELPGHRT--DIRSVDISDDDKLLATA-SNGLLKVWNLKTKACIRVFD 425
           +P S     +YT     H T  D+ S++ SDD +L +T   +  +K+W+L          
Sbjct: 439 NPNSLPSVCMYTF----HNTNQDMTSLEFSDDCRLASTGFQDSYIKIWSLD--------- 485

Query: 426 CGYALTCKFLPGG--TLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRR 483
            G +L  KF         I  T      + +  S+TL+      H   ++S   + D R 
Sbjct: 486 -GTSLNTKFTQANKDRNRITITDRSLTHMDNELSATLI-----GHSGTVYSTSFSPDNRY 539

Query: 484 LVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLA 543
           L++GS DKT++ W+      LV                +    N  +  V+ SP   + A
Sbjct: 540 LISGSEDKTVRLWSLDTHTALV----------------SYKGHNHPIWDVQFSPLGHYFA 583

Query: 544 ISLLDNTVKVFYLDSMKFFLSLY-GHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGD 602
            +  D T +++  D + F L ++ GH   V  +    +   + T S+DK  ++W +  GD
Sbjct: 584 TASHDQTARLWSCDHI-FPLRIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMWDISTGD 642

Query: 603 CHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAH-QSEVWSIAI 661
             +    H  ++++    P+     + S DG +  WD    + ++ L  H ++ V+S+  
Sbjct: 643 SVRLFLGHTSAVVSTAVSPDGRWLTTGSDDGTINVWDIGSGKRLKSLRGHGKNAVYSLTY 702

Query: 662 TSDGTSVISASHDHSLRVWE 681
           + +G  ++S+  D S+RVW+
Sbjct: 703 SKEGNLLVSSGADQSVRVWD 722

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 58/217 (26%), Positives = 97/217 (44%), Gaps = 31/217 (14%)

Query: 474 SLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSV 533
           SL+ + D R   TG  D  IK W+         GT+         ++    + N+D    
Sbjct: 460 SLEFSDDCRLASTGFQDSYIKIWSLD-------GTS---------LNTKFTQANKD--RN 501

Query: 534 RISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNI 593
           RI+  D+  +++ +DN +            +L GH   V S   S D++ +I+ S DK +
Sbjct: 502 RITITDR--SLTHMDNELSA----------TLIGHSGTVYSTSFSPDNRYLISGSEDKTV 549

Query: 594 KIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQ 653
           ++W LD      S   H   I +V+F P  H F ++S D   + W  D    ++  A H 
Sbjct: 550 RLWSLDTHTALVSYKGHNHPIWDVQFSPLGHYFATASHDQTARLWSCDHIFPLRIFAGHL 609

Query: 654 SEVWSIAITSDGTSVISASHDHSLRVWE-ETDDQVFL 689
           ++V  ++   +G  V + S D + R+W+  T D V L
Sbjct: 610 NDVDCVSFHPNGYYVFTGSSDKTCRMWDISTGDSVRL 646

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 64/143 (44%), Gaps = 6/143 (4%)

Query: 92  LAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSE 151
            A    D T ++W       L  F GH + +  + F   G  + +GS D    +WD+ + 
Sbjct: 582 FATASHDQTARLWSCDHIFPLRIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMWDISTG 641

Query: 152 VGLYKLRSHKDAI--SGIWCEGEDWLVSTSKDGLIKIWDL---KVQQCIETHIAHTGECW 206
             +     H  A+  + +  +G  WL + S DG I +WD+   K  + +  H  +     
Sbjct: 642 DSVRLFLGHTSAVVSTAVSPDGR-WLTTGSDDGTINVWDIGSGKRLKSLRGHGKNAVYSL 700

Query: 207 AMGVHEDLLITSGADTQLKLWNL 229
                 +LL++SGAD  +++W+L
Sbjct: 701 TYSKEGNLLVSSGADQSVRVWDL 723

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 56/113 (49%), Gaps = 2/113 (1%)

Query: 79  EVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGS 138
           +V  + +H     +  G  D T ++WD+ +   +  F GH SA+        G  L +GS
Sbjct: 611 DVDCVSFHPNGYYVFTGSSDKTCRMWDISTGDSVRLFLGHTSAVVSTAVSPDGRWLTTGS 670

Query: 139 RDSNIIVWDLVSEVGLYKLRSH-KDAISGIWCEGE-DWLVSTSKDGLIKIWDL 189
            D  I VWD+ S   L  LR H K+A+  +    E + LVS+  D  +++WDL
Sbjct: 671 DDGTINVWDIGSGKRLKSLRGHGKNAVYSLTYSKEGNLLVSSGADQSVRVWDL 723

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/182 (18%), Positives = 63/182 (34%), Gaps = 31/182 (17%)

Query: 79  EVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFN---------------------- 116
           +++ L + D+  L + G+ D  IK+W L   S+   F                       
Sbjct: 457 DMTSLEFSDDCRLASTGFQDSYIKIWSLDGTSLNTKFTQANKDRNRITITDRSLTHMDNE 516

Query: 117 ------GHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WC 169
                 GH   +    F      LISGS D  + +W L +   L   + H   I  + + 
Sbjct: 517 LSATLIGHSGTVYSTSFSPDNRYLISGSEDKTVRLWSLDTHTALVSYKGHNHPIWDVQFS 576

Query: 170 EGEDWLVSTSKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHED--LLITSGADTQLKLW 227
               +  + S D   ++W       +     H  +   +  H +   + T  +D   ++W
Sbjct: 577 PLGHYFATASHDQTARLWSCDHIFPLRIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMW 636

Query: 228 NL 229
           ++
Sbjct: 637 DI 638

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 11/65 (16%)

Query: 47  INIWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDL 106
           IN+WDI +G+ +  L           +      V  L Y  E NLL +   D +++VWDL
Sbjct: 675 INVWDIGSGKRLKSL-----------RGHGKNAVYSLTYSKEGNLLVSSGADQSVRVWDL 723

Query: 107 LSKSV 111
              S 
Sbjct: 724 FKPSA 728

>CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa]
           {ON} similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198c Transcription initiation factor TFIID 90
          Length = 806

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 70/297 (23%), Positives = 124/297 (41%), Gaps = 45/297 (15%)

Query: 389 DIRSVDISDDDKLLATA-SNGLLKVWNLKTKACIRVFDCGYALTCKFLPGGTLVIVGTRE 447
           D+ S++ SDD +L A    +  +K+W+L                     G +L+      
Sbjct: 475 DMTSLEFSDDCRLAAAGFQDSYIKIWSLD--------------------GSSLINPKYSS 514

Query: 448 GSLQLF--DLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLV 505
                F  D   STL+      H   ++S   + D   LV+GS DKT+K W+      LV
Sbjct: 515 SQFDRFSQDNTCSTLV-----GHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALV 569

Query: 506 PGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSL 565
                                N  V  V+ SP   + A +  D T +++  D +      
Sbjct: 570 ----------------NYKGHNHPVWDVKFSPLGHYFASASHDQTARLWACDHIYPLRIF 613

Query: 566 YGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHN 625
            GH   V ++    +   + T S+DK  ++W +  GD  +    H   +++ +  P+   
Sbjct: 614 AGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRW 673

Query: 626 FFSSSKDGLVKYWDGDKFECIQKLAAH-QSEVWSIAITSDGTSVISASHDHSLRVWE 681
             + S+DG++  WD    + I+++  H ++ V S++   +G  +IS   DHS+RVW+
Sbjct: 674 LATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWD 730

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 84/194 (43%), Gaps = 23/194 (11%)

Query: 515 VMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFF------------ 562
            M   H+T    N D+ S+  S + +  A    D+ +K++ LD                 
Sbjct: 465 CMYTFHNT----NRDMTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRF 520

Query: 563 ------LSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMN 616
                  +L GH   V S   S D+  +++ S DK +K+W +D      +   H   + +
Sbjct: 521 SQDNTCSTLVGHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWD 580

Query: 617 VKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHS 676
           VKF P  H F S+S D   + W  D    ++  A H ++V +++   +G  V + S D +
Sbjct: 581 VKFSPLGHYFASASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKT 640

Query: 677 LRVWE-ETDDQVFL 689
            R+W+  T D V L
Sbjct: 641 CRMWDVSTGDSVRL 654

 Score = 55.1 bits (131), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 66/145 (45%), Gaps = 6/145 (4%)

Query: 90  NLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLV 149
           +  A+   D T ++W       L  F GH + +  + F   G  + +GS D    +WD+ 
Sbjct: 588 HYFASASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVS 647

Query: 150 SEVGLYKLRSHKDAI--SGIWCEGEDWLVSTSKDGLIKIWDLKVQQCIETHIAHTGEC-- 205
           +   +     H   +  + +  +G  WL + S+DG+I +WD+   + I+    H      
Sbjct: 648 TGDSVRLFLGHTAPVLSTQVSPDGR-WLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVH 706

Query: 206 -WAMGVHEDLLITSGADTQLKLWNL 229
             +     ++LI+ GAD  +++W++
Sbjct: 707 SLSFNKEGNVLISGGADHSVRVWDV 731

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 34/172 (19%), Positives = 66/172 (38%), Gaps = 21/172 (12%)

Query: 79  EVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVL------------------LTFNGHKS 120
           +++ L + D+  L AAG+ D  IK+W L   S++                   T  GH  
Sbjct: 475 DMTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGHSG 534

Query: 121 AITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGEDWLVSTS 179
            +    F      L+SGS D  + +W + +   L   + H   +  + +     +  S S
Sbjct: 535 TVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASAS 594

Query: 180 KDGLIKIWDLKVQQCIETHIAHTGECWAMGVHED--LLITSGADTQLKLWNL 229
            D   ++W       +     HT +   +  H +   + T  +D   ++W++
Sbjct: 595 HDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDV 646

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 70/144 (48%), Gaps = 9/144 (6%)

Query: 79  EVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGS 138
           +V  + +H     +  G  D T ++WD+ +   +  F GH + +   +    G  L +GS
Sbjct: 619 DVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGS 678

Query: 139 RDSNIIVWDLVSEVGLYKLRSH-KDAISGIWCEGE-DWLVSTSKDGLIKIWDLK---VQQ 193
            D  I +WD+ +   + ++R H K+A+  +    E + L+S   D  +++WD+K    +Q
Sbjct: 679 EDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDVKHGTTEQ 738

Query: 194 CIETHI---AHTGECWAMGVHEDL 214
             E      AH G+  A  +++D+
Sbjct: 739 GPEPEQPFNAHVGDITA-SINQDI 761

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 57/146 (39%), Gaps = 3/146 (2%)

Query: 92  LAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSE 151
           L +G  D T+K+W + + + L+ + GH   +  +KF   G    S S D    +W     
Sbjct: 548 LVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASASHDQTARLWACDHI 607

Query: 152 VGLYKLRSHKDAISGIWCEGEDWLVST-SKDGLIKIWDLKVQQCIETHIAHTGECWAMGV 210
             L     H + +  +        V T S D   ++WD+     +   + HT    +  V
Sbjct: 608 YPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQV 667

Query: 211 HED--LLITSGADTQLKLWNLDFSKE 234
             D   L T   D  + LW++   K 
Sbjct: 668 SPDGRWLATGSEDGVICLWDIGTGKR 693

 Score = 33.5 bits (75), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 64/146 (43%), Gaps = 24/146 (16%)

Query: 385 GHRTDIRSVDISDDDKLLATAS-NGLLKVWNLKTKACI---RVFDCGYALTCKFLPGGTL 440
           GH   + S  +S D + LAT S +G++ +W++ T   I   R        +  F   G +
Sbjct: 657 GHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNV 716

Query: 441 VIVGTREGSLQLFDLASSTLLENKE-----DAHE---TAIWSLDITSDGRRLVTGSADKT 492
           +I G  + S++++D+   T  +  E     +AH    TA  + DI   GRR       +T
Sbjct: 717 LISGGADHSVRVWDVKHGTTEQGPEPEQPFNAHVGDITASINQDIKDYGRR-------RT 769

Query: 493 IKFWNFQVEEDLVPGTADKYLPVMKL 518
           I   N     DLV     K  PV K+
Sbjct: 770 IIPTN-----DLVASFYTKRSPVFKV 790

>ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON}
           similar to uniprot|P20053 Saccharomyces cerevisiae
           YPR178W PRP4 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 466

 Score = 90.1 bits (222), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 77/312 (24%), Positives = 139/312 (44%), Gaps = 31/312 (9%)

Query: 381 IELPGHRT----DIRSVDISDDDKLLATAS-NGLLKVWN------LKTKACIRVFDCGYA 429
           IEL G +      +  V +S +  L+A AS  G L + N      L+ K  I +   G  
Sbjct: 170 IELMGSQVVSTRPVSQVSLSPNGSLVAAASWAGDLTILNSQTLEILQNKPQIHMGKIG-- 227

Query: 430 LTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKE-DAHETAIWSLDITSDGRRLVTGS 488
               + P G L+  G  EGS++LF   S+TL E    + HE  +        GR + + S
Sbjct: 228 -GIHWSPTGDLITAGGEEGSVKLFGYKSNTLEEMATLNGHENRVTDSKFHPSGRFIASAS 286

Query: 489 ADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLD 548
            D T + W+ + +E+L+          ++  H       +++ S+    +   +    +D
Sbjct: 287 FDMTWRLWDVETQEELL----------LQEGH------GKELYSLGFQCDGSLVCSGGID 330

Query: 549 NTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLF 608
               V+ + S K  +SL GH  P+ S+D S +   + T S D  I+IW L   + ++++ 
Sbjct: 331 CKGLVWDIRSGKRAMSLSGHTKPIYSLDWSPNGYQVATGSGDGTIRIWDLRKPEEYQTIL 390

Query: 609 AHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSV 668
           AH+  +  V F    +   SS  D  +  +    +  +  L  H  ++  + I+ + +SV
Sbjct: 391 AHKSIVTKVAFEKNGNCLVSSGYDKSINLYGAYNWAQLTTLQGHMDKILCVDISENASSV 450

Query: 669 ISASHDHSLRVW 680
           +S   D S+++W
Sbjct: 451 VSCGWDRSVKLW 462

 Score = 52.4 bits (124), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 65/143 (45%), Gaps = 13/143 (9%)

Query: 49  IWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLS 108
           +WDI++G+    LS            +KP  +  L +      +A G  DGTI++WDL  
Sbjct: 335 VWDIRSGKRAMSLSG----------HTKP--IYSLDWSPNGYQVATGSGDGTIRIWDLRK 382

Query: 109 KSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI- 167
                T   HKS +T + F+  G  L+S   D +I ++   +   L  L+ H D I  + 
Sbjct: 383 PEEYQTILAHKSIVTKVAFEKNGNCLVSSGYDKSINLYGAYNWAQLTTLQGHMDKILCVD 442

Query: 168 WCEGEDWLVSTSKDGLIKIWDLK 190
             E    +VS   D  +K+W ++
Sbjct: 443 ISENASSVVSCGWDRSVKLWTMQ 465

 Score = 52.0 bits (123), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 92/203 (45%), Gaps = 17/203 (8%)

Query: 32  KSNSPGSVITSALENI--NIWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDET 89
           K +  G  I SA  ++   +WD++T E + +L +G              E+  L +  + 
Sbjct: 274 KFHPSGRFIASASFDMTWRLWDVETQEEL-LLQEG-----------HGKELYSLGFQCDG 321

Query: 90  NLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLV 149
           +L+ +G +D    VWD+ S    ++ +GH   I  + +   G ++ +GS D  I +WDL 
Sbjct: 322 SLVCSGGIDCKGLVWDIRSGKRAMSLSGHTKPIYSLDWSPNGYQVATGSGDGTIRIWDLR 381

Query: 150 SEVGLYKLRSHKDAISGIWCE-GEDWLVSTSKDGLIKIWDLKVQQCIETHIAHTGECWAM 208
                  + +HK  ++ +  E   + LVS+  D  I ++       + T   H  +   +
Sbjct: 382 KPEEYQTILAHKSIVTKVAFEKNGNCLVSSGYDKSINLYGAYNWAQLTTLQGHMDKILCV 441

Query: 209 GVHEDL--LITSGADTQLKLWNL 229
            + E+   +++ G D  +KLW +
Sbjct: 442 DISENASSVVSCGWDRSVKLWTM 464

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/215 (21%), Positives = 91/215 (42%), Gaps = 51/215 (23%)

Query: 65  LPAGSIDVKSSKP----AEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSV--LLTFNGH 118
           L + ++++  +KP     ++  +H+    +L+ AG  +G++K++   S ++  + T NGH
Sbjct: 207 LNSQTLEILQNKPQIHMGKIGGIHWSPTGDLITAGGEEGSVKLFGYKSNTLEEMATLNGH 266

Query: 119 KSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAI-------------- 164
           ++ +T  KF  +G  + S S D    +WD+ ++  L     H   +              
Sbjct: 267 ENRVTDSKFHPSGRFIASASFDMTWRLWDVETQEELLLQEGHGKELYSLGFQCDGSLVCS 326

Query: 165 SGIWCEGEDW-----------------------------LVSTSKDGLIKIWDLKVQQCI 195
            GI C+G  W                             + + S DG I+IWDL+  +  
Sbjct: 327 GGIDCKGLVWDIRSGKRAMSLSGHTKPIYSLDWSPNGYQVATGSGDGTIRIWDLRKPEEY 386

Query: 196 ETHIAHTGECWAMGVHE--DLLITSGADTQLKLWN 228
           +T +AH      +   +  + L++SG D  + L+ 
Sbjct: 387 QTILAHKSIVTKVAFEKNGNCLVSSGYDKSINLYG 421

 Score = 38.5 bits (88), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 49/116 (42%), Gaps = 2/116 (1%)

Query: 568 HKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHK--SLFAHQDSIMNVKFLPESHN 625
           H   +  I  S    LI     + ++K++G       +  +L  H++ + + KF P    
Sbjct: 222 HMGKIGGIHWSPTGDLITAGGEEGSVKLFGYKSNTLEEMATLNGHENRVTDSKFHPSGRF 281

Query: 626 FFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWE 681
             S+S D   + WD +  E +     H  E++S+    DG+ V S   D    VW+
Sbjct: 282 IASASFDMTWRLWDVETQEELLLQEGHGKELYSLGFQCDGSLVCSGGIDCKGLVWD 337

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 58/126 (46%), Gaps = 10/126 (7%)

Query: 380 TIELPGHRTDIRSVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFDCGYALTCK--FLP 436
            + L GH   I S+D S +   +AT S +G +++W+L+     +      ++  K  F  
Sbjct: 344 AMSLSGHTKPIYSLDWSPNGYQVATGSGDGTIRIWDLRKPEEYQTILAHKSIVTKVAFEK 403

Query: 437 GGTLVIVGTREGSLQLF---DLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTI 493
            G  ++    + S+ L+   + A  T L+     H   I  +DI+ +   +V+   D+++
Sbjct: 404 NGNCLVSSGYDKSINLYGAYNWAQLTTLQ----GHMDKILCVDISENASSVVSCGWDRSV 459

Query: 494 KFWNFQ 499
           K W  Q
Sbjct: 460 KLWTMQ 465

>Kpol_1013.37 s1013
           complement(88637..88936,88986..88994,89037..90134) [1407
           bp, 468 aa] {ON}
           complement(88637..88936,88986..88994,89037..90134) [1407
           nt, 469 aa]
          Length = 468

 Score = 89.7 bits (221), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 74/274 (27%), Positives = 122/274 (44%), Gaps = 30/274 (10%)

Query: 436 PGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKF 495
           P GT    G+  G + +F+  +   +    + H   I  +D +SD R LV+G  D  +K 
Sbjct: 191 PEGTCTAAGSWAGDISIFNTKTLAPVITSRETHSGKISGIDWSSDSRHLVSGGEDGIVKL 250

Query: 496 WNF-----QVEEDLVPGTAD----KYLPVMKLI----HDTTMEV---------------N 527
           +NF     QV    +   A     K+ P  K I     DTT  +               +
Sbjct: 251 YNFDSNSIQVATSFIGHDARVTNVKFHPSQKYIGSASFDTTWRLWDIVTNSELLLQEGHS 310

Query: 528 EDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITS 587
           +++ S+    +   +A +  D    ++ L S K  LSL GH  P+   D S  +      
Sbjct: 311 KEIYSLSFQTDGSLIATAGADKVGIIWDLRSGKNILSLVGHAKPIYCSDWS-QNGYQXXX 369

Query: 588 SADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFF-SSSKDGLVKYWDGDKFECI 646
           S D  IKIW L   D  +++ AH++ + ++KF  E+  F  SSS D  +  +  D +  I
Sbjct: 370 SGDGTIKIWDLRKVDDVETILAHKNVVTDLKFEKENSKFLISSSYDKDINVFSSDSWVKI 429

Query: 647 QKLAAHQSEVWSIAITSDGTSVISASHDHSLRVW 680
             L  H  ++ SI I+SD  +++S   D S+++W
Sbjct: 430 HTLQGHNDKILSIDISSDYQTIVSGGWDRSVKLW 463

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 87/198 (43%), Gaps = 22/198 (11%)

Query: 50  WDIKTGELISVLSDGL------PAGSIDVKSS---KPAEVSYLHYHDETNLLAAGYMDGT 100
           W   +  L+S   DG+       + SI V +S     A V+ + +H     + +   D T
Sbjct: 232 WSSDSRHLVSGGEDGIVKLYNFDSNSIQVATSFIGHDARVTNVKFHPSQKYIGSASFDTT 291

Query: 101 IKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSH 160
            ++WD+++ S LL   GH   I  + F   G+ + +   D   I+WDL S   +  L  H
Sbjct: 292 WRLWDIVTNSELLLQEGHSKEIYSLSFQTDGSLIATAGADKVGIIWDLRSGKNILSLVGH 351

Query: 161 KDAISGIWCEGEDW-----LVSTSKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHED-- 213
                 I+C   DW         S DG IKIWDL+    +ET +AH      +   ++  
Sbjct: 352 AKP---IYC--SDWSQNGYQXXXSGDGTIKIWDLRKVDDVETILAHKNVVTDLKFEKENS 406

Query: 214 -LLITSGADTQLKLWNLD 230
             LI+S  D  + +++ D
Sbjct: 407 KFLISSSYDKDINVFSSD 424

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/245 (22%), Positives = 107/245 (43%), Gaps = 32/245 (13%)

Query: 386 HRTDIRSVDISDDDK-LLATASNGLLKVWNLKTK----ACIRVFDCGYALTCKFLPGGTL 440
           H   I  +D S D + L++   +G++K++N  +     A   +         KF P    
Sbjct: 223 HSGKISGIDWSSDSRHLVSGGEDGIVKLYNFDSNSIQVATSFIGHDARVTNVKFHPSQKY 282

Query: 441 VIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQV 500
           +   + + + +L+D+ +++ L  +E  H   I+SL   +DG  + T  ADK    W+ + 
Sbjct: 283 IGSASFDTTWRLWDIVTNSELLLQE-GHSKEIYSLSFQTDGSLIATAGADKVGIIWDLRS 341

Query: 501 EEDLVP---------------------GTADKYLPVMKLIH----DTTMEVNEDVLSVRI 535
            ++++                       + D  + +  L      +T +     V  ++ 
Sbjct: 342 GKNILSLVGHAKPIYCSDWSQNGYQXXXSGDGTIKIWDLRKVDDVETILAHKNVVTDLKF 401

Query: 536 SPED-KFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIK 594
             E+ KFL  S  D  + VF  DS     +L GH   +LSIDIS D + I++   D+++K
Sbjct: 402 EKENSKFLISSSYDKDINVFSSDSWVKIHTLQGHNDKILSIDISSDYQTIVSGGWDRSVK 461

Query: 595 IWGLD 599
           +W ++
Sbjct: 462 LWSME 466

 Score = 48.5 bits (114), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 72/170 (42%), Gaps = 10/170 (5%)

Query: 522 TTMEVN-EDVLSVR------ISPEDKFLAISLLDNTVKVFYLDSMK-FFLSLYGHKLPVL 573
           TT+++N   V+S R      ISPE    A       + +F   ++     S   H   + 
Sbjct: 169 TTVQLNGSQVISSRPISKICISPEGTCTAAGSWAGDISIFNTKTLAPVITSRETHSGKIS 228

Query: 574 SIDISFDSKLIITSSADKNIKIWGLDFGDCH--KSLFAHQDSIMNVKFLPESHNFFSSSK 631
            ID S DS+ +++   D  +K++  D        S   H   + NVKF P      S+S 
Sbjct: 229 GIDWSSDSRHLVSGGEDGIVKLYNFDSNSIQVATSFIGHDARVTNVKFHPSQKYIGSASF 288

Query: 632 DGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWE 681
           D   + WD      +     H  E++S++  +DG+ + +A  D    +W+
Sbjct: 289 DTTWRLWDIVTNSELLLQEGHSKEIYSLSFQTDGSLIATAGADKVGIIWD 338

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 68/145 (46%), Gaps = 15/145 (10%)

Query: 49  IWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLS 108
           IWD+++G+ I  L          V  +KP    Y     +         DGTIK+WDL  
Sbjct: 336 IWDLRSGKNILSL----------VGHAKPI---YCSDWSQNGYQXXXSGDGTIKIWDLRK 382

Query: 109 KSVLLTFNGHKSAITVMKFDVTGTR-LISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI 167
              + T   HK+ +T +KF+   ++ LIS S D +I V+   S V ++ L+ H D I  I
Sbjct: 383 VDDVETILAHKNVVTDLKFEKENSKFLISSSYDKDINVFSSDSWVKIHTLQGHNDKILSI 442

Query: 168 WCEGE-DWLVSTSKDGLIKIWDLKV 191
               +   +VS   D  +K+W ++ 
Sbjct: 443 DISSDYQTIVSGGWDRSVKLWSMEA 467

 Score = 35.8 bits (81), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 56/128 (43%), Gaps = 14/128 (10%)

Query: 381 IELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLKTKACIRVFDCGYALTCKFL----- 435
           + L GH   I   D S +      + +G +K+W+L+     +V D    L  K +     
Sbjct: 346 LSLVGHAKPIYCSDWSQNGYQXXXSGDGTIKIWDLR-----KVDDVETILAHKNVVTDLK 400

Query: 436 ---PGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKT 492
                   +I  + +  + +F   S   +   +  H   I S+DI+SD + +V+G  D++
Sbjct: 401 FEKENSKFLISSSYDKDINVFSSDSWVKIHTLQ-GHNDKILSIDISSDYQTIVSGGWDRS 459

Query: 493 IKFWNFQV 500
           +K W+ + 
Sbjct: 460 VKLWSMEA 467

>TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa]
           {ON} Anc_6.363 YCR084C
          Length = 657

 Score = 90.5 bits (223), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 72/285 (25%), Positives = 127/285 (44%), Gaps = 50/285 (17%)

Query: 428 YALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTG 487
           Y  +  F P G  +  G  +  ++++D+A   ++   +  HE  I+SLD    G +LV+G
Sbjct: 377 YIRSVCFSPDGKFLATGAEDRLIRIWDIAKKQIVMVLQ-GHEQDIYSLDYFPSGDKLVSG 435

Query: 488 SADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPED-KFLAISL 546
           S D+T++ W+ +  +  +                 T+ + + V +V +SP D KF+A   
Sbjct: 436 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKFIAAGS 478

Query: 547 LDNTVKVFYLDSMKFFLSLY---------GHKLPVLSIDISFDSKLIITSSADKNIKIWG 597
           LD  V+V+  DS   FL            GHK  V S+  + D   +++ S D+++K+W 
Sbjct: 479 LDRAVRVW--DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWN 536

Query: 598 L------------DFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFEC 645
           L              G C  +   H+D +++V          S SKD  V +WD      
Sbjct: 537 LRGDKNNSSSGKPTPGTCEVTYTGHKDFVLSVATTQNDQYILSGSKDRGVLFWDTQSGNP 596

Query: 646 IQKLAAHQSEVWSIAITSDGTSV-------ISASHDHSLRVWEET 683
           +  L  H++ V S+A+ ++G  +        + S D   R+W+ T
Sbjct: 597 LLMLQGHRNSVISVAV-ANGFPLGPQYGVFATGSGDCKARIWKYT 640

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 82/165 (49%), Gaps = 9/165 (5%)

Query: 530 VLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSA 589
           + SV  SP+ KFLA    D  ++++ +   +  + L GH+  + S+D       +++ S 
Sbjct: 378 IRSVCFSPDGKFLATGAEDRLIRIWDIAKKQIVMVLQGHEQDIYSLDYFPSGDKLVSGSG 437

Query: 590 DKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSS-SKDGLVKYWDGDKFECIQK 648
           D+ ++IW L  G C  +L + +D +  V   P    F ++ S D  V+ WD +    +++
Sbjct: 438 DRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETGFLVER 496

Query: 649 L-------AAHQSEVWSIAITSDGTSVISASHDHSLRVWEETDDQ 686
           L         H+  V+S+  T DG  V+S S D S+++W    D+
Sbjct: 497 LDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRGDK 541

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 62/248 (25%), Positives = 114/248 (45%), Gaps = 40/248 (16%)

Query: 383 LPGHRTDIRSVD-ISDDDKLLATASNGLLKVWNLKTKACIRVFDCGYALTCKFL-PG-GT 439
           L GH  DI S+D     DKL++ + +  +++W+L+T  C         +T   + PG G 
Sbjct: 413 LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGK 472

Query: 440 LVIVGTREGSLQLFDLASSTLLENKED------AHETAIWSLDITSDGRRLVTGSADKTI 493
            +  G+ + +++++D  +  L+E  +        H+ +++S+  T DG  +V+GS D+++
Sbjct: 473 FIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSV 532

Query: 494 KFWNFQVEED------LVPGTADKYLPVMKLIHDTTMEVNED-VLSVRISPEDKFLAISL 546
           K WN + +++        PGT            + T   ++D VLSV  +  D+++    
Sbjct: 533 KLWNLRGDKNNSSSGKPTPGTC-----------EVTYTGHKDFVLSVATTQNDQYILSGS 581

Query: 547 LDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKL------IITSSADKNIKIW---- 596
            D  V  +   S    L L GH+  V+S+ ++    L        T S D   +IW    
Sbjct: 582 KDRGVLFWDTQSGNPLLMLQGHRNSVISVAVANGFPLGPQYGVFATGSGDCKARIWKYTK 641

Query: 597 ---GLDFG 601
              G+D G
Sbjct: 642 TDAGIDSG 649

 Score = 61.2 bits (147), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 101/238 (42%), Gaps = 35/238 (14%)

Query: 33  SNSPGSVITSALENINIWDIKTGELISVLSD------GLPAGSI--------DVKSSKPA 78
           SN    + T   +   ++ +  G LI+ LSD        PAGS         DV S   A
Sbjct: 310 SNDGEYLATGCNKTTQVFRVSDGALIARLSDDAASQVAAPAGSPANADEPNNDVNSFVTA 369

Query: 79  E-------VSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTG 131
           +       +  + +  +   LA G  D  I++WD+  K +++   GH+  I  + +  +G
Sbjct: 370 KSASSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAKKQIVMVLQGHEQDIYSLDYFPSG 429

Query: 132 TRLISGSRDSNIIVWDLVSEVGLYKLR-SHKDAISGIWCEGED--WLVSTSKDGLIKIWD 188
            +L+SGS D  + +WDL    G   L  S +D ++ +     D  ++ + S D  +++WD
Sbjct: 430 DKLVSGSGDRTVRIWDL--RTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWD 487

Query: 189 LKVQQCIET-------HIAHTGECWAMGVHED--LLITSGADTQLKLWNLDFSKEAGS 237
            +    +E           H    +++    D   +++   D  +KLWNL   K   S
Sbjct: 488 SETGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRGDKNNSS 545

 Score = 58.9 bits (141), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 65/276 (23%), Positives = 123/276 (44%), Gaps = 43/276 (15%)

Query: 390 IRSVDISDDDKLLAT-ASNGLLKVWNLKTKACIRVFDCG----YALTCKFLPGGTLVIVG 444
           IRSV  S D K LAT A + L+++W++  K  + V        Y+L   + P G  ++ G
Sbjct: 378 IRSVCFSPDGKFLATGAEDRLIRIWDIAKKQIVMVLQGHEQDIYSL--DYFPSGDKLVSG 435

Query: 445 TREGSLQLFDLASS--TLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEE 502
           + + +++++DL +   +L  + ED   T   S     DG+ +  GS D+ ++ W+ +   
Sbjct: 436 SGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVS---PGDGKFIAAGSLDRAVRVWDSET-- 490

Query: 503 DLVPGTADKYLPVMKLIHDTTMEVN--EDVLSVRISPEDKFLAISLLDNTVKVFYLDSMK 560
                    +L V +L  +  +     + V SV  + +   +    LD +VK++ L   K
Sbjct: 491 --------GFL-VERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRGDK 541

Query: 561 ------------FFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLF 608
                         ++  GHK  VLS+  + + + I++ S D+ +  W    G+    L 
Sbjct: 542 NNSSSGKPTPGTCEVTYTGHKDFVLSVATTQNDQYILSGSKDRGVLFWDTQSGNPLLMLQ 601

Query: 609 AHQDSIMNVKFL------PESHNFFSSSKDGLVKYW 638
            H++S+++V         P+   F + S D   + W
Sbjct: 602 GHRNSVISVAVANGFPLGPQYGVFATGSGDCKARIW 637

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 75/172 (43%), Gaps = 25/172 (14%)

Query: 7   RFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISVL--SDG 64
           R  Q S+   I      V +SP   K  + GS+  +    + +WD +TG L+  L   + 
Sbjct: 447 RTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRA----VRVWDSETGFLVERLDSENE 502

Query: 65  LPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDL------------LSKSVL 112
           L  G  D        V  + +  + N + +G +D ++K+W+L               +  
Sbjct: 503 LGTGHKD-------SVYSVVFTRDGNGVVSGSLDRSVKLWNLRGDKNNSSSGKPTPGTCE 555

Query: 113 LTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAI 164
           +T+ GHK  +  +        ++SGS+D  ++ WD  S   L  L+ H++++
Sbjct: 556 VTYTGHKDFVLSVATTQNDQYILSGSKDRGVLFWDTQSGNPLLMLQGHRNSV 607

>SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some
           similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 660

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 83/360 (23%), Positives = 148/360 (41%), Gaps = 84/360 (23%)

Query: 386 HRTDIRSVDISDDDKLLATASNGLLKVWNLKTKACI-RVFDCGYALTCK----------- 433
           H + +  V  S+D + LAT  N   +V+ + T A + R+ D   + T             
Sbjct: 303 HSSVVCCVRFSNDGEYLATGCNKTTQVYKVSTGALVARLSDDSASTTANSSISQDANNSG 362

Query: 434 -----------------------FLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHET 470
                                  F P G  +  G  +  ++++DL++  ++   +  HE 
Sbjct: 363 ENGENAVSSASTSSSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLSTKRIVMTLQ-GHEQ 421

Query: 471 AIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDV 530
            I+SLD    G +LV+GS D+T++ W+ +  +  +                 T+ + + V
Sbjct: 422 DIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSL-----------------TLSIEDGV 464

Query: 531 LSVRISP-EDKFLAISLLDNTVKVFYLDSMKFFLSLY---------GHKLPVLSIDISFD 580
            +V +SP E KF+A   LD T++V+  DS   FL            GHK  V S+  + D
Sbjct: 465 TTVAVSPGEGKFIAAGSLDRTLRVW--DSETGFLVERLDSENELGTGHKDSVYSVVFTRD 522

Query: 581 SKLIITSSADKNIKIWGLD-------------FGDCHKSLFAHQDSIMNVKFLPESHNFF 627
            + +++ S D+++K+W L                 C  +   H+D +++V          
Sbjct: 523 GQGVVSGSLDRSVKLWNLHNTGSSSKNDSKPTAATCEVTYTGHKDFVLSVATTQNDKYIL 582

Query: 628 SSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITS------DGTSVISASHDHSLRVWE 681
           S SKD  V +WD      +  L  H++ V S+A+ +      D     + S D   R+W+
Sbjct: 583 SGSKDRGVLFWDTQSGNPLLMLQGHRNSVISVAVANGFPLGPDYGVFATGSGDCKARIWK 642

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 109/236 (46%), Gaps = 18/236 (7%)

Query: 376 TRLYTIELPGHRTDIRSVD-ISDDDKLLATASNGLLKVWNLKTKACIRVFDCGYALTCKF 434
           T+   + L GH  DI S+D     DKL++ + +  +++W+L+T  C         +T   
Sbjct: 409 TKRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVA 468

Query: 435 L-PG-GTLVIVGTREGSLQLFDLASSTLLENKED------AHETAIWSLDITSDGRRLVT 486
           + PG G  +  G+ + +L+++D  +  L+E  +        H+ +++S+  T DG+ +V+
Sbjct: 469 VSPGEGKFIAAGSLDRTLRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGQGVVS 528

Query: 487 GSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISL 546
           GS D+++K WN     +    + +   P       T     + VLSV  +  DK++    
Sbjct: 529 GSLDRSVKLWNLH---NTGSSSKNDSKPTAATCEVTYTGHKDFVLSVATTQNDKYILSGS 585

Query: 547 LDNTVKVFYLDSMKFFLSLYGHKLPVLSIDIS------FDSKLIITSSADKNIKIW 596
            D  V  +   S    L L GH+  V+S+ ++       D  +  T S D   +IW
Sbjct: 586 KDRGVLFWDTQSGNPLLMLQGHRNSVISVAVANGFPLGPDYGVFATGSGDCKARIW 641

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 75/152 (49%), Gaps = 16/152 (10%)

Query: 91  LLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVS 150
            LA G  D  I++WDL +K +++T  GH+  I  + +  +G +L+SGS D  + +WDL  
Sbjct: 392 FLATGAEDKLIRIWDLSTKRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDL-- 449

Query: 151 EVGLYKLR-SHKDAISGIWC---EGEDWLVSTSKDGLIKIWDLKVQQCIET-------HI 199
             G   L  S +D ++ +     EG+ ++ + S D  +++WD +    +E          
Sbjct: 450 RTGQCSLTLSIEDGVTTVAVSPGEGK-FIAAGSLDRTLRVWDSETGFLVERLDSENELGT 508

Query: 200 AHTGECWAMGVHED--LLITSGADTQLKLWNL 229
            H    +++    D   +++   D  +KLWNL
Sbjct: 509 GHKDSVYSVVFTRDGQGVVSGSLDRSVKLWNL 540

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 86/203 (42%), Gaps = 33/203 (16%)

Query: 7   RFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISVL--SDG 64
           R  Q S+   I      V +SP   K  + GS+       + +WD +TG L+  L   + 
Sbjct: 450 RTGQCSLTLSIEDGVTTVAVSPGEGKFIAAGSLD----RTLRVWDSETGFLVERLDSENE 505

Query: 65  LPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDL-------------LSKSV 111
           L  G  D        V  + +  +   + +G +D ++K+W+L              + + 
Sbjct: 506 LGTGHKD-------SVYSVVFTRDGQGVVSGSLDRSVKLWNLHNTGSSSKNDSKPTAATC 558

Query: 112 LLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKD-----AISG 166
            +T+ GHK  +  +        ++SGS+D  ++ WD  S   L  L+ H++     A++ 
Sbjct: 559 EVTYTGHKDFVLSVATTQNDKYILSGSKDRGVLFWDTQSGNPLLMLQGHRNSVISVAVAN 618

Query: 167 IWCEGEDWLV--STSKDGLIKIW 187
            +  G D+ V  + S D   +IW
Sbjct: 619 GFPLGPDYGVFATGSGDCKARIW 641

>Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON}
           (63032..65266) [2235 nt, 745 aa]
          Length = 744

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 75/283 (26%), Positives = 126/283 (44%), Gaps = 47/283 (16%)

Query: 428 YALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTG 487
           Y  +  F P G  +  G  +  ++++D+A   ++   +  HE  I+SLD    G +LV+G
Sbjct: 464 YIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQ-GHEQDIYSLDYFPSGDKLVSG 522

Query: 488 SADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPED-KFLAISL 546
           S D+T++ W      DL  G               T+ + + V +V +SP D K++A   
Sbjct: 523 SGDRTVRIW------DLRNGQC-----------SLTLSIEDGVTTVAVSPGDGKYIAAGS 565

Query: 547 LDNTVKVFYLDSMKFFLSLY---------GHKLPVLSIDISFDSKLIITSSADKNIKIWG 597
           LD  V+V+  DS   FL            GHK  V S+  + D   +++ S D+++K+W 
Sbjct: 566 LDRAVRVW--DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWN 623

Query: 598 LD-----------FGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECI 646
           L             G C  +   H+D +++V          S SKD  V +WD      +
Sbjct: 624 LRGDNNQDVKPNVPGTCEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPL 683

Query: 647 QKLAAHQSEVWSIAITSD---GTSV---ISASHDHSLRVWEET 683
             L  H++ V S+A+ +    G +V    + S D   R+W+ T
Sbjct: 684 LMLQGHRNSVISVAVANGFPLGPNVGVFATGSGDCKARIWKYT 726

 Score = 80.9 bits (198), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 61/249 (24%), Positives = 106/249 (42%), Gaps = 47/249 (18%)

Query: 468 HETAIWSLDITSDGRRLVTGSADKTIKF-----------------WNFQVEEDLVPGTAD 510
           H + +  +  ++DG+ L TG    T  F                    Q + D   GTAD
Sbjct: 385 HTSVVCCVRFSNDGQFLATGCNKTTQVFRVSDGELVARLSDDSTSQGVQGQSDAANGTAD 444

Query: 511 KYLPVMKLIHDTTMEVNED-----------VLSVRISPEDKFLAISLLDNTVKVFYLDSM 559
                      T+ E N             + SV  SP+ KFLA    D  ++++ +   
Sbjct: 445 ----------GTSGETNSFATSTSASSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAQK 494

Query: 560 KFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKF 619
           K  + L GH+  + S+D       +++ S D+ ++IW L  G C  +L + +D +  V  
Sbjct: 495 KIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRNGQCSLTL-SIEDGVTTVAV 553

Query: 620 LPESHNFFSS-SKDGLVKYWDGDKFECIQKL-------AAHQSEVWSIAITSDGTSVISA 671
            P    + ++ S D  V+ WD +    +++L         H+  V+S+  T DG +V+S 
Sbjct: 554 SPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSG 613

Query: 672 SHDHSLRVW 680
           S D S+++W
Sbjct: 614 SLDRSVKLW 622

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 113/243 (46%), Gaps = 32/243 (13%)

Query: 383 LPGHRTDIRSVD-ISDDDKLLATASNGLLKVWNLKTKACIRVFDCGYALTCKFL-PG-GT 439
           L GH  DI S+D     DKL++ + +  +++W+L+   C         +T   + PG G 
Sbjct: 500 LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRNGQCSLTLSIEDGVTTVAVSPGDGK 559

Query: 440 LVIVGTREGSLQLFDLASSTLLENKED------AHETAIWSLDITSDGRRLVTGSADKTI 493
            +  G+ + +++++D  +  L+E  +        H+ +++S+  T DG  +V+GS D+++
Sbjct: 560 YIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSV 619

Query: 494 KFWNFQVEEDL-----VPGTADKYLPVMKLIHDTTMEVNED-VLSVRISPEDKFLAISLL 547
           K WN + + +      VPGT            + T   ++D VLSV  +  D+++     
Sbjct: 620 KLWNLRGDNNQDVKPNVPGTC-----------EVTYTGHKDFVLSVATTQNDEYILSGSK 668

Query: 548 DNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSL 607
           D  V  +   S    L L GH+  V+S+ ++    L        N+ ++    GDC   +
Sbjct: 669 DRGVLFWDTKSGNPLLMLQGHRNSVISVAVANGFPL------GPNVGVFATGSGDCKARI 722

Query: 608 FAH 610
           + +
Sbjct: 723 WKY 725

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 73/156 (46%), Gaps = 12/156 (7%)

Query: 85  YHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNII 144
           +  +   LA G  D  I++WD+  K +++   GH+  I  + +  +G +L+SGS D  + 
Sbjct: 470 FSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVR 529

Query: 145 VWDLVSEVGLYKLRSHKDAISGIWCEGED--WLVSTSKDGLIKIWDLKVQQCIET----- 197
           +WDL +      L S +D ++ +     D  ++ + S D  +++WD +    +E      
Sbjct: 530 IWDLRNGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSEN 588

Query: 198 --HIAHTGECWAMGVHEDL--LITSGADTQLKLWNL 229
                H    +++    D   +++   D  +KLWNL
Sbjct: 589 ELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNL 624

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 88/212 (41%), Gaps = 47/212 (22%)

Query: 47  INIWDIKTGELISVLS--DGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVW 104
           + IWD++ G+    LS  DG+   ++      P +  Y+         AAG +D  ++VW
Sbjct: 528 VRIWDLRNGQCSLTLSIEDGVTTVAV-----SPGDGKYI---------AAGSLDRAVRVW 573

Query: 105 D---------LLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDL------- 148
           D         L S++ L T  GHK ++  + F   G  ++SGS D ++ +W+L       
Sbjct: 574 DSETGFLVERLDSENELGT--GHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLRGDNNQD 631

Query: 149 ----VSEVGLYKLRSHKD-AISGIWCEGEDWLVSTSKDGLIKIWDLKVQQCIETHIAH-- 201
               V          HKD  +S    + +++++S SKD  +  WD K    +     H  
Sbjct: 632 VKPNVPGTCEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRN 691

Query: 202 ------TGECWAMGVHEDLLITSGADTQLKLW 227
                     + +G +  +  T   D + ++W
Sbjct: 692 SVISVAVANGFPLGPNVGVFATGSGDCKARIW 723

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 76/169 (44%), Gaps = 20/169 (11%)

Query: 7   RFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISVLSDGLP 66
           R  Q S+   I      V +SP   K  + GS+  +    + +WD +TG L+  L     
Sbjct: 534 RNGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRA----VRVWDSETGFLVERLDSENE 589

Query: 67  AGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDL-----------LSKSVLLTF 115
            G+      K +  S +   D  N+++ G +D ++K+W+L           +  +  +T+
Sbjct: 590 LGT----GHKDSVYSVVFTRDGNNVVS-GSLDRSVKLWNLRGDNNQDVKPNVPGTCEVTY 644

Query: 116 NGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAI 164
            GHK  +  +        ++SGS+D  ++ WD  S   L  L+ H++++
Sbjct: 645 TGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSV 693

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 41/76 (53%)

Query: 614 IMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASH 673
           I +V F P+     + ++D L++ WD  + + +  L  H+ +++S+     G  ++S S 
Sbjct: 465 IRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSG 524

Query: 674 DHSLRVWEETDDQVFL 689
           D ++R+W+  + Q  L
Sbjct: 525 DRTVRIWDLRNGQCSL 540

>Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 90.5 bits (223), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 66/295 (22%), Positives = 127/295 (43%), Gaps = 40/295 (13%)

Query: 389 DIRSVDISDDDKLLATA-SNGLLKVWNLKTKACIRVFDCGYALTCKFLPGGTLVIVGTRE 447
           D+  +D SDD ++ A    +  +K+W+L           G +L           IV   E
Sbjct: 468 DMSCLDFSDDCRVAAAGFQDSYIKIWSLD----------GSSLN-------NPNIVLNNE 510

Query: 448 GSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPG 507
            + +  D    TL+      H   ++S   + D + L++GS DKT++ W+      LV  
Sbjct: 511 TNYKDDDPTCKTLV-----GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALV-- 563

Query: 508 TADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYG 567
                         +    N  V  V  SP   + A +  D T +++  D +       G
Sbjct: 564 --------------SYKGHNHPVWDVNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAG 609

Query: 568 HKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFF 627
           H   V  +    +   + T S+DK  ++W +  GD  +    H   ++++   P+     
Sbjct: 610 HLNDVDCVSFHPNGCYLFTGSSDKTCRMWNVSTGDSVRLFLGHTAPVISIAVSPDGRWLS 669

Query: 628 SSSKDGLVKYWDGDKFECIQKLAAH-QSEVWSIAITSDGTSVISASHDHSLRVWE 681
           + S+DG++  WD    + ++++  H ++ ++S++ + +G  +IS   DHS+RVW+
Sbjct: 670 TGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWD 724

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 63/136 (46%), Gaps = 1/136 (0%)

Query: 555 YLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSI 614
           Y D      +L GH   V S   S D+K +++ S DK +++W +D      S   H   +
Sbjct: 513 YKDDDPTCKTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPV 572

Query: 615 MNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHD 674
            +V F P  H F ++S D   + W  D    ++  A H ++V  ++   +G  + + S D
Sbjct: 573 WDVNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSD 632

Query: 675 HSLRVWE-ETDDQVFL 689
            + R+W   T D V L
Sbjct: 633 KTCRMWNVSTGDSVRL 648

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 62/142 (43%), Gaps = 4/142 (2%)

Query: 92  LAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSE 151
            A    D T ++W       L  F GH + +  + F   G  L +GS D    +W++ + 
Sbjct: 584 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNVSTG 643

Query: 152 VGLYKLRSHKDAISGIWCEGED-WLVSTSKDGLIKIWDLKVQQCIETHIAHTGEC---WA 207
             +     H   +  I    +  WL + S+DG+I +WD+   + ++    H        +
Sbjct: 644 DSVRLFLGHTAPVISIAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLS 703

Query: 208 MGVHEDLLITSGADTQLKLWNL 229
                ++LI+ GAD  +++W+L
Sbjct: 704 YSKEGNVLISGGADHSVRVWDL 725

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 58/114 (50%), Gaps = 2/114 (1%)

Query: 79  EVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGS 138
           +V  + +H     L  G  D T ++W++ +   +  F GH + +  +     G  L +GS
Sbjct: 613 DVDCVSFHPNGCYLFTGSSDKTCRMWNVSTGDSVRLFLGHTAPVISIAVSPDGRWLSTGS 672

Query: 139 RDSNIIVWDLVSEVGLYKLRSH-KDAISGI-WCEGEDWLVSTSKDGLIKIWDLK 190
            D  I VWD+ +   L ++R H K+AI  + + +  + L+S   D  +++WDLK
Sbjct: 673 EDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLK 726

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/173 (19%), Positives = 64/173 (36%), Gaps = 22/173 (12%)

Query: 79  EVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSV-------------------LLTFNGHK 119
           ++S L + D+  + AAG+ D  IK+W L   S+                     T  GH 
Sbjct: 468 DMSCLDFSDDCRVAAAGFQDSYIKIWSLDGSSLNNPNIVLNNETNYKDDDPTCKTLVGHS 527

Query: 120 SAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGEDWLVST 178
             +    F      L+SGS D  + +W + +   L   + H   +  + +     +  + 
Sbjct: 528 GTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATA 587

Query: 179 SKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHED--LLITSGADTQLKLWNL 229
           S D   ++W       +     H  +   +  H +   L T  +D   ++WN+
Sbjct: 588 SHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNV 640

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 31/156 (19%), Positives = 65/156 (41%), Gaps = 9/156 (5%)

Query: 85  YHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNII 144
           +  +   L +G  D T+++W + + + L+++ GH   +  + F   G    + S D    
Sbjct: 535 FSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTAR 594

Query: 145 VWDLVSEVGLYKLRSHKDAISGIWC----EGEDWLVSTSKDGLIKIWDLKVQQCIETHIA 200
           +W   S   +Y LR     ++ + C        +L + S D   ++W++     +   + 
Sbjct: 595 LW---SCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNVSTGDSVRLFLG 651

Query: 201 HTGECWAMGVHED--LLITSGADTQLKLWNLDFSKE 234
           HT    ++ V  D   L T   D  + +W++   K 
Sbjct: 652 HTAPVISIAVSPDGRWLSTGSEDGIINVWDIGTGKR 687

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 11/60 (18%)

Query: 47  INIWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDL 106
           IN+WDI TG+ +  +           +      +  L Y  E N+L +G  D +++VWDL
Sbjct: 677 INVWDIGTGKRLKQM-----------RGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDL 725

>Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON}
           YCR084C (REAL)
          Length = 709

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/283 (24%), Positives = 128/283 (45%), Gaps = 50/283 (17%)

Query: 428 YALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTG 487
           Y  +  F P G  +  G  +  ++++D+    ++   +  HE  I+SLD    G +LV+G
Sbjct: 441 YIRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVMILQ-GHEQDIYSLDYFPSGDKLVSG 499

Query: 488 SADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPED-KFLAISL 546
           S D+T++ W+ +  +  +                 T+ + + V +V +SP D K++A   
Sbjct: 500 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 542

Query: 547 LDNTVKVFYLDSMKFFL---------SLYGHKLPVLSIDISFDSKLIITSSADKNIKIWG 597
           LD  V+V+  DS   FL         S  GHK  V S+  + D   +++ S D+++K+W 
Sbjct: 543 LDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWN 600

Query: 598 L------------DFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFEC 645
           L            + G C  +   H+D +++V          S SKD  V +WD      
Sbjct: 601 LQNANNKSDSKAPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNP 660

Query: 646 IQKLAAHQSEVWSIAITSDGTSV-------ISASHDHSLRVWE 681
           +  L  H++ V S+A+ ++G+ +        + S D   R+W+
Sbjct: 661 LLMLQGHRNSVISVAV-ANGSPLGPEYNVFATGSGDCKARIWK 702

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 107/229 (46%), Gaps = 19/229 (8%)

Query: 383 LPGHRTDIRSVD-ISDDDKLLATASNGLLKVWNLKTKACIRVFDCGYALTCKFL-PG-GT 439
           L GH  DI S+D     DKL++ + +  +++W+L+T  C         +T   + PG G 
Sbjct: 477 LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGK 536

Query: 440 LVIVGTREGSLQLFDLASSTLLENKED------AHETAIWSLDITSDGRRLVTGSADKTI 493
            +  G+ + +++++D  +  L+E  +        H+ +++S+  T DG  +V+GS D+++
Sbjct: 537 YIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSV 596

Query: 494 KFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKV 553
           K WN Q   +     +D   P       T +   + VLSV  +  D+++     D  V  
Sbjct: 597 KLWNLQNANN----KSDSKAPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLF 652

Query: 554 FYLDSMKFFLSLYGHKLPVLSIDISFDSKL------IITSSADKNIKIW 596
           +   S    L L GH+  V+S+ ++  S L        T S D   +IW
Sbjct: 653 WDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 701

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 70/293 (23%), Positives = 128/293 (43%), Gaps = 53/293 (18%)

Query: 378 LYTIELPGHRTDIRSVDISDDDKLLAT-ASNGLLKVWNLKTKACIRVFDCG----YALTC 432
           L T   P     IRSV  S D K LAT A + L+++W+++ +  + +        Y+L  
Sbjct: 430 LNTSSSPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVMILQGHEQDIYSL-- 487

Query: 433 KFLPGGTLVIVGTREGSLQLFDLASS--TLLENKEDAHETAIWSLDITSDGRRLVTGSAD 490
            + P G  ++ G+ + +++++DL +   +L  + ED   T   S     DG+ +  GS D
Sbjct: 488 DYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVS---PGDGKYIAAGSLD 544

Query: 491 KTIKFWN----FQVEE---DLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLA 543
           + ++ W+    F VE    +   GT  K                + V SV  + +   + 
Sbjct: 545 RAVRVWDSETGFLVERLDSENESGTGHK----------------DSVYSVVFTRDGHSVV 588

Query: 544 ISLLDNTVKVFYL------------DSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADK 591
              LD +VK++ L            +S    ++  GHK  VLS+  + + + I++ S D+
Sbjct: 589 SGSLDRSVKLWNLQNANNKSDSKAPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDR 648

Query: 592 NIKIWGLDFGDCHKSLFAHQDSIMNVKFL------PESHNFFSSSKDGLVKYW 638
            +  W    G+    L  H++S+++V         PE + F + S D   + W
Sbjct: 649 GVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 701

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 80/171 (46%), Gaps = 17/171 (9%)

Query: 74  SSKPAEVSYLH---YHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVT 130
           SS P+   Y+    +  +   LA G  D  I++WD+  + +++   GH+  I  + +  +
Sbjct: 433 SSSPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVMILQGHEQDIYSLDYFPS 492

Query: 131 GTRLISGSRDSNIIVWDLVSEVGLYKLR-SHKDAISGIWCEGED--WLVSTSKDGLIKIW 187
           G +L+SGS D  + +WDL    G   L  S +D ++ +     D  ++ + S D  +++W
Sbjct: 493 GDKLVSGSGDRTVRIWDL--RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVW 550

Query: 188 DLKVQQCI-------ETHIAHTGECWAMGVHED--LLITSGADTQLKLWNL 229
           D +    +       E+   H    +++    D   +++   D  +KLWNL
Sbjct: 551 DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWNL 601

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/221 (20%), Positives = 81/221 (36%), Gaps = 61/221 (27%)

Query: 530 VLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSA 589
           + SV  SP+ KFLA    D  ++++ ++  K  + L GH+  + S+D       +++ S 
Sbjct: 442 IRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 501

Query: 590 DKNIKIWGLDFGDC---------------------------------------------- 603
           D+ ++IW L  G C                                              
Sbjct: 502 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERL 561

Query: 604 ---HKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWD------------GDKFECIQK 648
              ++S   H+DS+ +V F  + H+  S S D  VK W+             +   C   
Sbjct: 562 DSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWNLQNANNKSDSKAPNSGTCEVT 621

Query: 649 LAAHQSEVWSIAITSDGTSVISASHDHSLRVWEETDDQVFL 689
              H+  V S+A T +   ++S S D  +  W++      L
Sbjct: 622 YIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLL 662

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 56/113 (49%), Gaps = 2/113 (1%)

Query: 570 LPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSS 629
           L + S+  S D K + T + D+ I+IW ++       L  H+  I ++ + P      S 
Sbjct: 440 LYIRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVMILQGHEQDIYSLDYFPSGDKLVSG 499

Query: 630 SKDGLVKYWDGDKFECIQKLAAHQSEVWSIAIT-SDGTSVISASHDHSLRVWE 681
           S D  V+ WD    +C   L+  +  V ++A++  DG  + + S D ++RVW+
Sbjct: 500 SGDRTVRIWDLRTGQCSLTLSI-EDGVTTVAVSPGDGKYIAAGSLDRAVRVWD 551

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 90/213 (42%), Gaps = 48/213 (22%)

Query: 47  INIWDIKTGELISVLS--DGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVW 104
           + IWD++TG+    LS  DG+   ++      P +  Y         +AAG +D  ++VW
Sbjct: 505 VRIWDLRTGQCSLTLSIEDGVTTVAV-----SPGDGKY---------IAAGSLDRAVRVW 550

Query: 105 DLLSKSVLL---------TFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDL------- 148
           D  S++  L         +  GHK ++  + F   G  ++SGS D ++ +W+L       
Sbjct: 551 D--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWNLQNANNKS 608

Query: 149 ---VSEVGLYKLR--SHKD-AISGIWCEGEDWLVSTSKDGLIKIWDLKVQQCIETHIAHT 202
                  G  ++    HKD  +S    + +++++S SKD  +  WD K    +     H 
Sbjct: 609 DSKAPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHR 668

Query: 203 GECWA--------MGVHEDLLITSGADTQLKLW 227
               +        +G   ++  T   D + ++W
Sbjct: 669 NSVISVAVANGSPLGPEYNVFATGSGDCKARIW 701

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 46/203 (22%), Positives = 88/203 (43%), Gaps = 28/203 (13%)

Query: 7   RFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISVLSDGLP 66
           R  Q S+   I      V +SP   K  + GS+  +    + +WD +TG L+  L     
Sbjct: 511 RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRA----VRVWDSETGFLVERLDSENE 566

Query: 67  AGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLL------------SKSVLLT 114
           +G+    S     V  + +  + + + +G +D ++K+W+L             S +  +T
Sbjct: 567 SGTGHKDS-----VYSVVFTRDGHSVVSGSLDRSVKLWNLQNANNKSDSKAPNSGTCEVT 621

Query: 115 FNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCE---- 170
           + GHK  +  +        ++SGS+D  ++ WD  S   L  L+ H++++  +       
Sbjct: 622 YIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSP 681

Query: 171 -GEDWLV--STSKDGLIKIWDLK 190
            G ++ V  + S D   +IW  K
Sbjct: 682 LGPEYNVFATGSGDCKARIWKYK 704

>KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363
           YCR084C
          Length = 655

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 92/386 (23%), Positives = 161/386 (41%), Gaps = 83/386 (21%)

Query: 358 IEYYSIPYEKRDPT-------SPAPTRLYTIELPG---HRTDIRSVDISDDDKLLATASN 407
           ++Y  +P   R  T       +PA  R   +EL     H + +  V  S+D + LAT  N
Sbjct: 276 LDYKQVPENLRKKTEEYDVLYNPALPRTLEVELHKSLEHTSVVCCVKFSNDGQYLATGCN 335

Query: 408 GLLKVWNLKTKACIRVF---------------DCG----YALTCKFLPGGTLVIVGTREG 448
              +V+ +     +                  D G    Y  +  F P G  +  G  + 
Sbjct: 336 KTTQVFRVSDGELVARLSDDNAPSIQNGGNGSDSGSTDLYIRSVCFSPDGKFLATGAEDR 395

Query: 449 SLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGT 508
            ++++DLA   ++   +  H+  ++SLD    G +LV+GS D+T++ W      DL  G 
Sbjct: 396 LIRIWDLAQQKIVMVLQ-GHDQDVYSLDYFPSGDKLVSGSGDRTVRIW------DLKTGQ 448

Query: 509 ADKYLPVMKLIHDTTMEVNEDVLSVRISPED-KFLAISLLDNTVKVFYLDSMKFFLSLY- 566
                         T+ + + V +V +SP D K++A   LD  V+V+  DS   FL    
Sbjct: 449 CS-----------LTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVW--DSETGFLVERL 495

Query: 567 --------GHKLPVLSIDISFDSKLIITSSADKNIKIWGL-------DFGD--------- 602
                   GH+  V S+  + D   +++SS D+++K+W L       +  D         
Sbjct: 496 DSENELGTGHRDSVYSVVFTRDGNKVVSSSLDRSVKLWNLRGYNEKENAADNNKSQSSVV 555

Query: 603 CHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAIT 662
           C  +   H+D +++V          S SKD  V +WD +    +  L  H++ V S+A+ 
Sbjct: 556 CEVTYIGHKDFVLSVTTTANDEFVLSGSKDRGVLFWDTNTGNPLLMLQGHRNSVISVAV- 614

Query: 663 SDGTSV-------ISASHDHSLRVWE 681
           ++G  +        + S D   R+W+
Sbjct: 615 ANGHPLGPEYQVFATGSGDCRARIWK 640

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 99/222 (44%), Gaps = 31/222 (13%)

Query: 31  KKSNSPGSVITSALENINIWDIKTGELISVLSD-----------GLPAGSIDVKSSKPAE 79
           K SN    + T   +   ++ +  GEL++ LSD           G  +GS D+       
Sbjct: 322 KFSNDGQYLATGCNKTTQVFRVSDGELVARLSDDNAPSIQNGGNGSDSGSTDLY------ 375

Query: 80  VSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSR 139
           +  + +  +   LA G  D  I++WDL  + +++   GH   +  + +  +G +L+SGS 
Sbjct: 376 IRSVCFSPDGKFLATGAEDRLIRIWDLAQQKIVMVLQGHDQDVYSLDYFPSGDKLVSGSG 435

Query: 140 DSNIIVWDLVSEVGLYKLR-SHKDAISGIWCEGED--WLVSTSKDGLIKIWDLKVQQCIE 196
           D  + +WDL  + G   L  S +D ++ +     D  ++ + S D  +++WD +    +E
Sbjct: 436 DRTVRIWDL--KTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVE 493

Query: 197 T-------HIAHTGECWAMGVHED--LLITSGADTQLKLWNL 229
                      H    +++    D   +++S  D  +KLWNL
Sbjct: 494 RLDSENELGTGHRDSVYSVVFTRDGNKVVSSSLDRSVKLWNL 535

 Score = 38.5 bits (88), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 45/203 (22%), Positives = 86/203 (42%), Gaps = 36/203 (17%)

Query: 10  QASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISVL--SDGLPA 67
           Q S+   I      V +SP   K  + GS+  +    + +WD +TG L+  L   + L  
Sbjct: 448 QCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRA----VRVWDSETGFLVERLDSENELGT 503

Query: 68  GSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLS--------------KSVL- 112
           G  D        V  + +  + N + +  +D ++K+W+L                 SV+ 
Sbjct: 504 GHRD-------SVYSVVFTRDGNKVVSSSLDRSVKLWNLRGYNEKENAADNNKSQSSVVC 556

Query: 113 -LTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCE- 170
            +T+ GHK  +  +        ++SGS+D  ++ WD  +   L  L+ H++++  +    
Sbjct: 557 EVTYIGHKDFVLSVTTTANDEFVLSGSKDRGVLFWDTNTGNPLLMLQGHRNSVISVAVAN 616

Query: 171 ----GEDWLV--STSKDGLIKIW 187
               G ++ V  + S D   +IW
Sbjct: 617 GHPLGPEYQVFATGSGDCRARIW 639

>NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON} 
          Length = 859

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 68/308 (22%), Positives = 133/308 (43%), Gaps = 40/308 (12%)

Query: 378 LYTIELPGHRT--DIRSVDISDDDKLLATA-SNGLLKVWNLKTKACIRVFDCGYALTCKF 434
           LYT     H T  D+ S+D S+D +L A    +  +K+W+L   +  +  D   + +   
Sbjct: 512 LYTF----HNTNRDMTSLDFSEDSRLAAGGFQDSYIKLWSLDGSSLKKYGDVSSSPSPSA 567

Query: 435 LPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIK 494
                              D  ++TL+      H  A++S   + D + L++GS DKT++
Sbjct: 568 TTADKYSK-----------DFTNTTLI-----GHSGAVYSTSFSPDNKYLISGSEDKTVR 611

Query: 495 FWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVF 554
            W+      LV                +    N  V  V+ SP   + A +  D T +++
Sbjct: 612 LWSLDTNTTLV----------------SYKGHNHPVWDVKFSPLGHYFATASHDQTARLW 655

Query: 555 YLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSI 614
             D +       GH   V  +    +   + T S+DK  ++W +  GD  +    H   +
Sbjct: 656 SCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPV 715

Query: 615 MNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAH-QSEVWSIAITSDGTSVISASH 673
           ++    P+     + S+DG++  WD    + ++ +  H ++ ++S++ + +G  ++S+  
Sbjct: 716 ISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKLMRGHGKNAIYSLSYSKEGNVLVSSGA 775

Query: 674 DHSLRVWE 681
           DHS+RVW+
Sbjct: 776 DHSVRVWD 783

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 85/194 (43%), Gaps = 26/194 (13%)

Query: 522 TTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLD--SMKFF----------------- 562
           T    N D+ S+  S + +  A    D+ +K++ LD  S+K +                 
Sbjct: 514 TFHNTNRDMTSLDFSEDSRLAAGGFQDSYIKLWSLDGSSLKKYGDVSSSPSPSATTADKY 573

Query: 563 ------LSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMN 616
                  +L GH   V S   S D+K +I+ S DK +++W LD      S   H   + +
Sbjct: 574 SKDFTNTTLIGHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWD 633

Query: 617 VKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHS 676
           VKF P  H F ++S D   + W  D    ++  A H S+V  ++   +G  V + S D +
Sbjct: 634 VKFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKT 693

Query: 677 LRVWE-ETDDQVFL 689
            R+W+  T D V L
Sbjct: 694 CRMWDVSTGDSVRL 707

 Score = 58.2 bits (139), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 66/143 (46%), Gaps = 6/143 (4%)

Query: 92  LAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSE 151
            A    D T ++W       L  F GH S +  + F   G  + +GS D    +WD+ + 
Sbjct: 643 FATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTG 702

Query: 152 VGLYKLRSHKDAI--SGIWCEGEDWLVSTSKDGLIKIWDL---KVQQCIETHIAHTGECW 206
             +     H   +  + +  +G  WL + S+DG+I +WD+   K  + +  H  +     
Sbjct: 703 DSVRLFLGHTAPVISTAVSPDGR-WLSTGSEDGIINVWDIGTGKRLKLMRGHGKNAIYSL 761

Query: 207 AMGVHEDLLITSGADTQLKLWNL 229
           +     ++L++SGAD  +++W+L
Sbjct: 762 SYSKEGNVLVSSGADHSVRVWDL 784

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 58/115 (50%), Gaps = 2/115 (1%)

Query: 78  AEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISG 137
           ++V  + +H     +  G  D T ++WD+ +   +  F GH + +        G  L +G
Sbjct: 671 SDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISTAVSPDGRWLSTG 730

Query: 138 SRDSNIIVWDLVSEVGLYKLRSH-KDAISGI-WCEGEDWLVSTSKDGLIKIWDLK 190
           S D  I VWD+ +   L  +R H K+AI  + + +  + LVS+  D  +++WDLK
Sbjct: 731 SEDGIINVWDIGTGKRLKLMRGHGKNAIYSLSYSKEGNVLVSSGADHSVRVWDLK 785

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/156 (21%), Positives = 65/156 (41%), Gaps = 9/156 (5%)

Query: 85  YHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNII 144
           +  +   L +G  D T+++W L + + L+++ GH   +  +KF   G    + S D    
Sbjct: 594 FSPDNKYLISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFSPLGHYFATASHDQTAR 653

Query: 145 VWDLVSEVGLYKLRSHKDAISGIWC----EGEDWLVSTSKDGLIKIWDLKVQQCIETHIA 200
           +W   S   +Y LR     +S + C        ++ + S D   ++WD+     +   + 
Sbjct: 654 LW---SCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLG 710

Query: 201 HTGECWAMGVHED--LLITSGADTQLKLWNLDFSKE 234
           HT    +  V  D   L T   D  + +W++   K 
Sbjct: 711 HTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKR 746

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/179 (18%), Positives = 65/179 (36%), Gaps = 28/179 (15%)

Query: 79  EVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVL-------------------------L 113
           +++ L + +++ L A G+ D  IK+W L   S+                           
Sbjct: 521 DMTSLDFSEDSRLAAGGFQDSYIKLWSLDGSSLKKYGDVSSSPSPSATTADKYSKDFTNT 580

Query: 114 TFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGE 172
           T  GH  A+    F      LISGS D  + +W L +   L   + H   +  + +    
Sbjct: 581 TLIGHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFSPLG 640

Query: 173 DWLVSTSKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHED--LLITSGADTQLKLWNL 229
            +  + S D   ++W       +     H  +   +  H +   + T  +D   ++W++
Sbjct: 641 HYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDV 699

>Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON}
           YCR084C (REAL)
          Length = 700

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/263 (26%), Positives = 118/263 (44%), Gaps = 52/263 (19%)

Query: 428 YALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKE-----DAHETAIWSLDITSDGR 482
           Y  +  F P G  +  G  +  ++++D+      EN++       HE  I+SLD    G 
Sbjct: 449 YIRSVCFSPDGKFLATGAEDRLIRIWDI------ENRKIVMILQGHEQDIYSLDYFPSGD 502

Query: 483 RLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPED-KF 541
           +LV+GS D+T++ W      DL  G               T+ + + V +V +SP D K+
Sbjct: 503 KLVSGSGDRTVRIW------DLRTGQCS-----------LTLSIEDGVTTVAVSPGDGKY 545

Query: 542 LAISLLDNTVKVFYLDSMKFFL---------SLYGHKLPVLSIDISFDSKLIITSSADKN 592
           +A   LD  V+V+  DS   FL         S  GHK  V S+  + D + +++ S D++
Sbjct: 546 IAAGSLDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRS 603

Query: 593 IKIWGL------------DFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDG 640
           +K+W L            + G C  +   H+D +++V          S SKD  V +WD 
Sbjct: 604 VKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDK 663

Query: 641 DKFECIQKLAAHQSEVWSIAITS 663
                +  L  H++ V S+A+ +
Sbjct: 664 KSGNPLLMLQGHRNSVISVAVAN 686

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 83/159 (52%), Gaps = 9/159 (5%)

Query: 530 VLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSA 589
           + SV  SP+ KFLA    D  ++++ +++ K  + L GH+  + S+D       +++ S 
Sbjct: 450 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 509

Query: 590 DKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSS-SKDGLVKYWDGDKFECIQK 648
           D+ ++IW L  G C  +L + +D +  V   P    + ++ S D  V+ WD +    +++
Sbjct: 510 DRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVER 568

Query: 649 L-------AAHQSEVWSIAITSDGTSVISASHDHSLRVW 680
           L         H+  V+S+  T DG SV+S S D S+++W
Sbjct: 569 LDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLW 607

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 54/210 (25%), Positives = 101/210 (48%), Gaps = 13/210 (6%)

Query: 383 LPGHRTDIRSVD-ISDDDKLLATASNGLLKVWNLKTKACIRVFDCGYALTCKFL-PG-GT 439
           L GH  DI S+D     DKL++ + +  +++W+L+T  C         +T   + PG G 
Sbjct: 485 LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGK 544

Query: 440 LVIVGTREGSLQLFDLASSTLLENKED------AHETAIWSLDITSDGRRLVTGSADKTI 493
            +  G+ + +++++D  +  L+E  +        H+ +++S+  T DG  +V+GS D+++
Sbjct: 545 YIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSV 604

Query: 494 KFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKV 553
           K WN Q   +     +D   P       T +   + VLSV  +  D+++     D  V  
Sbjct: 605 KLWNLQNANN----KSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLF 660

Query: 554 FYLDSMKFFLSLYGHKLPVLSIDISFDSKL 583
           +   S    L L GH+  V+S+ ++  S L
Sbjct: 661 WDKKSGNPLLMLQGHRNSVISVAVANGSPL 690

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 81/171 (47%), Gaps = 17/171 (9%)

Query: 74  SSKPAEVSYLH---YHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVT 130
           SS P+   Y+    +  +   LA G  D  I++WD+ ++ +++   GH+  I  + +  +
Sbjct: 441 SSTPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPS 500

Query: 131 GTRLISGSRDSNIIVWDLVSEVGLYKLR-SHKDAISGIWCEGED--WLVSTSKDGLIKIW 187
           G +L+SGS D  + +WDL    G   L  S +D ++ +     D  ++ + S D  +++W
Sbjct: 501 GDKLVSGSGDRTVRIWDL--RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVW 558

Query: 188 DLKVQQCI-------ETHIAHTGECWAMGVHED--LLITSGADTQLKLWNL 229
           D +    +       E+   H    +++    D   +++   D  +KLWNL
Sbjct: 559 DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLWNL 609

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 64/266 (24%), Positives = 120/266 (45%), Gaps = 47/266 (17%)

Query: 378 LYTIELPGHRTDIRSVDISDDDKLLAT-ASNGLLKVWNLKTKACIRVFDCG----YALTC 432
           L T   P     IRSV  S D K LAT A + L+++W+++ +  + +        Y+L  
Sbjct: 438 LNTSSTPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSL-- 495

Query: 433 KFLPGGTLVIVGTREGSLQLFDLASS--TLLENKEDAHETAIWSLDITSDGRRLVTGSAD 490
            + P G  ++ G+ + +++++DL +   +L  + ED   T   S     DG+ +  GS D
Sbjct: 496 DYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVS---PGDGKYIAAGSLD 552

Query: 491 KTIKFWN----FQVEE---DLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLA 543
           + ++ W+    F VE    +   GT  K                + V SV  + + + + 
Sbjct: 553 RAVRVWDSETGFLVERLDSENESGTGHK----------------DSVYSVVFTRDGESVV 596

Query: 544 ISLLDNTVKVFYL------------DSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADK 591
              LD +VK++ L            +S    ++  GHK  VLS+  + + + I++ S D+
Sbjct: 597 SGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDR 656

Query: 592 NIKIWGLDFGDCHKSLFAHQDSIMNV 617
            +  W    G+    L  H++S+++V
Sbjct: 657 GVLFWDKKSGNPLLMLQGHRNSVISV 682

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 56/113 (49%), Gaps = 2/113 (1%)

Query: 570 LPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSS 629
           L + S+  S D K + T + D+ I+IW ++       L  H+  I ++ + P      S 
Sbjct: 448 LYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSG 507

Query: 630 SKDGLVKYWDGDKFECIQKLAAHQSEVWSIAIT-SDGTSVISASHDHSLRVWE 681
           S D  V+ WD    +C   L+  +  V ++A++  DG  + + S D ++RVW+
Sbjct: 508 SGDRTVRIWDLRTGQCSLTLSI-EDGVTTVAVSPGDGKYIAAGSLDRAVRVWD 559

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 77/168 (45%), Gaps = 40/168 (23%)

Query: 47  INIWDIKTGELISVLS--DGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVW 104
           + IWD++TG+    LS  DG+   ++      P +  Y         +AAG +D  ++VW
Sbjct: 513 VRIWDLRTGQCSLTLSIEDGVTTVAV-----SPGDGKY---------IAAGSLDRAVRVW 558

Query: 105 DLLSKSVLL---------TFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDL------- 148
           D  S++  L         +  GHK ++  + F   G  ++SGS D ++ +W+L       
Sbjct: 559 D--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLWNLQNANNKS 616

Query: 149 ---VSEVGLYKLR--SHKD-AISGIWCEGEDWLVSTSKDGLIKIWDLK 190
                  G  ++    HKD  +S    + +++++S SKD  +  WD K
Sbjct: 617 DSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKK 664

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 77/170 (45%), Gaps = 21/170 (12%)

Query: 7   RFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISVLSDGLP 66
           R  Q S+   I      V +SP   K  + GS+  +    + +WD +TG L+  L     
Sbjct: 519 RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRA----VRVWDSETGFLVERLDSENE 574

Query: 67  AGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLL------------SKSVLLT 114
           +G+      K +  S +   D  ++++ G +D ++K+W+L             S +  +T
Sbjct: 575 SGT----GHKDSVYSVVFTRDGESVVS-GSLDRSVKLWNLQNANNKSDSKTPNSGTCEVT 629

Query: 115 FNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAI 164
           + GHK  +  +        ++SGS+D  ++ WD  S   L  L+ H++++
Sbjct: 630 YIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSV 679

>TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {ON}
           Anc_8.544 YBR198C
          Length = 831

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/295 (23%), Positives = 128/295 (43%), Gaps = 39/295 (13%)

Query: 389 DIRSVDISDDDKLLATA-SNGLLKVWNLKTKACIRVFDCGYALTCKFLPGGTLVIVGTRE 447
           D+ S++ SDD +L A    +  +K+++L           G +L  K      L     + 
Sbjct: 498 DMTSLEFSDDCRLAAAGFQDSQIKIFSLD----------GSSLNSK------LTESNKKT 541

Query: 448 GSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPG 507
             L   D ++STL+      H   ++S   + D R LV+GS DKT++ W+      LV  
Sbjct: 542 NKLLNNDESTSTLI-----GHSGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLV-- 594

Query: 508 TADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYG 567
                         +    N  V  V  SP   + A +  D+T +++  D +       G
Sbjct: 595 --------------SYKGHNHPVWDVEFSPLGHYFATASHDHTARLWSCDHIYPLRIFAG 640

Query: 568 HKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFF 627
           H   V  +    +   + T S+DK  ++W +  GD  +        +M+    P+     
Sbjct: 641 HLNDVDCVSFHPNGCYLFTGSSDKTCRMWDITTGDSVRLFLGLTAPVMSTSVSPDGRWLS 700

Query: 628 SSSKDGLVKYWDGDKFECIQKLAAH-QSEVWSIAITSDGTSVISASHDHSLRVWE 681
           + S+DG++  WD    + ++++  H ++ ++S++   +G  +IS   DHS+RVW+
Sbjct: 701 TGSEDGVINVWDIGTGKRLKQMRGHGKNAIYSLSYNKEGNVLISGGADHSVRVWD 755

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 84/196 (42%), Gaps = 25/196 (12%)

Query: 515 VMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKF------------- 561
            M   H+T    + D+ S+  S + +  A    D+ +K+F LD                 
Sbjct: 488 CMYTFHNT----DRDMTSLEFSDDCRLAAAGFQDSQIKIFSLDGSSLNSKLTESNKKTNK 543

Query: 562 -------FLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSI 614
                    +L GH   V S   S D++ +++ S DK +++W +D      S   H   +
Sbjct: 544 LLNNDESTSTLIGHSGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNHPV 603

Query: 615 MNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHD 674
            +V+F P  H F ++S D   + W  D    ++  A H ++V  ++   +G  + + S D
Sbjct: 604 WDVEFSPLGHYFATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSD 663

Query: 675 HSLRVWE-ETDDQVFL 689
            + R+W+  T D V L
Sbjct: 664 KTCRMWDITTGDSVRL 679

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 55/114 (48%), Gaps = 2/114 (1%)

Query: 79  EVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGS 138
           +V  + +H     L  G  D T ++WD+ +   +  F G  + +        G  L +GS
Sbjct: 644 DVDCVSFHPNGCYLFTGSSDKTCRMWDITTGDSVRLFLGLTAPVMSTSVSPDGRWLSTGS 703

Query: 139 RDSNIIVWDLVSEVGLYKLRSH-KDAISGIWCEGE-DWLVSTSKDGLIKIWDLK 190
            D  I VWD+ +   L ++R H K+AI  +    E + L+S   D  +++WDLK
Sbjct: 704 EDGVINVWDIGTGKRLKQMRGHGKNAIYSLSYNKEGNVLISGGADHSVRVWDLK 757

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/191 (19%), Positives = 76/191 (39%), Gaps = 46/191 (24%)

Query: 85  YHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNII 144
           +  +   L +G  D T+++W + + + L+++ GH   +  ++F   G    + S D    
Sbjct: 566 FSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVWDVEFSPLGHYFATASHDHTAR 625

Query: 145 VW------------------DLVS--EVGLYKLRSHKDAISGIW--CEGED--------- 173
           +W                  D VS    G Y      D    +W    G+          
Sbjct: 626 LWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDITTGDSVRLFLGLTA 685

Query: 174 ------------WLVSTSKDGLIKIWDLKVQQCIETHIAHTGEC-WAMGVHE--DLLITS 218
                       WL + S+DG+I +WD+   + ++    H     +++  ++  ++LI+ 
Sbjct: 686 PVMSTSVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAIYSLSYNKEGNVLISG 745

Query: 219 GADTQLKLWNL 229
           GAD  +++W+L
Sbjct: 746 GADHSVRVWDL 756

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 34/174 (19%), Positives = 66/174 (37%), Gaps = 23/174 (13%)

Query: 79  EVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSV-------------LL-------TFNGH 118
           +++ L + D+  L AAG+ D  IK++ L   S+             LL       T  GH
Sbjct: 498 DMTSLEFSDDCRLAAAGFQDSQIKIFSLDGSSLNSKLTESNKKTNKLLNNDESTSTLIGH 557

Query: 119 KSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGEDWLVS 177
              +    F      L+SGS D  + +W + +   L   + H   +  + +     +  +
Sbjct: 558 SGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVWDVEFSPLGHYFAT 617

Query: 178 TSKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHED--LLITSGADTQLKLWNL 229
            S D   ++W       +     H  +   +  H +   L T  +D   ++W++
Sbjct: 618 ASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDI 671

 Score = 35.4 bits (80), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 11/60 (18%)

Query: 47  INIWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDL 106
           IN+WDI TG+ +  +           +      +  L Y+ E N+L +G  D +++VWDL
Sbjct: 708 INVWDIGTGKRLKQM-----------RGHGKNAIYSLSYNKEGNVLISGGADHSVRVWDL 756

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 76/315 (24%), Positives = 137/315 (43%), Gaps = 31/315 (9%)

Query: 377 RLYTIELPGHR----TDIRSVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFDCGYALT 431
           RL T EL G +      +  V +  D + LAT    G +KV + +T    +  D  +   
Sbjct: 158 RLATFELVGSQLVADKHVSQVAVHRDGQQLATGCWGGSIKVVSCETLGIAKSIDAAHEGK 217

Query: 432 CKFL---PGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGS 488
              L   P G  ++ G  +  ++L+D+ S++  E +   H   +  + +   GR   + S
Sbjct: 218 IGGLDWHPDGNHLLSGGGDNLVKLWDMTSNSFEELR--GHAGRVSRVKVHPSGRLAASAS 275

Query: 489 ADKTIKFWNFQ--VEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISL 546
            D T   W+ +  VE  L  G +                  + V ++    +   LA + 
Sbjct: 276 FDLTWILWDLERKVELQLQEGHS------------------KAVYTIAFQSDGALLASAG 317

Query: 547 LDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKS 606
           LD    ++ L S +  + L GH   +  +D S +   + T+ AD  +++W +       +
Sbjct: 318 LDAVCAIWDLRSGEPIMKLEGHAGAISGVDWSPNGYQLATAGADGTVRVWDIRNVGTESA 377

Query: 607 LFAHQDSIMNVKFLPESHNFF-SSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDG 665
           L AHQ + ++VKF   +  F  S   D LV  ++ D ++ +  L  H   V+++ IT DG
Sbjct: 378 LLAHQVAALDVKFKKNNGTFLVSCGHDRLVNIFNADNWQKLASLEGHTDRVFTVDITEDG 437

Query: 666 TSVISASHDHSLRVW 680
           +++ S   D SL+ W
Sbjct: 438 STIYSGGKDRSLKQW 452

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 70/159 (44%), Gaps = 8/159 (5%)

Query: 78  AEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISG 137
             VS +  H    L A+   D T  +WDL  K  L    GH  A+  + F   G  L S 
Sbjct: 257 GRVSRVKVHPSGRLAASASFDLTWILWDLERKVELQLQEGHSKAVYTIAFQSDGALLASA 316

Query: 138 SRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGEDWLVSTSKDGLIKIWDLKVQQCIE 196
             D+   +WDL S   + KL  H  AISG+ W      L +   DG +++WD++      
Sbjct: 317 GLDAVCAIWDLRSGEPIMKLEGHAGAISGVDWSPNGYQLATAGADGTVRVWDIRNVGTES 376

Query: 197 THIAHTGECWAMGV-----HEDLLITSGADTQLKLWNLD 230
             +AH  +  A+ V     +   L++ G D  + ++N D
Sbjct: 377 ALLAH--QVAALDVKFKKNNGTFLVSCGHDRLVNIFNAD 413

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 70/152 (46%), Gaps = 4/152 (2%)

Query: 80  VSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSR 139
           V  + +  +  LLA+  +D    +WDL S   ++   GH  AI+ + +   G +L +   
Sbjct: 301 VYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAISGVDWSPNGYQLATAGA 360

Query: 140 DSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGED--WLVSTSKDGLIKIWDLKVQQCIET 197
           D  + VWD+ +      L +H+ A   +  +  +  +LVS   D L+ I++    Q + +
Sbjct: 361 DGTVRVWDIRNVGTESALLAHQVAALDVKFKKNNGTFLVSCGHDRLVNIFNADNWQKLAS 420

Query: 198 HIAHTGECWAMGVHED--LLITSGADTQLKLW 227
              HT   + + + ED   + + G D  LK W
Sbjct: 421 LEGHTDRVFTVDITEDGSTIYSGGKDRSLKQW 452

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 87/208 (41%), Gaps = 16/208 (7%)

Query: 80  VSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNG-HKSAITVMKFDVTGTRLISGS 138
           VS +  H +   LA G   G+IKV    +  +  + +  H+  I  + +   G  L+SG 
Sbjct: 175 VSQVAVHRDGQQLATGCWGGSIKVVSCETLGIAKSIDAAHEGKIGGLDWHPDGNHLLSGG 234

Query: 139 RDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVSTSKDGLIKI-WDLKVQQCIET 197
            D+ + +WD+ S     +LR H   +S +       L +++   L  I WDL+ +  ++ 
Sbjct: 235 GDNLVKLWDMTSN-SFEELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLERKVELQL 293

Query: 198 HIAHTGECWAMGVHED--LLITSGADTQLKLWNLDFSKEAGSKLIEKGVYDKQSKQRGLD 255
              H+   + +    D  LL ++G D    +W+L     +G  ++      K     G  
Sbjct: 294 QEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDL----RSGEPIM------KLEGHAGAI 343

Query: 256 IKFSVAPNGTAFFYIQNADKTTEVFRIR 283
                +PNG        AD T  V+ IR
Sbjct: 344 SGVDWSPNGYQ-LATAGADGTVRVWDIR 370

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 74/172 (43%), Gaps = 3/172 (1%)

Query: 511 KYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSL-YGHK 569
           K L   +L+  + +  ++ V  V +  + + LA      ++KV   +++    S+   H+
Sbjct: 157 KRLATFELV-GSQLVADKHVSQVAVHRDGQQLATGCWGGSIKVVSCETLGIAKSIDAAHE 215

Query: 570 LPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSS 629
             +  +D   D   +++   D  +K+W +   +  + L  H   +  VK  P      S+
Sbjct: 216 GKIGGLDWHPDGNHLLSGGGDNLVKLWDM-TSNSFEELRGHAGRVSRVKVHPSGRLAASA 274

Query: 630 SKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWE 681
           S D     WD ++   +Q    H   V++IA  SDG  + SA  D    +W+
Sbjct: 275 SFDLTWILWDLERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWD 326

>NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {ON}
           Anc_6.363
          Length = 793

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 61/221 (27%), Positives = 107/221 (48%), Gaps = 15/221 (6%)

Query: 468 HETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVN 527
           H + +  +  + DG  L TG  +KT + +     E +   + D     +KL  ++T   +
Sbjct: 442 HSSVVCCVKFSYDGEFLATG-CNKTTQVYRVSTGELIAKLSDDN----VKLDSNST-STD 495

Query: 528 EDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITS 587
             + SV  SP+ KFLA    D  ++++ +   K  + L GH+  V S+D   D + +++ 
Sbjct: 496 LYIRSVCFSPDGKFLATGAEDKLIRIWDIQEGKIVMVLKGHEQDVYSLDYFPDGQKLVSG 555

Query: 588 SADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSS-SKDGLVKYWDGDKFECI 646
           S D+ ++IW L  G C  +L + +D +  V   P    F ++ S D  V+ WD      +
Sbjct: 556 SGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPHDGRFIAAGSLDRAVRVWDSTTGFLV 614

Query: 647 QKL-------AAHQSEVWSIAITSDGTSVISASHDHSLRVW 680
           ++L         HQ  V+S+  T DG  V+S S D S+++W
Sbjct: 615 ERLDSENELGTGHQDSVYSVVFTRDGNEVVSGSLDKSVKLW 655

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 88/373 (23%), Positives = 152/373 (40%), Gaps = 84/373 (22%)

Query: 372 SPAPTRLYTIELP---GHRTDIRSVDISDDDKLLATASNGLLKVWNLKTKACI-RVFDCG 427
           +PA  R   +EL     H + +  V  S D + LAT  N   +V+ + T   I ++ D  
Sbjct: 425 NPALPRTLDVELHKSLDHSSVVCCVKFSYDGEFLATGCNKTTQVYRVSTGELIAKLSDDN 484

Query: 428 ------------YALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSL 475
                       Y  +  F P G  +  G  +  ++++D+    ++   +  HE  ++SL
Sbjct: 485 VKLDSNSTSTDLYIRSVCFSPDGKFLATGAEDKLIRIWDIQEGKIVMVLK-GHEQDVYSL 543

Query: 476 DITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRI 535
           D   DG++LV+GS D+T++ W      DL  G               T+ + + V +V +
Sbjct: 544 DYFPDGQKLVSGSGDRTVRIW------DLRTGQCS-----------LTLSIEDGVTTVAV 586

Query: 536 SPED-KFLAISLLDNTVKVFYLDSMKFFLSLY---------GHKLPVLSIDISFDSKLII 585
           SP D +F+A   LD  V+V+  DS   FL            GH+  V S+  + D   ++
Sbjct: 587 SPHDGRFIAAGSLDRAVRVW--DSTTGFLVERLDSENELGTGHQDSVYSVVFTRDGNEVV 644

Query: 586 TSSADKNIKIWGLDF------------------------------GDCHKSLFAHQDSIM 615
           + S DK++K+W L                                  C  +   H+D ++
Sbjct: 645 SGSLDKSVKLWNLGNDVNSNNNGNDSSSNGTNNNNNSNRASNGTSATCEVTYVGHKDFVL 704

Query: 616 NVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSV------- 668
           +V          S SKD  V +WD      +  L  H++ V S+A+ ++G  +       
Sbjct: 705 SVTTSQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHKNSVISVAV-ANGYPLGPKYNVF 763

Query: 669 ISASHDHSLRVWE 681
            + S D   R+W+
Sbjct: 764 ATGSGDCKARIWK 776

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 90/196 (45%), Gaps = 21/196 (10%)

Query: 49  IWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLH---YHDETNLLAAGYMDGTIKVWD 105
           ++ + TGELI+ LSD     ++ + S+  +   Y+    +  +   LA G  D  I++WD
Sbjct: 468 VYRVSTGELIAKLSDD----NVKLDSNSTSTDLYIRSVCFSPDGKFLATGAEDKLIRIWD 523

Query: 106 LLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLR-SHKDAI 164
           +    +++   GH+  +  + +   G +L+SGS D  + +WDL    G   L  S +D +
Sbjct: 524 IQEGKIVMVLKGHEQDVYSLDYFPDGQKLVSGSGDRTVRIWDL--RTGQCSLTLSIEDGV 581

Query: 165 SGIWCEGED--WLVSTSKDGLIKIWDLKVQQCIET-------HIAHTGECWAMGVHED-- 213
           + +     D  ++ + S D  +++WD      +E           H    +++    D  
Sbjct: 582 TTVAVSPHDGRFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHQDSVYSVVFTRDGN 641

Query: 214 LLITSGADTQLKLWNL 229
            +++   D  +KLWNL
Sbjct: 642 EVVSGSLDKSVKLWNL 657

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 67/143 (46%), Gaps = 10/143 (6%)

Query: 542 LAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFG 601
           L   L D+ VK   LDS      LY     + S+  S D K + T + DK I+IW +  G
Sbjct: 476 LIAKLSDDNVK---LDSNSTSTDLY-----IRSVCFSPDGKFLATGAEDKLIRIWDIQEG 527

Query: 602 DCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAI 661
                L  H+  + ++ + P+     S S D  V+ WD    +C   L+     V ++A+
Sbjct: 528 KIVMVLKGHEQDVYSLDYFPDGQKLVSGSGDRTVRIWDLRTGQCSLTLSIEDG-VTTVAV 586

Query: 662 TS-DGTSVISASHDHSLRVWEET 683
           +  DG  + + S D ++RVW+ T
Sbjct: 587 SPHDGRFIAAGSLDRAVRVWDST 609

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/231 (21%), Positives = 88/231 (38%), Gaps = 66/231 (28%)

Query: 47  INIWDIKTGELISVLS--DGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVW 104
           + IWD++TG+    LS  DG+   ++               HD    +AAG +D  ++VW
Sbjct: 561 VRIWDLRTGQCSLTLSIEDGVTTVAVSP-------------HD-GRFIAAGSLDRAVRVW 606

Query: 105 D---------LLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDL------- 148
           D         L S++ L T  GH+ ++  + F   G  ++SGS D ++ +W+L       
Sbjct: 607 DSTTGFLVERLDSENELGT--GHQDSVYSVVFTRDGNEVVSGSLDKSVKLWNLGNDVNSN 664

Query: 149 -----------------------VSEVGLYKLRSHKD-AISGIWCEGEDWLVSTSKDGLI 184
                                   S         HKD  +S    + +++++S SKD  +
Sbjct: 665 NNGNDSSSNGTNNNNNSNRASNGTSATCEVTYVGHKDFVLSVTTSQNDEYILSGSKDRGV 724

Query: 185 KIWDLKVQQCIETHIAH--------TGECWAMGVHEDLLITSGADTQLKLW 227
             WD K    +     H            + +G   ++  T   D + ++W
Sbjct: 725 LFWDKKSGNPLLMLQGHKNSVISVAVANGYPLGPKYNVFATGSGDCKARIW 775

>Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa]
           {ON} complement(112044..114575) [2532 nt, 844 aa]
          Length = 843

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 97/216 (44%), Gaps = 17/216 (7%)

Query: 467 AHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEV 526
            H  A++S   + D + L++GS DKT++ W    +  LV                     
Sbjct: 561 GHSGAVYSTSFSPDNKLLISGSEDKTVRLWAMDTQSTLVSYKGH---------------- 604

Query: 527 NEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIIT 586
           N  V  V  SP   + A +  D T +++  D +       GH   V  +    +   + T
Sbjct: 605 NHPVWDVAFSPMGHYFATASHDQTARLWSCDHIYSLRIFAGHLSDVDCVTFHPNGCYVFT 664

Query: 587 SSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECI 646
            S+DK  ++W +  G+  +    H   ++++   P+     S S+DGL+  WD    + +
Sbjct: 665 GSSDKTCRMWDVSTGETVRLFLGHTAPVVSLGVSPDGRWLASGSEDGLINVWDIGSGKRL 724

Query: 647 QKLAAH-QSEVWSIAITSDGTSVISASHDHSLRVWE 681
           +++  H ++ V SI  + +GT +IS   D+S+RVW+
Sbjct: 725 KQMRGHGRNAVNSIVFSQEGTVIISGGTDNSVRVWD 760

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 91/228 (39%), Gaps = 19/228 (8%)

Query: 472 IWSLDITSDGRRLVTGSADKTIKFWNFQVEE-DLVPGTADKYLPVMKLIHDTTME----- 525
           + SLD + D R    G  D  IK W+      D +  T + +    K   D  +      
Sbjct: 491 MLSLDFSDDCRLAAAGFQDSYIKIWSLDGSSLDTLTSTNNTHF-TKKNTADNNLHSKKKH 549

Query: 526 ---VNED---------VLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVL 573
              VN +         V S   SP++K L     D TV+++ +D+    +S  GH  PV 
Sbjct: 550 QEHVNTNTKLVGHSGAVYSTSFSPDNKLLISGSEDKTVRLWAMDTQSTLVSYKGHNHPVW 609

Query: 574 SIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDG 633
            +  S       T+S D+  ++W  D     +    H   +  V F P     F+ S D 
Sbjct: 610 DVAFSPMGHYFATASHDQTARLWSCDHIYSLRIFAGHLSDVDCVTFHPNGCYVFTGSSDK 669

Query: 634 LVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWE 681
             + WD    E ++    H + V S+ ++ DG  + S S D  + VW+
Sbjct: 670 TCRMWDVSTGETVRLFLGHTAPVVSLGVSPDGRWLASGSEDGLINVWD 717

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 34/156 (21%), Positives = 69/156 (44%), Gaps = 9/156 (5%)

Query: 85  YHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNII 144
           +  +  LL +G  D T+++W + ++S L+++ GH   +  + F   G    + S D    
Sbjct: 571 FSPDNKLLISGSEDKTVRLWAMDTQSTLVSYKGHNHPVWDVAFSPMGHYFATASHDQTAR 630

Query: 145 VWDLVSEVGLYKLRSHKDAISGIWC----EGEDWLVSTSKDGLIKIWDLKVQQCIETHIA 200
           +W   S   +Y LR     +S + C        ++ + S D   ++WD+   + +   + 
Sbjct: 631 LW---SCDHIYSLRIFAGHLSDVDCVTFHPNGCYVFTGSSDKTCRMWDVSTGETVRLFLG 687

Query: 201 HTGECWAMGVHED--LLITSGADTQLKLWNLDFSKE 234
           HT    ++GV  D   L +   D  + +W++   K 
Sbjct: 688 HTAPVVSLGVSPDGRWLASGSEDGLINVWDIGSGKR 723

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 57/114 (50%), Gaps = 2/114 (1%)

Query: 78  AEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISG 137
           ++V  + +H     +  G  D T ++WD+ +   +  F GH + +  +     G  L SG
Sbjct: 648 SDVDCVTFHPNGCYVFTGSSDKTCRMWDVSTGETVRLFLGHTAPVVSLGVSPDGRWLASG 707

Query: 138 SRDSNIIVWDLVSEVGLYKLRSH-KDAISGIWCEGEDW-LVSTSKDGLIKIWDL 189
           S D  I VWD+ S   L ++R H ++A++ I    E   ++S   D  +++WD+
Sbjct: 708 SEDGLINVWDIGSGKRLKQMRGHGRNAVNSIVFSQEGTVIISGGTDNSVRVWDM 761

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 100/225 (44%), Gaps = 29/225 (12%)

Query: 382 ELPGHRTDIRSVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFDCGY---ALTCKFLPG 437
           +L GH   + S   S D+KLL + S +  +++W + T++ +  +  G+        F P 
Sbjct: 558 KLVGHSGAVYSTSFSPDNKLLISGSEDKTVRLWAMDTQSTLVSYK-GHNHPVWDVAFSPM 616

Query: 438 GTLVIVGTREGSLQLFD---LASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIK 494
           G      + + + +L+    + S  +       H + +  +    +G  + TGS+DKT +
Sbjct: 617 GHYFATASHDQTARLWSCDHIYSLRIFA----GHLSDVDCVTFHPNGCYVFTGSSDKTCR 672

Query: 495 FWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVF 554
            W+    E             ++L    T      V+S+ +SP+ ++LA    D  + V+
Sbjct: 673 MWDVSTGE------------TVRLFLGHTAP----VVSLGVSPDGRWLASGSEDGLINVW 716

Query: 555 YLDSMKFFLSLYGH-KLPVLSIDISFDSKLIITSSADKNIKIWGL 598
            + S K    + GH +  V SI  S +  +II+   D ++++W +
Sbjct: 717 DIGSGKRLKQMRGHGRNAVNSIVFSQEGTVIISGGTDNSVRVWDM 761

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/208 (19%), Positives = 75/208 (36%), Gaps = 36/208 (17%)

Query: 58  ISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSV--LLTF 115
           +S L   LP+  +    +   E+  L + D+  L AAG+ D  IK+W L   S+  L + 
Sbjct: 469 LSNLRSELPSVCMYTFHNTNREMLSLDFSDDCRLAAAGFQDSYIKIWSLDGSSLDTLTST 528

Query: 116 N-------------------------------GHKSAITVMKFDVTGTRLISGSRDSNII 144
           N                               GH  A+    F      LISGS D  + 
Sbjct: 529 NNTHFTKKNTADNNLHSKKKHQEHVNTNTKLVGHSGAVYSTSFSPDNKLLISGSEDKTVR 588

Query: 145 VWDLVSEVGLYKLRSHKDAISGI-WCEGEDWLVSTSKDGLIKIWDLKVQQCIETHIAHTG 203
           +W + ++  L   + H   +  + +     +  + S D   ++W       +     H  
Sbjct: 589 LWAMDTQSTLVSYKGHNHPVWDVAFSPMGHYFATASHDQTARLWSCDHIYSLRIFAGHLS 648

Query: 204 ECWAMGVHED--LLITSGADTQLKLWNL 229
           +   +  H +   + T  +D   ++W++
Sbjct: 649 DVDCVTFHPNGCYVFTGSSDKTCRMWDV 676

>YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}
           TAF5Subunit (90 kDa) of TFIID and SAGA complexes,
           involved in RNA polymerase II transcription initiation
           and in chromatin modification
          Length = 798

 Score = 88.2 bits (217), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 98/216 (45%), Gaps = 17/216 (7%)

Query: 467 AHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEV 526
            H   ++S   + D + L++GS DKT++ W+      LV                +    
Sbjct: 523 GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALV----------------SYKGH 566

Query: 527 NEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIIT 586
           N  V  V  SP   + A +  D T +++  D +       GH   V  +    +   + T
Sbjct: 567 NHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFT 626

Query: 587 SSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECI 646
            S+DK  ++W +  GD  +    H   ++++   P+     + S+DG++  WD    + +
Sbjct: 627 GSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRL 686

Query: 647 QKLAAH-QSEVWSIAITSDGTSVISASHDHSLRVWE 681
           +++  H ++ ++S++ + +G  +IS   DH++RVW+
Sbjct: 687 KQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWD 722

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 80/186 (43%), Gaps = 18/186 (9%)

Query: 522 TTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFL-----------------S 564
           T    N+D+  +  S + +  A    D+ +K++ LD                       +
Sbjct: 461 TFQNTNKDMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKT 520

Query: 565 LYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESH 624
           L GH   V S   S D+K +++ S DK +++W +D      S   H   + +V F P  H
Sbjct: 521 LVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGH 580

Query: 625 NFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWE-ET 683
            F ++S D   + W  D    ++  A H ++V  ++   +G  V + S D + R+W+  T
Sbjct: 581 YFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVST 640

Query: 684 DDQVFL 689
            D V L
Sbjct: 641 GDSVRL 646

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 58/114 (50%), Gaps = 2/114 (1%)

Query: 79  EVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGS 138
           +V  + +H     +  G  D T ++WD+ +   +  F GH + +  +     G  L +GS
Sbjct: 611 DVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGS 670

Query: 139 RDSNIIVWDLVSEVGLYKLRSH-KDAISGI-WCEGEDWLVSTSKDGLIKIWDLK 190
            D  I VWD+ +   L ++R H K+AI  + + +  + L+S   D  +++WDLK
Sbjct: 671 EDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLK 724

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/191 (19%), Positives = 70/191 (36%), Gaps = 46/191 (24%)

Query: 85  YHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNII 144
           +  +   L +G  D T+++W + + + L+++ GH   +  + F   G    + S D    
Sbjct: 533 FSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTAR 592

Query: 145 VW------------------DLVS--EVGLYKLRSHKDAISGIW---------------- 168
           +W                  D VS    G Y      D    +W                
Sbjct: 593 LWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTA 652

Query: 169 -------CEGEDWLVSTSKDGLIKIWDLKVQQCIETHIAHTGEC---WAMGVHEDLLITS 218
                  C    WL + S+DG+I +WD+   + ++    H        +     ++LI+ 
Sbjct: 653 PVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISG 712

Query: 219 GADTQLKLWNL 229
           GAD  +++W+L
Sbjct: 713 GADHTVRVWDL 723

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 32/171 (18%), Positives = 64/171 (37%), Gaps = 20/171 (11%)

Query: 79  EVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLL-----------------TFNGHKSA 121
           ++S L + D+  + AAG+ D  IK+W L   S+                   T  GH   
Sbjct: 468 DMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGT 527

Query: 122 ITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGEDWLVSTSK 180
           +    F      L+SGS D  + +W + +   L   + H   +  + +     +  + S 
Sbjct: 528 VYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASH 587

Query: 181 DGLIKIWDLKVQQCIETHIAHTGECWAMGVHED--LLITSGADTQLKLWNL 229
           D   ++W       +     H  +   +  H +   + T  +D   ++W++
Sbjct: 588 DQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDV 638

 Score = 35.8 bits (81), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 11/60 (18%)

Query: 47  INIWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDL 106
           IN+WDI TG+ +  +           +      +  L Y  E N+L +G  D T++VWDL
Sbjct: 675 INVWDIGTGKRLKQM-----------RGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDL 723

>Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON}
           YBR198C (REAL)
          Length = 802

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 62/295 (21%), Positives = 127/295 (43%), Gaps = 39/295 (13%)

Query: 389 DIRSVDISDDDKLLATA-SNGLLKVWNLKTKACIRVFDCGYALTCKFLPGGTLVIVGTRE 447
           D+  ++ SDD ++ A    +  +K+W+L           G +L          +++ +  
Sbjct: 469 DMSCLNFSDDCRIAAAGFQDSYIKIWSLD----------GSSLN------NPNIMLNSAN 512

Query: 448 GSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPG 507
            + +  D    TL+      H   ++S   + D + L++GS DKT++ W+      LV  
Sbjct: 513 NNYRDDDPTCKTLV-----GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALV-- 565

Query: 508 TADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYG 567
                         +    N  V  V  SP   + A +  D T +++  D +       G
Sbjct: 566 --------------SYKGHNHPVWDVNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAG 611

Query: 568 HKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFF 627
           H   V  +    +   + T S+DK  ++W +  GD  +    H   ++ +   P+     
Sbjct: 612 HLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLS 671

Query: 628 SSSKDGLVKYWDGDKFECIQKLAAH-QSEVWSIAITSDGTSVISASHDHSLRVWE 681
           + S+DG++  WD    + ++++  H ++ ++S++ + +G  +IS   DHS+RVW+
Sbjct: 672 TGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWD 726

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 69/146 (47%), Gaps = 1/146 (0%)

Query: 545 SLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCH 604
           +++ N+    Y D      +L GH   V S   S D+K +++ S DK +++W +D     
Sbjct: 505 NIMLNSANNNYRDDDPTCKTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTAL 564

Query: 605 KSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSD 664
            S   H   + +V F P  H F ++S D   + W  D    ++  A H ++V  ++   +
Sbjct: 565 VSYKGHNHPVWDVNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPN 624

Query: 665 GTSVISASHDHSLRVWE-ETDDQVFL 689
           G  V + S D + R+W+  T D V L
Sbjct: 625 GCYVFTGSSDKTCRMWDVSTGDSVRL 650

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 62/142 (43%), Gaps = 4/142 (2%)

Query: 92  LAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSE 151
            A    D T ++W       L  F GH + +  + F   G  + +GS D    +WD+ + 
Sbjct: 586 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTG 645

Query: 152 VGLYKLRSHKDAISGIWCEGED-WLVSTSKDGLIKIWDLKVQQCIETHIAHTGEC---WA 207
             +     H   +  I    +  WL + S+DG+I IWD+   + ++    H        +
Sbjct: 646 DSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLS 705

Query: 208 MGVHEDLLITSGADTQLKLWNL 229
                ++LI+ GAD  +++W+L
Sbjct: 706 YSKEGNVLISGGADHSVRVWDL 727

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 58/114 (50%), Gaps = 2/114 (1%)

Query: 79  EVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGS 138
           +V  + +H     +  G  D T ++WD+ +   +  F GH + +  +     G  L +GS
Sbjct: 615 DVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGS 674

Query: 139 RDSNIIVWDLVSEVGLYKLRSH-KDAISGI-WCEGEDWLVSTSKDGLIKIWDLK 190
            D  I +WD+ +   L ++R H K+AI  + + +  + L+S   D  +++WDLK
Sbjct: 675 EDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLK 728

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/156 (19%), Positives = 64/156 (41%), Gaps = 9/156 (5%)

Query: 85  YHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNII 144
           +  +   L +G  D T+++W + + + L+++ GH   +  + F   G    + S D    
Sbjct: 537 FSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTAR 596

Query: 145 VWDLVSEVGLYKLRSHKDAISGIWC----EGEDWLVSTSKDGLIKIWDLKVQQCIETHIA 200
           +W   S   +Y LR     ++ + C        ++ + S D   ++WD+     +   + 
Sbjct: 597 LW---SCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLG 653

Query: 201 HTGECWAMGVHED--LLITSGADTQLKLWNLDFSKE 234
           HT     + V  D   L T   D  + +W++   K 
Sbjct: 654 HTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKR 689

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 33/174 (18%), Positives = 67/174 (38%), Gaps = 23/174 (13%)

Query: 79  EVSYLHYHDETNLLAAGYMDGTIKVWDLLSKS-----VLL---------------TFNGH 118
           ++S L++ D+  + AAG+ D  IK+W L   S     ++L               T  GH
Sbjct: 469 DMSCLNFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIMLNSANNNYRDDDPTCKTLVGH 528

Query: 119 KSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGEDWLVS 177
              +    F      L+SGS D  + +W + +   L   + H   +  + +     +  +
Sbjct: 529 SGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFAT 588

Query: 178 TSKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHED--LLITSGADTQLKLWNL 229
            S D   ++W       +     H  +   +  H +   + T  +D   ++W++
Sbjct: 589 ASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDV 642

 Score = 36.6 bits (83), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 41/86 (47%), Gaps = 20/86 (23%)

Query: 23  CVWMSPESKKSNSPGSVITSALEN--INIWDIKTGELISVLSDGLPAGSIDVKSSKPAEV 80
           C+ +SP+       G  +++  E+  INIWDI TG+ +  +           +      +
Sbjct: 660 CIAVSPD-------GRWLSTGSEDGIINIWDIGTGKRLKQM-----------RGHGKNAI 701

Query: 81  SYLHYHDETNLLAAGYMDGTIKVWDL 106
             L Y  E N+L +G  D +++VWDL
Sbjct: 702 YSLSYSKEGNVLISGGADHSVRVWDL 727

>NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa]
           {ON} Anc_6.363
          Length = 671

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 81/348 (23%), Positives = 148/348 (42%), Gaps = 73/348 (20%)

Query: 386 HRTDIRSVDISDDDKLLATASNGLLKVWNLKTKACI-RVFDCG----------------- 427
           H + +  V  S+D + LAT  N   +++ +     I ++ D                   
Sbjct: 327 HSSVVCCVKFSNDGQFLATGCNKTTQIYRVSDGELIAKLSDDSVTSPDTSSATSGSTPST 386

Query: 428 --YALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLV 485
             Y  +  F P G  +  G  +  ++++D+    ++   +  HE  ++SLD   +G +LV
Sbjct: 387 DLYIRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVMVLK-GHEQDVYSLDYFPNGEKLV 445

Query: 486 TGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPED-KFLAI 544
           +GS D+T++ W      DL  G               T+ +   V +V +SP D KF+A 
Sbjct: 446 SGSGDRTVRIW------DLRTGQCS-----------LTLSIEYGVTTVAVSPNDGKFIAA 488

Query: 545 SLLDNTVKVFYLDSMKFFLSLY---------GHKLPVLSIDISFDSKLIITSSADKNIKI 595
             LD  V+V+  DS   FL            GH+  V S+  + D   +++ S DK +K+
Sbjct: 489 GSLDRAVRVW--DSTTGFLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKL 546

Query: 596 WGL-----------DFGD----CHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDG 640
           W +           D G     C  +   H+D +++V    +     S SKD  + +WD 
Sbjct: 547 WNMRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILFWDK 606

Query: 641 DKFECIQKLAAHQSEVWSIAITSDGTSV-------ISASHDHSLRVWE 681
           +    +  L  H++ V S+A+ ++G+++        + S D   R+W+
Sbjct: 607 ESGNPLLMLQGHRNSVISVAV-ANGSALGPKYNVFATGSGDCKARIWK 653

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 68/277 (24%), Positives = 123/277 (44%), Gaps = 58/277 (20%)

Query: 377 RLYTIELPGHRTDIRSVD-ISDDDKLLATASNGLLKVWNLKTKACIRVFDCGYALTCKFL 435
           R   + L GH  D+ S+D   + +KL++ + +  +++W+L+T  C       Y +T   +
Sbjct: 419 RKIVMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLRTGQCSLTLSIEYGVTTVAV 478

Query: 436 -PG-GTLVIVGTREGSLQLFDLASSTLLENKED------AHETAIWSLDITSDGRRLVTG 487
            P  G  +  G+ + +++++D  +  L+E  +        H  +++S+  T DG  +V+G
Sbjct: 479 SPNDGKFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSG 538

Query: 488 SADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLL 547
           S DKT+K WN                  M+   ++  E N           DK  A +  
Sbjct: 539 SLDKTVKLWN------------------MRHSGNSNNESN-----------DKGSASA-- 567

Query: 548 DNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSL 607
             T +V Y+          GHK  VLS+  S D K I++ S D+ I  W  + G+    L
Sbjct: 568 --TCEVTYV----------GHKDFVLSVTTSQDDKYILSGSKDRGILFWDKESGNPLLML 615

Query: 608 FAHQDSIMNVKFL------PESHNFFSSSKDGLVKYW 638
             H++S+++V         P+ + F + S D   + W
Sbjct: 616 QGHRNSVISVAVANGSALGPKYNVFATGSGDCKARIW 652

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 101/231 (43%), Gaps = 20/231 (8%)

Query: 31  KKSNSPGSVITSALENINIWDIKTGELISVLSDGL---PAGSIDVKSSKPAEVSYLH--- 84
           K SN    + T   +   I+ +  GELI+ LSD     P  S     S P+   Y+    
Sbjct: 335 KFSNDGQFLATGCNKTTQIYRVSDGELIAKLSDDSVTSPDTSSATSGSTPSTDLYIRSVC 394

Query: 85  YHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNII 144
           +  +   LA G  D  I++WD+  + +++   GH+  +  + +   G +L+SGS D  + 
Sbjct: 395 FSPDGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVR 454

Query: 145 VWDLVSEVGLYKLR-SHKDAISGIWCEGED--WLVSTSKDGLIKIWDLKVQQCIET---- 197
           +WDL    G   L  S +  ++ +     D  ++ + S D  +++WD      +E     
Sbjct: 455 IWDL--RTGQCSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTGFLVERLDSE 512

Query: 198 ---HIAHTGECWAMGVHED--LLITSGADTQLKLWNLDFSKEAGSKLIEKG 243
                 H    +++    D   +++   D  +KLWN+  S  + ++  +KG
Sbjct: 513 NELGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNMRHSGNSNNESNDKG 563

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 55/113 (48%), Gaps = 2/113 (1%)

Query: 572 VLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSK 631
           + S+  S D + + T + DK I+IW +        L  H+  + ++ + P      S S 
Sbjct: 390 IRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSG 449

Query: 632 DGLVKYWDGDKFECIQKLAAHQSEVWSIAIT-SDGTSVISASHDHSLRVWEET 683
           D  V+ WD    +C   L+     V ++A++ +DG  + + S D ++RVW+ T
Sbjct: 450 DRTVRIWDLRTGQCSLTLSIEYG-VTTVAVSPNDGKFIAAGSLDRAVRVWDST 501

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 75/175 (42%), Gaps = 28/175 (16%)

Query: 7   RFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISVL--SDG 64
           R  Q S+   I      V +SP   K  + GS+  +    + +WD  TG L+  L   + 
Sbjct: 459 RTGQCSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRA----VRVWDSTTGFLVERLDSENE 514

Query: 65  LPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDL---------------LSK 109
           L  G  D        V  + +  + N + +G +D T+K+W++                S 
Sbjct: 515 LGTGHRD-------SVYSVVFTRDGNEVVSGSLDKTVKLWNMRHSGNSNNESNDKGSASA 567

Query: 110 SVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAI 164
           +  +T+ GHK  +  +        ++SGS+D  I+ WD  S   L  L+ H++++
Sbjct: 568 TCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILFWDKESGNPLLMLQGHRNSV 622

>CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some
           similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084c TUP1
          Length = 836

 Score = 87.4 bits (215), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 75/300 (25%), Positives = 123/300 (41%), Gaps = 81/300 (27%)

Query: 385 GHRTD--IRSVDISDDDKLLAT-ASNGLLKVWNLKTKACIRVFDCGYALTCKFLPGGTLV 441
           G  TD  IRSV  S D K LAT A + L+++W+++ K  + V                  
Sbjct: 551 GATTDLYIRSVCFSPDGKFLATGAEDKLIRIWDIEQKKIVMVLK---------------- 594

Query: 442 IVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVE 501
                                     HE  I+SLD    G +LV+GS D+T++ W+ +  
Sbjct: 595 -------------------------GHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLKTG 629

Query: 502 EDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPED-KFLAISLLDNTVKVFYLDSMK 560
           +  +                 T+ + + V +V +SP D KF+A   LD  V+V+  D+  
Sbjct: 630 QCTL-----------------TLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSDTGF 672

Query: 561 FFLSL-------YGHKLPVLSIDISFDSKLIITSSADKNIKIWGL------------DFG 601
               L        GHK  V S+  + D   +++ S D+++K+W L              G
Sbjct: 673 LVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSG 732

Query: 602 DCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAI 661
            C  +   H+D +++V    +     S SKD  V +WD      +  L  H++ V S+A+
Sbjct: 733 TCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWDKVSGNPLLMLQGHRNSVISVAV 792

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 107/229 (46%), Gaps = 19/229 (8%)

Query: 468 HETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVN 527
           H + +  +  ++DG  L TG  +KT + +    + +LV   +D+     K   +   E  
Sbjct: 490 HTSVVCCVKFSNDGEFLATG-CNKTTQIYRVS-DGELVARFSDENAHTDKADGNDNAEAE 547

Query: 528 ED--------VLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISF 579
                     + SV  SP+ KFLA    D  ++++ ++  K  + L GH+  + S+D   
Sbjct: 548 TSAGATTDLYIRSVCFSPDGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFP 607

Query: 580 DSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSS-SKDGLVKYW 638
               +++ S D+ ++IW L  G C  +L + +D +  V   P    F ++ S D  V+ W
Sbjct: 608 SGDKLVSGSGDRTVRIWDLKTGQCTLTL-SIEDGVTTVAVSPGDGKFIAAGSLDRAVRVW 666

Query: 639 DGDKFECIQKL-------AAHQSEVWSIAITSDGTSVISASHDHSLRVW 680
           D D    +++L         H+  V+S+  T DG  V+S S D S+++W
Sbjct: 667 DSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLW 715

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 107/230 (46%), Gaps = 19/230 (8%)

Query: 383 LPGHRTDIRSVD-ISDDDKLLATASNGLLKVWNLKTKACIRVFDCGYALTCKFL-PG-GT 439
           L GH  DI S+D     DKL++ + +  +++W+LKT  C         +T   + PG G 
Sbjct: 593 LKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCTLTLSIEDGVTTVAVSPGDGK 652

Query: 440 LVIVGTREGSLQLFDLASSTLLENKED------AHETAIWSLDITSDGRRLVTGSADKTI 493
            +  G+ + +++++D  +  L+E  +        H+ +++S+  T DG  +V+GS D+++
Sbjct: 653 FIAAGSLDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSV 712

Query: 494 KFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKV 553
           K WN +   ++    AD   P       T     + VLSV  + +D+++     D  V  
Sbjct: 713 KLWNLR---NVNHNNADGK-PTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLF 768

Query: 554 FYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDC 603
           +   S    L L GH+  V+S+ ++    L        N  I+    GDC
Sbjct: 769 WDKVSGNPLLMLQGHRNSVISVAVNHGHPL------GPNYHIFATGSGDC 812

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 49/213 (23%), Positives = 92/213 (43%), Gaps = 23/213 (10%)

Query: 39  VITSALENINIWDIKTGELISVLSD-GLPAGSIDVKSSKPAEVS-------YLH---YHD 87
           + T   +   I+ +  GEL++  SD        D   +  AE S       Y+    +  
Sbjct: 506 LATGCNKTTQIYRVSDGELVARFSDENAHTDKADGNDNAEAETSAGATTDLYIRSVCFSP 565

Query: 88  ETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWD 147
           +   LA G  D  I++WD+  K +++   GH+  I  + +  +G +L+SGS D  + +WD
Sbjct: 566 DGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 625

Query: 148 LVSEVGLYKLRSHKDAISGIWCEGED--WLVSTSKDGLIKIWDLKVQQCIET-------H 198
           L +      L S +D ++ +     D  ++ + S D  +++WD      +E         
Sbjct: 626 LKTGQCTLTL-SIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSDTGFLVERLDSENELG 684

Query: 199 IAHTGECWAMGVHED--LLITSGADTQLKLWNL 229
             H    +++    D   +++   D  +KLWNL
Sbjct: 685 TGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNL 717

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 58/119 (48%), Gaps = 4/119 (3%)

Query: 572 VLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSK 631
           + S+  S D K + T + DK I+IW ++       L  H+  I ++ + P      S S 
Sbjct: 558 IRSVCFSPDGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSG 617

Query: 632 DGLVKYWDGDKFECIQKLAAHQSEVWSIAIT-SDGTSVISASHDHSLRVWEETDDQVFL 689
           D  V+ WD    +C   L+  +  V ++A++  DG  + + S D ++RVW+   D  FL
Sbjct: 618 DRTVRIWDLKTGQCTLTLSI-EDGVTTVAVSPGDGKFIAAGSLDRAVRVWDS--DTGFL 673

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 73/166 (43%), Gaps = 40/166 (24%)

Query: 47  INIWDIKTGELISVLS--DGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVW 104
           + IWD+KTG+    LS  DG+   ++     K               +AAG +D  ++VW
Sbjct: 621 VRIWDLKTGQCTLTLSIEDGVTTVAVSPGDGK--------------FIAAGSLDRAVRVW 666

Query: 105 D---------LLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDL------- 148
           D         L S++ L T  GHK ++  + F   G  ++SGS D ++ +W+L       
Sbjct: 667 DSDTGFLVERLDSENELGT--GHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVNHNN 724

Query: 149 -----VSEVGLYKLRSHKD-AISGIWCEGEDWLVSTSKDGLIKIWD 188
                 S         HKD  +S    E +++++S SKD  +  WD
Sbjct: 725 ADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWD 770

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 71/162 (43%), Gaps = 28/162 (17%)

Query: 47  INIWDIKTGELISVL--SDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVW 104
           + +WD  TG L+  L   + L  G  D        V  + +  + N + +G +D ++K+W
Sbjct: 663 VRVWDSDTGFLVERLDSENELGTGHKD-------SVYSVVFTRDGNGVVSGSLDRSVKLW 715

Query: 105 DL------------LSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEV 152
           +L             S +  +T+ GHK  +  +        ++SGS+D  ++ WD VS  
Sbjct: 716 NLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWDKVSGN 775

Query: 153 GLYKLRSHKDAISGIWCE-----GEDW--LVSTSKDGLIKIW 187
            L  L+ H++++  +        G ++    + S D   +IW
Sbjct: 776 PLLMLQGHRNSVISVAVNHGHPLGPNYHIFATGSGDCKARIW 817

>TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8.544
           YBR198C
          Length = 832

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 101/219 (46%), Gaps = 19/219 (8%)

Query: 467 AHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEV 526
            H  AI+S   + D + LV+ S DKTI+ W+      LV                T    
Sbjct: 551 GHSGAIYSTSFSPDNKLLVSASEDKTIRLWSMDTRTTLV----------------TYKGH 594

Query: 527 NEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLY-GHKLPVLSIDISFDSKLII 585
           N  V  V+ SP   + A +  D T +++  D + F L ++ GH   V  +    +   I 
Sbjct: 595 NHPVWDVQFSPVGHYFATASHDQTARLWSCDHI-FPLRIFSGHISDVDCVTFHPNGCYIF 653

Query: 586 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFEC 645
           T S+DK  ++W +  G+  +    H   I++V   P+     + S+DG++  WD    + 
Sbjct: 654 TGSSDKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHIWDIGTGKS 713

Query: 646 IQKLAAH-QSEVWSIAITSDGTSVISASHDHSLRVWEET 683
           ++KL  H +S V S++   +   ++S   D+S+R+W+ T
Sbjct: 714 LKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDLT 752

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 92/215 (42%), Gaps = 28/215 (13%)

Query: 472 IWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVL 531
           + SL  ++D R    G  D  IK W+                     +  TT+E      
Sbjct: 478 MLSLSYSNDCRLAAAGFKDSYIKVWS---------------------LDGTTLESK---- 512

Query: 532 SVRISPEDKFLAISL-LDNTV--KVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSS 588
           + +I P     A+   LDN +  K    ++    + L GH   + S   S D+KL++++S
Sbjct: 513 ATKIQPSKSQAALRAGLDNKINEKTRSQETPITTVKLVGHSGAIYSTSFSPDNKLLVSAS 572

Query: 589 ADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQK 648
            DK I++W +D      +   H   + +V+F P  H F ++S D   + W  D    ++ 
Sbjct: 573 EDKTIRLWSMDTRTTLVTYKGHNHPVWDVQFSPVGHYFATASHDQTARLWSCDHIFPLRI 632

Query: 649 LAAHQSEVWSIAITSDGTSVISASHDHSLRVWEET 683
            + H S+V  +    +G  + + S D + R+W+ T
Sbjct: 633 FSGHISDVDCVTFHPNGCYIFTGSSDKTCRMWDIT 667

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 56/266 (21%), Positives = 100/266 (37%), Gaps = 59/266 (22%)

Query: 376 TRLYTIELPGHRTDIRSVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFDCGYALTCKF 434
           T + T++L GH   I S   S D+KLL +AS +  +++W++ T+  +  +          
Sbjct: 542 TPITTVKLVGHSGAIYSTSFSPDNKLLVSASEDKTIRLWSMDTRTTLVTY---------- 591

Query: 435 LPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIK 494
                                            H   +W +  +  G    T S D+T +
Sbjct: 592 -------------------------------KGHNHPVWDVQFSPVGHYFATASHDQTAR 620

Query: 495 FWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVF 554
            W           + D   P +++      +V+     V   P   ++     D T +++
Sbjct: 621 LW-----------SCDHIFP-LRIFSGHISDVD----CVTFHPNGCYIFTGSSDKTCRMW 664

Query: 555 YLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSI 614
            + + +      GH  P+LS+ ++ D   + T S D  I IW +  G   K L  H  S 
Sbjct: 665 DITTGESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHIWDIGTGKSLKKLIGHGKSA 724

Query: 615 MN-VKFLPESHNFFSSSKDGLVKYWD 639
           +N + +  ES+   S   D  V+ WD
Sbjct: 725 VNSLSYNKESNILVSGGSDNSVRIWD 750

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 59/116 (50%), Gaps = 2/116 (1%)

Query: 78  AEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISG 137
           ++V  + +H     +  G  D T ++WD+ +   +  F GH + I  +     G RL +G
Sbjct: 638 SDVDCVTFHPNGCYIFTGSSDKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATG 697

Query: 138 SRDSNIIVWDLVSEVGLYKLRSH-KDAISGI-WCEGEDWLVSTSKDGLIKIWDLKV 191
           S D  I +WD+ +   L KL  H K A++ + + +  + LVS   D  ++IWDL V
Sbjct: 698 SEDGVIHIWDIGTGKSLKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDLTV 753

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 72/165 (43%), Gaps = 10/165 (6%)

Query: 85  YHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNII 144
           +  +  LL +   D TI++W + +++ L+T+ GH   +  ++F   G    + S D    
Sbjct: 561 FSPDNKLLVSASEDKTIRLWSMDTRTTLVTYKGHNHPVWDVQFSPVGHYFATASHDQTAR 620

Query: 145 VWDLVSEVGLYKLRSHKDAISGIWC----EGEDWLVSTSKDGLIKIWDLKVQQCIETHIA 200
           +W   S   ++ LR     IS + C        ++ + S D   ++WD+   + +   I 
Sbjct: 621 LW---SCDHIFPLRIFSGHISDVDCVTFHPNGCYIFTGSSDKTCRMWDITTGESVRLFIG 677

Query: 201 HTGECWAMGVHED--LLITSGADTQLKLWNLDFSKEAGSKLIEKG 243
           HT    ++ V  D   L T   D  + +W++   K    KLI  G
Sbjct: 678 HTAPILSVAVAPDGLRLATGSEDGVIHIWDIGTGKSL-KKLIGHG 721

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 64/142 (45%), Gaps = 4/142 (2%)

Query: 92  LAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSE 151
            A    D T ++W       L  F+GH S +  + F   G  + +GS D    +WD+ + 
Sbjct: 610 FATASHDQTARLWSCDHIFPLRIFSGHISDVDCVTFHPNGCYIFTGSSDKTCRMWDITTG 669

Query: 152 VGLYKLRSHKDAISGIWCEGEDWLVST-SKDGLIKIWDLKVQQCIETHIAHTGEC---WA 207
             +     H   I  +    +   ++T S+DG+I IWD+   + ++  I H        +
Sbjct: 670 ESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHIWDIGTGKSLKKLIGHGKSAVNSLS 729

Query: 208 MGVHEDLLITSGADTQLKLWNL 229
                ++L++ G+D  +++W+L
Sbjct: 730 YNKESNILVSGGSDNSVRIWDL 751

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 64/129 (49%), Gaps = 7/129 (5%)

Query: 375 PTRLYTIELPGHRTDIRSVDISDDDKLLAT-ASNGLLKVWNLKTKACIRVFDCGYA--LT 431
           P R+++    GH +D+  V    +   + T +S+   ++W++ T   +R+F    A  L+
Sbjct: 629 PLRIFS----GHISDVDCVTFHPNGCYIFTGSSDKTCRMWDITTGESVRLFIGHTAPILS 684

Query: 432 CKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADK 491
               P G  +  G+ +G + ++D+ +   L+      ++A+ SL    +   LV+G +D 
Sbjct: 685 VAVAPDGLRLATGSEDGVIHIWDIGTGKSLKKLIGHGKSAVNSLSYNKESNILVSGGSDN 744

Query: 492 TIKFWNFQV 500
           +++ W+  V
Sbjct: 745 SVRIWDLTV 753

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 65/156 (41%), Gaps = 11/156 (7%)

Query: 79  EVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGS 138
           E+  L Y ++  L AAG+ D  IKVW L   ++       +S  T ++   +   L +G 
Sbjct: 477 EMLSLSYSNDCRLAAAGFKDSYIKVWSLDGTTL-------ESKATKIQPSKSQAALRAGL 529

Query: 139 RDS-NIIVWDLVSEVGLYKLRSHKDAI-SGIWCEGEDWLVSTSKDGLIKIWDLKVQQCIE 196
            +  N       + +   KL  H  AI S  +      LVS S+D  I++W +  +  + 
Sbjct: 530 DNKINEKTRSQETPITTVKLVGHSGAIYSTSFSPDNKLLVSASEDKTIRLWSMDTRTTLV 589

Query: 197 THIAHTGECWAMGVHE--DLLITSGADTQLKLWNLD 230
           T+  H    W +          T+  D   +LW+ D
Sbjct: 590 TYKGHNHPVWDVQFSPVGHYFATASHDQTARLWSCD 625

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 11/60 (18%)

Query: 47  INIWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDL 106
           I+IWDI TG+ +  L          +   K A V+ L Y+ E+N+L +G  D ++++WDL
Sbjct: 703 IHIWDIGTGKSLKKL----------IGHGKSA-VNSLSYNKESNILVSGGSDNSVRIWDL 751

>Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa]
           {ON} YCR084C (TUP1) - glucose repression regulatory
           protein, exhibits similarity to beta subunits of G
           proteins [contig 17] FULL
          Length = 750

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 69/282 (24%), Positives = 124/282 (43%), Gaps = 48/282 (17%)

Query: 428 YALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTG 487
           Y  +  F P G  +  G  +  ++++DLA+  ++   +  HE  I+SLD    G +LV+G
Sbjct: 472 YIRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQ-GHEQDIYSLDYFPSGDKLVSG 530

Query: 488 SADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPED-KFLAISL 546
           S D+T++ W+ +  +  +                 T+ + + V +V +SP D K +A   
Sbjct: 531 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKLIAAGS 573

Query: 547 LDNTVKVFYLDSMKFFLSLY---------GHKLPVLSIDISFDSKLIITSSADKNIKIWG 597
           LD TV+++  DS   FL            GHK  V S+  + D   +++ S D+++K+W 
Sbjct: 574 LDRTVRIW--DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWN 631

Query: 598 L------------DFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFEC 645
           L            +      +   H+D +++V          S SKD  V +WD      
Sbjct: 632 LRSANGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNP 691

Query: 646 IQKLAAHQSEVWSIAITSDGT------SVISASHDHSLRVWE 681
           +  L  H++ V S+A+ +D           + S D   R+W+
Sbjct: 692 LLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIWK 733

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 113/237 (47%), Gaps = 21/237 (8%)

Query: 376 TRLYTIELPGHRTDIRSVD-ISDDDKLLATASNGLLKVWNLKTKACIRVFDCGYALTCKF 434
           TR   + L GH  DI S+D     DKL++ + +  +++W+L+T  C         +T   
Sbjct: 501 TRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVA 560

Query: 435 L-PG-GTLVIVGTREGSLQLFDLASSTLLENKED------AHETAIWSLDITSDGRRLVT 486
           + PG G L+  G+ + +++++D  +  L+E  +        H+ +++S+  T DG  +V+
Sbjct: 561 VSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVS 620

Query: 487 GSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNED-VLSVRISPEDKFLAIS 545
           GS D+++K WN +       GTA+          + T   ++D VLSV  +  D+F+   
Sbjct: 621 GSLDRSVKLWNLRSANG---GTAEGK--ANTAASEVTYTGHKDFVLSVATTQNDEFILSG 675

Query: 546 LLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKL------IITSSADKNIKIW 596
             D  V  +   S    L L GH+  V+S+ ++ D  L        T S D   +IW
Sbjct: 676 SKDRGVLFWDTPSGNPLLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIW 732

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/220 (24%), Positives = 101/220 (45%), Gaps = 31/220 (14%)

Query: 39  VITSALENINIWDIKTGELISVLSD---GLPAGSIDVKSSKPAEVS-----------YLH 84
           + T   +   ++ + TGELI+ LS+     P+G+    +S+ A+ S           Y+ 
Sbjct: 415 LATGCNKTTQVYKVSTGELIARLSEDASSAPSGADASATSENAKASPAVATSASSDLYIR 474

Query: 85  ---YHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDS 141
              +  +   LA G  D  I++WDL ++ +++T  GH+  I  + +  +G +L+SGS D 
Sbjct: 475 SVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDR 534

Query: 142 NIIVWDLVSEVGLYKLR-SHKDAISGIWCEGED--WLVSTSKDGLIKIWDLKVQQCIET- 197
            + +WDL    G   L  S +D ++ +     D   + + S D  ++IWD +    +E  
Sbjct: 535 TVRIWDL--RTGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERL 592

Query: 198 ------HIAHTGECWAMGVHED--LLITSGADTQLKLWNL 229
                    H    +++    D   +++   D  +KLWNL
Sbjct: 593 DSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNL 632

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/207 (22%), Positives = 85/207 (41%), Gaps = 32/207 (15%)

Query: 7   RFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISVL--SDG 64
           R  Q S+   I      V +SP   K  + GS+       + IWD +TG L+  L   + 
Sbjct: 542 RTGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLD----RTVRIWDSETGFLVERLDSENE 597

Query: 65  LPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSK------------SVL 112
           L  G  D        V  + +  + + + +G +D ++K+W+L S             +  
Sbjct: 598 LGTGHKD-------SVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGTAEGKANTAASE 650

Query: 113 LTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGE 172
           +T+ GHK  +  +        ++SGS+D  ++ WD  S   L  L+ H++++  +    +
Sbjct: 651 VTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNSVISVAVAND 710

Query: 173 DWL-------VSTSKDGLIKIWDLKVQ 192
             L        + S D   +IW    Q
Sbjct: 711 HPLGPEYGVFATGSGDCKARIWKYSKQ 737

>NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {ON}
           Anc_8.544
          Length = 822

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 62/284 (21%), Positives = 119/284 (41%), Gaps = 38/284 (13%)

Query: 420 CIRVFDC--GYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDA---------- 467
           C+  F    G   + +F     LV  G ++  ++L+ L  S+L + +E +          
Sbjct: 479 CMYTFHNTNGGMTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINTGDMN 538

Query: 468 ---------HETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKL 518
                    H  A++S   + D R L++GS DKT++ W+      LV             
Sbjct: 539 DNTSTTLIGHSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLV------------- 585

Query: 519 IHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDIS 578
              +    N  V  V+ SP   + A +  D T +++  D +       GH   V  +   
Sbjct: 586 ---SYKGHNHPVWDVQFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFH 642

Query: 579 FDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYW 638
            +   + T S+DK  ++W +  GD  +    H   ++     P+     + S+DG++  W
Sbjct: 643 PNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINLW 702

Query: 639 DGDKFECIQKLAAH-QSEVWSIAITSDGTSVISASHDHSLRVWE 681
           D    + ++ +  H ++ + S++   +G  ++S   DHS+RVW+
Sbjct: 703 DIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWD 746

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 87/196 (44%), Gaps = 25/196 (12%)

Query: 515 VMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLD--SMKFF---------- 562
            M   H+T    N  + S++ S + + +A    D+ +K++ LD  S+K            
Sbjct: 479 CMYTFHNT----NGGMTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINT 534

Query: 563 --------LSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSI 614
                    +L GH   V S   S D++ +++ S DK +++W  D      S   H   +
Sbjct: 535 GDMNDNTSTTLIGHSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPV 594

Query: 615 MNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHD 674
            +V+F P  H F ++S D   + W  D    ++  A H S+V  ++   +G  V + S D
Sbjct: 595 WDVQFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSD 654

Query: 675 HSLRVWE-ETDDQVFL 689
            + R+W+  T D V L
Sbjct: 655 KTCRMWDISTGDSVRL 670

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 58/115 (50%), Gaps = 2/115 (1%)

Query: 78  AEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISG 137
           ++V  + +H     +  G  D T ++WD+ +   +  F GH + +        G  L +G
Sbjct: 634 SDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATG 693

Query: 138 SRDSNIIVWDLVSEVGLYKLRSH-KDAISGI-WCEGEDWLVSTSKDGLIKIWDLK 190
           S D  I +WD+ +   L  +R H K+AI  + +C+  + LVS   D  +++WDLK
Sbjct: 694 SEDGIINLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDLK 748

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 72/159 (45%), Gaps = 7/159 (4%)

Query: 92  LAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSE 151
            A    D T ++W       L  F GH S +  + F   G  + +GS D    +WD+ + 
Sbjct: 606 FATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTG 665

Query: 152 VGLYKLRSHKDAI--SGIWCEGEDWLVSTSKDGLIKIWDL---KVQQCIETHIAHTGECW 206
             +     H   +  + +  +G  WL + S+DG+I +WD+   K  + +  H  +     
Sbjct: 666 DSVRLFLGHTAPVLCTAVSPDGR-WLATGSEDGIINLWDIGTAKRLKVMRGHGKNAIHSL 724

Query: 207 AMGVHEDLLITSGADTQLKLWNLDFS-KEAGSKLIEKGV 244
           +     ++L++ GAD  +++W+L  S  E G +  E+ V
Sbjct: 725 SYCKEGNVLVSGGADHSVRVWDLKKSTAEPGPEPEEQFV 763

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 75/159 (47%), Gaps = 9/159 (5%)

Query: 375 PTRLYTIELPGHRTDIRSVDISDDDKLLAT-ASNGLLKVWNLKTKACIRVF--DCGYALT 431
           P R++     GH +D+  V    +   + T +S+   ++W++ T   +R+F       L 
Sbjct: 625 PLRIFA----GHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLC 680

Query: 432 CKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADK 491
               P G  +  G+ +G + L+D+ ++  L+      + AI SL    +G  LV+G AD 
Sbjct: 681 TAVSPDGRWLATGSEDGIINLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADH 740

Query: 492 TIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDV 530
           +++ W+ + +    PG   +    +  I + T  +N+D+
Sbjct: 741 SVRVWDLK-KSTAEPGPEPEEQ-FVGYIGNLTASINQDI 777

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 65/156 (41%), Gaps = 9/156 (5%)

Query: 85  YHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNII 144
           +  +   L +G  D T+++W   + + L+++ GH   +  ++F   G    + S D    
Sbjct: 557 FSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGHYFATASHDQTAR 616

Query: 145 VWDLVSEVGLYKLRSHKDAISGIWC----EGEDWLVSTSKDGLIKIWDLKVQQCIETHIA 200
           +W   S   +Y LR     +S + C        ++ + S D   ++WD+     +   + 
Sbjct: 617 LW---SCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLG 673

Query: 201 HTGE--CWAMGVHEDLLITSGADTQLKLWNLDFSKE 234
           HT    C A+      L T   D  + LW++  +K 
Sbjct: 674 HTAPVLCTAVSPDGRWLATGSEDGIINLWDIGTAKR 709

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/173 (17%), Positives = 66/173 (38%), Gaps = 23/173 (13%)

Query: 80  VSYLHYHDETNLLAAGYMDGTIKVWDL--------------------LSKSVLLTFNGHK 119
           ++ L + +++ L+AAG+ D  IK+W L                    ++ +   T  GH 
Sbjct: 490 MTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINTGDMNDNTSTTLIGHS 549

Query: 120 SAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGEDWLVST 178
            A+    F      L+SGS D  + +W   +   L   + H   +  + +     +  + 
Sbjct: 550 GAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGHYFATA 609

Query: 179 SKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHED--LLITSGADTQLKLWNL 229
           S D   ++W       +     H  +   +  H +   + T  +D   ++W++
Sbjct: 610 SHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDI 662

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 20/86 (23%)

Query: 23  CVWMSPESKKSNSPGSVITSALEN--INIWDIKTGELISVLSDGLPAGSIDVKSSKPAEV 80
           C  +SP+       G  + +  E+  IN+WDI T + + V+           +      +
Sbjct: 680 CTAVSPD-------GRWLATGSEDGIINLWDIGTAKRLKVM-----------RGHGKNAI 721

Query: 81  SYLHYHDETNLLAAGYMDGTIKVWDL 106
             L Y  E N+L +G  D +++VWDL
Sbjct: 722 HSLSYCKEGNVLVSGGADHSVRVWDL 747

>KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {ON}
           some similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 725

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 69/284 (24%), Positives = 124/284 (43%), Gaps = 48/284 (16%)

Query: 428 YALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTG 487
           Y  +  F P G  +  G  +  ++++DL +  ++   +  HE  I+SLD    G +LV+G
Sbjct: 450 YIRSVCFSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQ-GHEQDIYSLDYFPSGDKLVSG 508

Query: 488 SADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPED-KFLAISL 546
           S D+T++ W+ +  +  +                 T+ + + V +V +SP D K +A   
Sbjct: 509 SGDRTVRIWDLRAGQCSL-----------------TLSIEDGVTTVAVSPGDGKLIAAGS 551

Query: 547 LDNTVKVFYLDSMKFFLSLY---------GHKLPVLSIDISFDSKLIITSSADKNIKIWG 597
           LD TV+++  DS   FL            GHK  V S+  + D   +++ S D+++K+W 
Sbjct: 552 LDRTVRIW--DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWN 609

Query: 598 L------------DFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFEC 645
           L            +      +   H+D +++V          S SKD  V +WD      
Sbjct: 610 LRSANGGSTEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNP 669

Query: 646 IQKLAAHQSEVWSIAITSDGT------SVISASHDHSLRVWEET 683
           +  L  H++ V S+A+ +D           + S D   R+W+ T
Sbjct: 670 LLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIWKYT 713

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 111/238 (46%), Gaps = 23/238 (9%)

Query: 376 TRLYTIELPGHRTDIRSVD-ISDDDKLLATASNGLLKVWNLKTKACIRVFDCGYALTCKF 434
           TR   + L GH  DI S+D     DKL++ + +  +++W+L+   C         +T   
Sbjct: 479 TRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRAGQCSLTLSIEDGVTTVA 538

Query: 435 L-PG-GTLVIVGTREGSLQLFDLASSTLLENKED------AHETAIWSLDITSDGRRLVT 486
           + PG G L+  G+ + +++++D  +  L+E  +        H+ +++S+  T DG  +V+
Sbjct: 539 VSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVS 598

Query: 487 GSADKTIKFWNFQ-VEEDLVPGTADKYLPVMKLIHDTTMEVNED-VLSVRISPEDKFLAI 544
           GS D+++K WN +        G A+          + T   ++D VLSV  +  D+F+  
Sbjct: 599 GSLDRSVKLWNLRSANGGSTEGKAN------TAASEVTYTGHKDFVLSVATTQNDEFILS 652

Query: 545 SLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKL------IITSSADKNIKIW 596
              D  V  +   S    L L GH+  V+S+ ++ D  L        T S D   +IW
Sbjct: 653 GSKDRGVLFWDTPSGNPLLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIW 710

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/228 (22%), Positives = 100/228 (43%), Gaps = 33/228 (14%)

Query: 33  SNSPGSVITSALENINIWDIKTGELISVLSD---GLPAG----------------SIDVK 73
           SN    + T   +   ++ + TGEL++ LS+     P+G                ++   
Sbjct: 385 SNDGEYLATGCNKTTQVYKVSTGELVARLSEDAASAPSGNSGDGASGAENAEQTPAVSTS 444

Query: 74  SSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTR 133
           +S    +  + +  +   LA G  D  I++WDL ++ +++T  GH+  I  + +  +G +
Sbjct: 445 ASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQGHEQDIYSLDYFPSGDK 504

Query: 134 LISGSRDSNIIVWDLVSEVGLYKLR-SHKDAISGIWCEGEDW--LVSTSKDGLIKIWDLK 190
           L+SGS D  + +WDL    G   L  S +D ++ +     D   + + S D  ++IWD +
Sbjct: 505 LVSGSGDRTVRIWDL--RAGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSE 562

Query: 191 VQQCIET-------HIAHTGECWAMGVHED--LLITSGADTQLKLWNL 229
               +E           H    +++    D   +++   D  +KLWNL
Sbjct: 563 TGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNL 610

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 56/113 (49%), Gaps = 2/113 (1%)

Query: 570 LPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSS 629
           L + S+  S D K + T + DK I+IW L       +L  H+  I ++ + P      S 
Sbjct: 449 LYIRSVCFSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQGHEQDIYSLDYFPSGDKLVSG 508

Query: 630 SKDGLVKYWDGDKFECIQKLAAHQSEVWSIAIT-SDGTSVISASHDHSLRVWE 681
           S D  V+ WD    +C   L+  +  V ++A++  DG  + + S D ++R+W+
Sbjct: 509 SGDRTVRIWDLRAGQCSLTLSI-EDGVTTVAVSPGDGKLIAAGSLDRTVRIWD 560

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 76/172 (44%), Gaps = 25/172 (14%)

Query: 7   RFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISVL--SDG 64
           R  Q S+   I      V +SP   K  + GS+  +    + IWD +TG L+  L   + 
Sbjct: 520 RAGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRT----VRIWDSETGFLVERLDSENE 575

Query: 65  LPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSK------------SVL 112
           L  G  D        V  + +  + + + +G +D ++K+W+L S             +  
Sbjct: 576 LGTGHKD-------SVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGSTEGKANTAASE 628

Query: 113 LTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAI 164
           +T+ GHK  +  +        ++SGS+D  ++ WD  S   L  L+ H++++
Sbjct: 629 VTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNSV 680

>Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 97/216 (44%), Gaps = 17/216 (7%)

Query: 467 AHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEV 526
            H   +++   + D + L++GS DKT++ W+      LV                +    
Sbjct: 525 GHSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALV----------------SYKGH 568

Query: 527 NEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIIT 586
           N  V  V  SP   + A +  D T +++  D +       GH   V  +    +   + T
Sbjct: 569 NHPVWDVNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFT 628

Query: 587 SSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECI 646
            S+DK  ++W +  GD  +    H   ++ +   P+     + S+DG++  WD    + +
Sbjct: 629 GSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKRL 688

Query: 647 QKLAAH-QSEVWSIAITSDGTSVISASHDHSLRVWE 681
           +++  H ++ ++S++ + +G  +IS   DHS+RVW+
Sbjct: 689 KQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWD 724

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 62/127 (48%), Gaps = 1/127 (0%)

Query: 564 SLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPES 623
           +L GH   V +   S D+K +++ S DK +++W +D      S   H   + +V F P  
Sbjct: 522 TLVGHSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLG 581

Query: 624 HNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWE-E 682
           H F ++S D   + W  D    ++  A H ++V  ++   +G  V + S D + R+W+  
Sbjct: 582 HYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVS 641

Query: 683 TDDQVFL 689
           T D V L
Sbjct: 642 TGDSVRL 648

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 62/142 (43%), Gaps = 4/142 (2%)

Query: 92  LAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSE 151
            A    D T ++W       L  F GH + +  + F   G  + +GS D    +WD+ + 
Sbjct: 584 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTG 643

Query: 152 VGLYKLRSHKDAISGIWCEGED-WLVSTSKDGLIKIWDLKVQQCIETHIAHTGEC---WA 207
             +     H   +  I    +  WL + S+DG+I IWD+   + ++    H        +
Sbjct: 644 DSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLS 703

Query: 208 MGVHEDLLITSGADTQLKLWNL 229
                ++LI+ GAD  +++W+L
Sbjct: 704 YSKEGNVLISGGADHSVRVWDL 725

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 58/114 (50%), Gaps = 2/114 (1%)

Query: 79  EVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGS 138
           +V  + +H     +  G  D T ++WD+ +   +  F GH + +  +     G  L +GS
Sbjct: 613 DVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGS 672

Query: 139 RDSNIIVWDLVSEVGLYKLRSH-KDAISGI-WCEGEDWLVSTSKDGLIKIWDLK 190
            D  I +WD+ +   L ++R H K+AI  + + +  + L+S   D  +++WDLK
Sbjct: 673 EDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLK 726

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/155 (20%), Positives = 64/155 (41%), Gaps = 9/155 (5%)

Query: 85  YHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNII 144
           +  +   L +G  D T+++W + + + L+++ GH   +  + F   G    + S D    
Sbjct: 535 FSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTAR 594

Query: 145 VWDLVSEVGLYKLRSHKDAISGIWC----EGEDWLVSTSKDGLIKIWDLKVQQCIETHIA 200
           +W   S   +Y LR     ++ + C        ++ + S D   ++WD+     +   + 
Sbjct: 595 LW---SCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLG 651

Query: 201 HTGECWAMGVHED--LLITSGADTQLKLWNLDFSK 233
           HT     + V  D   L T   D  + +W++   K
Sbjct: 652 HTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGK 686

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/175 (18%), Positives = 64/175 (36%), Gaps = 24/175 (13%)

Query: 79  EVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLL---------------------TFNG 117
           ++S L + D+  + AAG+ D  IK+W L   S+                       T  G
Sbjct: 466 DMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIMPNINNSDHKDADDPTCKTLVG 525

Query: 118 HKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGEDWLV 176
           H   +    F      L+SGS D  + +W + +   L   + H   +  + +     +  
Sbjct: 526 HSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFA 585

Query: 177 STSKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHED--LLITSGADTQLKLWNL 229
           + S D   ++W       +     H  +   +  H +   + T  +D   ++W++
Sbjct: 586 TASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDV 640

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 41/86 (47%), Gaps = 20/86 (23%)

Query: 23  CVWMSPESKKSNSPGSVITSALEN--INIWDIKTGELISVLSDGLPAGSIDVKSSKPAEV 80
           C+ +SP+       G  +++  E+  INIWDI TG+ +  +           +      +
Sbjct: 658 CIAVSPD-------GRWLSTGSEDGIINIWDIGTGKRLKQM-----------RGHGKNAI 699

Query: 81  SYLHYHDETNLLAAGYMDGTIKVWDL 106
             L Y  E N+L +G  D +++VWDL
Sbjct: 700 YSLSYSKEGNVLISGGADHSVRVWDL 725

>KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 826

 Score = 85.1 bits (209), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 86/189 (45%), Gaps = 18/189 (9%)

Query: 515 VMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKF------------- 561
            M   H+T    N ++  V  S + +  A    D+T+KV+YLD                 
Sbjct: 490 CMYTFHNT----NGNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSN 545

Query: 562 FLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP 621
             +L GH  PV S+  S D++ ++++S DK +++W LD   C      H   +  VKF P
Sbjct: 546 SATLVGHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSP 605

Query: 622 ESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWE 681
             H F ++S D   + W  D    ++  + H ++V       +G  V + S D + R+W+
Sbjct: 606 LGHYFITASHDQTARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWD 665

Query: 682 -ETDDQVFL 689
            +T D V L
Sbjct: 666 IQTGDSVRL 674

 Score = 79.3 bits (194), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/290 (21%), Positives = 123/290 (42%), Gaps = 34/290 (11%)

Query: 410 LKVWNLKTKA---CIRVF-DCGYALTC-KFLPGGTLVIVGTREGSLQLFDLASSTL---L 461
           +++ NL+T A   C+  F +    +TC +F     L   G ++ +++++ L  S L   L
Sbjct: 477 IQLKNLQTSAPSVCMYTFHNTNGNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSIL 536

Query: 462 ENKED---------AHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKY 512
            +K            H   ++S+  + D R L++ S DKT++ W+      LV       
Sbjct: 537 PSKAKDQSNSATLVGHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGH-- 594

Query: 513 LPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPV 572
                         N  V  V+ SP   +   +  D T +++  D +       GH   V
Sbjct: 595 --------------NHPVWYVKFSPLGHYFITASHDQTARLWSCDHIYPLRIFSGHLNDV 640

Query: 573 LSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKD 632
                  +   + T S+DK  ++W +  GD  +    H   +  ++  P+     + S+D
Sbjct: 641 DCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTTGSED 700

Query: 633 GLVKYWDGDKFECIQKLAAH-QSEVWSIAITSDGTSVISASHDHSLRVWE 681
           G +  WD    + I+++  H ++ ++SI    +G  +++   D S+RVW+
Sbjct: 701 GTIIVWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWD 750

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/221 (23%), Positives = 101/221 (45%), Gaps = 23/221 (10%)

Query: 383 LPGHRTDIRSVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFDCGYALTC---KFLPGG 438
           L GH   + SV  S D++ L +AS +  +++W+L T  C+  +  G+       KF P G
Sbjct: 549 LVGHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYK-GHNHPVWYVKFSPLG 607

Query: 439 TLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNF 498
              I  + + + +L+       L      H   +       +G  + TGS+DKT + W+ 
Sbjct: 608 HYFITASHDQTARLWSCDHIYPLR-IFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDI 666

Query: 499 QVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDS 558
           Q  + +           + L H +       V ++ +SP+ ++L     D T+ V+ + +
Sbjct: 667 QTGDSVR----------LFLGHTSP------VTALEVSPDGRWLTTGSEDGTIIVWDIGT 710

Query: 559 MKFFLSLYGH-KLPVLSIDISFDSKLIITSSADKNIKIWGL 598
            K    + GH K P+ SI  + +   ++T  AD+++++W +
Sbjct: 711 GKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDI 751

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 56/108 (51%), Gaps = 2/108 (1%)

Query: 85  YHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNII 144
           +H     +  G  D T ++WD+ +   +  F GH S +T ++    G  L +GS D  II
Sbjct: 645 FHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTII 704

Query: 145 VWDLVSEVGLYKLRSH-KDAISGIWCEGE-DWLVSTSKDGLIKIWDLK 190
           VWD+ +   + +++ H K+ I  I    E + LV+   D  +++WD+K
Sbjct: 705 VWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDIK 752

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/250 (21%), Positives = 101/250 (40%), Gaps = 30/250 (12%)

Query: 47  INIWDIKTGELISVLSDGLPAGSIDVKSSK-----PAEVSYLHYHDETNLLAAGYMDGTI 101
           I +W +    L S+L    P+ + D  +S         V  + +  +   L +   D T+
Sbjct: 522 IKVWYLDGSPLQSIL----PSKAKDQSNSATLVGHSGPVYSVAFSPDNRYLLSASEDKTV 577

Query: 102 KVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHK 161
           ++W L + + L+ + GH   +  +KF   G   I+ S D    +W   S   +Y LR   
Sbjct: 578 RLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQTARLW---SCDHIYPLRIFS 634

Query: 162 DAISGIWC----EGEDWLVSTSKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHED--LL 215
             ++ + C        ++ + S D   ++WD++    +   + HT    A+ V  D   L
Sbjct: 635 GHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWL 694

Query: 216 ITSGADTQLKLWNLDFSKEAGSKLIEKGVYDKQSKQRGLDIKFSVAPNGTAFFYIQ-NAD 274
            T   D  + +W++   K             KQ K  G +  +S+  N      +   AD
Sbjct: 695 TTGSEDGTIIVWDIGTGKRI-----------KQMKGHGKNPIYSITFNKEGNCLVTGGAD 743

Query: 275 KTTEVFRIRR 284
           ++  V+ I+R
Sbjct: 744 QSVRVWDIKR 753

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 66/129 (51%), Gaps = 9/129 (6%)

Query: 375 PTRLYTIELPGHRTDIRSVDISDDDKLLAT-ASNGLLKVWNLKTKACIRVFDCGYALTCK 433
           P R+++    GH  D+       +   + T +S+   ++W+++T   +R+F  G+     
Sbjct: 629 PLRIFS----GHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLF-LGHTSPVT 683

Query: 434 FL---PGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSAD 490
            L   P G  +  G+ +G++ ++D+ +   ++  +   +  I+S+    +G  LVTG AD
Sbjct: 684 ALEVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGAD 743

Query: 491 KTIKFWNFQ 499
           ++++ W+ +
Sbjct: 744 QSVRVWDIK 752

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 28/136 (20%), Positives = 54/136 (39%), Gaps = 16/136 (11%)

Query: 111 VLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDL----VSEVGLYKLRSHKDAISG 166
            + TF+     +T ++F        +G +DS I VW L    +  +   K +   ++ + 
Sbjct: 490 CMYTFHNTNGNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATL 549

Query: 167 IWCEG----------EDWLVSTSKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHE--DL 214
           +   G            +L+S S+D  +++W L    C+  +  H    W +        
Sbjct: 550 VGHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHY 609

Query: 215 LITSGADTQLKLWNLD 230
            IT+  D   +LW+ D
Sbjct: 610 FITASHDQTARLWSCD 625

>KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 755

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 95/216 (43%), Gaps = 17/216 (7%)

Query: 467 AHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEV 526
            H   ++S   + D R L++ S DKT++ W+      LV                +    
Sbjct: 480 GHSGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLV----------------SYKGH 523

Query: 527 NEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIIT 586
           N  +  V  SP   + A +  D T +++  D +       GH   V ++    +   + T
Sbjct: 524 NHPIWDVAFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFT 583

Query: 587 SSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECI 646
            S+DK  ++W +  GD  +    H   +      P+     + S+DG++  WD    + +
Sbjct: 584 GSSDKTCRMWDMSTGDSVRLFLGHTAPVTATAVSPDGRWLSTGSEDGIINVWDIGTGKRL 643

Query: 647 QKLAAH-QSEVWSIAITSDGTSVISASHDHSLRVWE 681
           +++  H ++ V+S++ + +G  ++S   DHSLRVW+
Sbjct: 644 KQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWD 679

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 85/188 (45%), Gaps = 18/188 (9%)

Query: 516 MKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFF------------- 562
           M   H+T    N ++ S+  S + +  +    D+ VK++ LD                  
Sbjct: 420 MYTFHNT----NSEMTSLEFSDDVRLASAGFQDSIVKIWSLDGEPLSSKLPSKQDERSNN 475

Query: 563 LSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE 622
            +L GH   V S   S D++ ++++S DK +++W  D      S   H   I +V F P 
Sbjct: 476 ATLVGHSGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSPL 535

Query: 623 SHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWE- 681
            H F ++S D   + W  D    ++  A H ++V +++   +GT V + S D + R+W+ 
Sbjct: 536 GHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDM 595

Query: 682 ETDDQVFL 689
            T D V L
Sbjct: 596 STGDSVRL 603

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/272 (20%), Positives = 113/272 (41%), Gaps = 40/272 (14%)

Query: 388 TDIRSVDISDDDKLLATA-SNGLLKVWNL---------------KTKACIRVFDCGYALT 431
           +++ S++ SDD +L +    + ++K+W+L               ++     V   G   +
Sbjct: 428 SEMTSLEFSDDVRLASAGFQDSIVKIWSLDGEPLSSKLPSKQDERSNNATLVGHSGTVYS 487

Query: 432 CKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADK 491
             F P    ++  + + +++L+   + T L + +  H   IW +  +  G    T S D+
Sbjct: 488 TAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYK-GHNHPIWDVAFSPLGHYFATASHDQ 546

Query: 492 TIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTV 551
           T + W           + D   P+             DV +V   P   ++     D T 
Sbjct: 547 TARLW-----------SCDHIYPLRIFAGHLN-----DVDTVSFHPNGTYVFTGSSDKTC 590

Query: 552 KVFYL---DSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLF 608
           +++ +   DS++ FL   GH  PV +  +S D + + T S D  I +W +  G   K + 
Sbjct: 591 RMWDMSTGDSVRLFL---GHTAPVTATAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMR 647

Query: 609 AH-QDSIMNVKFLPESHNFFSSSKDGLVKYWD 639
            H ++++ ++ +  E H   S   D  ++ WD
Sbjct: 648 GHGKNAVYSLSYSKEGHVLVSGGADHSLRVWD 679

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 71/152 (46%), Gaps = 5/152 (3%)

Query: 92  LAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSE 151
            A    D T ++W       L  F GH + +  + F   GT + +GS D    +WD+ + 
Sbjct: 539 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDMSTG 598

Query: 152 VGLYKLRSHKDAISGIWCEGED-WLVSTSKDGLIKIWDLKVQQCIETHIAH-TGECWAMG 209
             +     H   ++      +  WL + S+DG+I +WD+   + ++    H     +++ 
Sbjct: 599 DSVRLFLGHTAPVTATAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLS 658

Query: 210 VHED--LLITSGADTQLKLWNLDFS-KEAGSK 238
             ++  +L++ GAD  L++W++  S  E GS+
Sbjct: 659 YSKEGHVLVSGGADHSLRVWDVKKSTAEPGSE 690

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 75/159 (47%), Gaps = 9/159 (5%)

Query: 375 PTRLYTIELPGHRTDIRSVDISDDDKLLAT-ASNGLLKVWNLKTKACIRVF--DCGYALT 431
           P R++     GH  D+ +V    +   + T +S+   ++W++ T   +R+F         
Sbjct: 558 PLRIFA----GHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDMSTGDSVRLFLGHTAPVTA 613

Query: 432 CKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADK 491
               P G  +  G+ +G + ++D+ +   L+      + A++SL  + +G  LV+G AD 
Sbjct: 614 TAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLVSGGADH 673

Query: 492 TIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDV 530
           +++ W+ + +    PG+  +  P      D T  VN+D+
Sbjct: 674 SLRVWDVK-KSTAEPGSEPEQ-PFTSFSGDVTTSVNQDI 710

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 56/114 (49%), Gaps = 2/114 (1%)

Query: 79  EVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGS 138
           +V  + +H     +  G  D T ++WD+ +   +  F GH + +T       G  L +GS
Sbjct: 568 DVDTVSFHPNGTYVFTGSSDKTCRMWDMSTGDSVRLFLGHTAPVTATAVSPDGRWLSTGS 627

Query: 139 RDSNIIVWDLVSEVGLYKLRSH-KDAISGIWCEGEDW-LVSTSKDGLIKIWDLK 190
            D  I VWD+ +   L ++R H K+A+  +    E   LVS   D  +++WD+K
Sbjct: 628 EDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWDVK 681

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/168 (19%), Positives = 65/168 (38%), Gaps = 16/168 (9%)

Query: 78  AEVSYLHYHDETNLLAAGYMDGTIKVWDL----LS---------KSVLLTFNGHKSAITV 124
           +E++ L + D+  L +AG+ D  +K+W L    LS         +S   T  GH   +  
Sbjct: 428 SEMTSLEFSDDVRLASAGFQDSIVKIWSLDGEPLSSKLPSKQDERSNNATLVGHSGTVYS 487

Query: 125 MKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGEDWLVSTSKDGL 183
             F      L+S S D  + +W   +   L   + H   I  + +     +  + S D  
Sbjct: 488 TAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSPLGHYFATASHDQT 547

Query: 184 IKIWDLKVQQCIETHIAHTGECWAMGVHED--LLITSGADTQLKLWNL 229
            ++W       +     H  +   +  H +   + T  +D   ++W++
Sbjct: 548 ARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDM 595

 Score = 36.2 bits (82), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 54/136 (39%), Gaps = 18/136 (13%)

Query: 112 LLTFNGHKSAITVMKFDVTGTRLIS-GSRDSNIIVWDLVSEVGLYKLRSHKD-------- 162
           + TF+   S +T ++F     RL S G +DS + +W L  E    KL S +D        
Sbjct: 420 MYTFHNTNSEMTSLEFS-DDVRLASAGFQDSIVKIWSLDGEPLSSKLPSKQDERSNNATL 478

Query: 163 ------AISGIWCEGEDWLVSTSKDGLIKIWDLKVQQCIETHIAHTGECW--AMGVHEDL 214
                   S  +     +L+S S+D  +++W       + ++  H    W  A       
Sbjct: 479 VGHSGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSPLGHY 538

Query: 215 LITSGADTQLKLWNLD 230
             T+  D   +LW+ D
Sbjct: 539 FATASHDQTARLWSCD 554

>KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {ON}
           Anc_2.431 YMR116C
          Length = 319

 Score = 81.3 bits (199), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 106/233 (45%), Gaps = 21/233 (9%)

Query: 460 LLENKEDAHETAIWSLDITSDGRR--LVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMK 517
           +L    + H   + SL  TS G+   LV+ S DKT+  W    ++  V      +     
Sbjct: 8   VLRGTLEGHNGWVTSL-ATSAGQPNLLVSASRDKTLISWKLTGDDQKVGVPVRSFKGHSH 66

Query: 518 LIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDI 577
           ++ D T+           +P+  +   +  D T++++ + + + F    GHK  V+S+ I
Sbjct: 67  IVQDVTL-----------TPDGAYALSASWDKTLRLWEVATGETFQRFVGHKSDVMSVAI 115

Query: 578 SFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP------ESHNFFSSSK 631
              + +II+ S DK+IK+W +  G C  +L  H D +  V+  P      E+    S+  
Sbjct: 116 DRKASMIISGSRDKSIKVWTIK-GQCLATLLGHNDWVSQVRVAPNDKDDDETVTVISAGN 174

Query: 632 DGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWEETD 684
           D +VK W+ ++F+       H   V +I  + DG+ + SA  D  + +W   D
Sbjct: 175 DKMVKAWNLNQFQIEADFVGHNGNVNTITASPDGSLIASAGKDGEIMLWNLAD 227

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 67/141 (47%), Gaps = 10/141 (7%)

Query: 98  DGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKL 157
           D T+++W++ +      F GHKS +  +  D   + +ISGSRD +I VW +  +  L  L
Sbjct: 86  DKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKASMIISGSRDKSIKVWTIKGQC-LATL 144

Query: 158 RSHKDAISGIWCEGED-------WLVSTSKDGLIKIWDLKVQQCIETHIAHTGECWAMGV 210
             H D +S +     D        ++S   D ++K W+L   Q     + H G    +  
Sbjct: 145 LGHNDWVSQVRVAPNDKDDDETVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTITA 204

Query: 211 HED--LLITSGADTQLKLWNL 229
             D  L+ ++G D ++ LWNL
Sbjct: 205 SPDGSLIASAGKDGEIMLWNL 225

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 60/260 (23%), Positives = 111/260 (42%), Gaps = 34/260 (13%)

Query: 436 PGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKF 495
           P G   +  + + +L+L+++A+    + +   H++ + S+ I      +++GS DK+IK 
Sbjct: 75  PDGAYALSASWDKTLRLWEVATGETFQ-RFVGHKSDVMSVAIDRKASMIISGSRDKSIKV 133

Query: 496 WNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDK-----FLAISLL-DN 549
           W  + +                    T +  N+ V  VR++P DK        IS   D 
Sbjct: 134 WTIKGQ-----------------CLATLLGHNDWVSQVRVAPNDKDDDETVTVISAGNDK 176

Query: 550 TVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFA 609
            VK + L+  +      GH   V +I  S D  LI ++  D  I +W L       +L A
Sbjct: 177 MVKAWNLNQFQIEADFVGHNGNVNTITASPDGSLIASAGKDGEIMLWNLADKVPMYTLNA 236

Query: 610 HQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKL--------AAHQSEVWSIAI 661
            QD +  + F P  +   +++  G +K +  D    I  L         A +    S+  
Sbjct: 237 -QDEVFALAFSPNRYWLAAATASG-IKVFSLDPQALIDDLRPEFAGYNKAAEPHAVSLTW 294

Query: 662 TSDGTSVISASHDHSLRVWE 681
           ++DG ++ +   D+ +RVW+
Sbjct: 295 SADGQTLFAGYTDNVIRVWQ 314

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 51/110 (46%), Gaps = 1/110 (0%)

Query: 87  DETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVW 146
           DET  + +   D  +K W+L    +   F GH   +  +     G+ + S  +D  I++W
Sbjct: 164 DETVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTITASPDGSLIASAGKDGEIMLW 223

Query: 147 DLVSEVGLYKLRSHKDAISGIWCEGEDWLVSTSKDGLIKIWDLKVQQCIE 196
           +L  +V +Y L +  +  +  +     WL + +  G IK++ L  Q  I+
Sbjct: 224 NLADKVPMYTLNAQDEVFALAFSPNRYWLAAATASG-IKVFSLDPQALID 272

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 70/163 (42%), Gaps = 16/163 (9%)

Query: 88  ETNLLAAGYMDGTIKVWDLLSKS-----VLLTFNGHKSAITVMKFDVTGTRLISGSRDSN 142
           + NLL +   D T+  W L          + +F GH   +  +     G   +S S D  
Sbjct: 29  QPNLLVSASRDKTLISWKLTGDDQKVGVPVRSFKGHSHIVQDVTLTPDGAYALSASWDKT 88

Query: 143 IIVWDLVSEVGLYKLRSHK-DAISGIWCEGEDWLVSTSKDGLIKIWDLKVQQCIETHIAH 201
           + +W++ +     +   HK D +S         ++S S+D  IK+W +K  QC+ T + H
Sbjct: 89  LRLWEVATGETFQRFVGHKSDVMSVAIDRKASMIISGSRDKSIKVWTIK-GQCLATLLGH 147

Query: 202 TGECWAMGVHED--------LLITSGADTQLKLWNLD-FSKEA 235
                 + V  +         +I++G D  +K WNL+ F  EA
Sbjct: 148 NDWVSQVRVAPNDKDDDETVTVISAGNDKMVKAWNLNQFQIEA 190

 Score = 38.5 bits (88), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 52/121 (42%), Gaps = 10/121 (8%)

Query: 385 GHRTDIRSVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFDC-GYALTCKFLPGGTLVI 442
           GH  ++ ++  S D  L+A+A  +G + +WNL  K  +   +         F P    + 
Sbjct: 194 GHNGNVNTITASPDGSLIASAGKDGEIMLWNLADKVPMYTLNAQDEVFALAFSPNRYWLA 253

Query: 443 VGTREGSLQLFDLASSTLLEN-------KEDAHETAIWSLDITSDGRRLVTGSADKTIKF 495
             T  G +++F L    L+++          A E    SL  ++DG+ L  G  D  I+ 
Sbjct: 254 AATASG-IKVFSLDPQALIDDLRPEFAGYNKAAEPHAVSLTWSADGQTLFAGYTDNVIRV 312

Query: 496 W 496
           W
Sbjct: 313 W 313

 Score = 32.0 bits (71), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 5/68 (7%)

Query: 626 FFSSSKDGLVKYWD--GDKFEC---IQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVW 680
             S+S+D  +  W   GD  +    ++    H   V  + +T DG   +SAS D +LR+W
Sbjct: 33  LVSASRDKTLISWKLTGDDQKVGVPVRSFKGHSHIVQDVTLTPDGAYALSASWDKTLRLW 92

Query: 681 EETDDQVF 688
           E    + F
Sbjct: 93  EVATGETF 100

>Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR198C
           (TAF5) - Probable transcription-associated factor
           protein, probable -transducin type [contig 24] FULL
          Length = 755

 Score = 84.0 bits (206), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 67/296 (22%), Positives = 128/296 (43%), Gaps = 46/296 (15%)

Query: 388 TDIRSVDISDDDKLLATA-SNGLLKVWNLKTKACIRVFDCGYALTCKFLPGGTLVIVGTR 446
           +++ S++ SDD +L A    + ++K+W+L           G  L  K LP          
Sbjct: 428 SEMTSLEFSDDVRLAAAGFQDSIIKIWSLD----------GEPLKNK-LP---------- 466

Query: 447 EGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVP 506
             S Q     + TL+      H   ++S   + D R L++ S DKT++ W          
Sbjct: 467 --SKQGERTNNETLV-----GHSGTVYSTSFSPDNRYLLSASEDKTVRLW---------- 509

Query: 507 GTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLY 566
            + D Y  ++          N  +  V  SP   + A +  D T +++  D +       
Sbjct: 510 -STDTYTSLVNYKGH-----NHPIWDVAFSPLGHYFATASHDQTARLWSCDHIYPLRIFA 563

Query: 567 GHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNF 626
           GH   V ++    +   + T S+DK  ++W +  GD  +    H   + +    P+    
Sbjct: 564 GHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGRWL 623

Query: 627 FSSSKDGLVKYWDGDKFECIQKLAAH-QSEVWSIAITSDGTSVISASHDHSLRVWE 681
            + S+DG++  WD    + ++++  H ++ V+S++ + +G  +IS   DHS+RVW+
Sbjct: 624 STGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWD 679

 Score = 70.9 bits (172), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 85/181 (46%), Gaps = 17/181 (9%)

Query: 516 MKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDS--MKFFL---------- 563
           M   H+T    N ++ S+  S + +  A    D+ +K++ LD   +K  L          
Sbjct: 420 MYTFHNT----NSEMTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNN 475

Query: 564 -SLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE 622
            +L GH   V S   S D++ ++++S DK +++W  D      +   H   I +V F P 
Sbjct: 476 ETLVGHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPL 535

Query: 623 SHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWEE 682
            H F ++S D   + W  D    ++  A H ++V +++   +GT V + S D + R+W+ 
Sbjct: 536 GHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDI 595

Query: 683 T 683
           T
Sbjct: 596 T 596

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 71/152 (46%), Gaps = 5/152 (3%)

Query: 92  LAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSE 151
            A    D T ++W       L  F GH + +  + F   GT + +GS D    +WD+ S 
Sbjct: 539 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSG 598

Query: 152 VGLYKLRSHKDAISGIWCEGED-WLVSTSKDGLIKIWDLKVQQCIETHIAH-TGECWAMG 209
             +     H   ++      +  WL + S+DG+I +WD+   + ++    H     +++ 
Sbjct: 599 DSVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLS 658

Query: 210 VHED--LLITSGADTQLKLWNLDFS-KEAGSK 238
             ++  +LI+ GAD  +++W++  S  E GS+
Sbjct: 659 YSKEGHVLISGGADHSVRVWDVKKSTAEPGSE 690

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 56/114 (49%), Gaps = 2/114 (1%)

Query: 79  EVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGS 138
           +V  + +H     +  G  D T ++WD+ S   +  F GH + +T       G  L +GS
Sbjct: 568 DVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGRWLSTGS 627

Query: 139 RDSNIIVWDLVSEVGLYKLRSH-KDAISGIWCEGEDW-LVSTSKDGLIKIWDLK 190
            D  I VWD+ +   L ++R H K+A+  +    E   L+S   D  +++WD+K
Sbjct: 628 EDGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDVK 681

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/168 (20%), Positives = 64/168 (38%), Gaps = 16/168 (9%)

Query: 78  AEVSYLHYHDETNLLAAGYMDGTIKVWD---------LLSKSVLLTFN----GHKSAITV 124
           +E++ L + D+  L AAG+ D  IK+W          L SK    T N    GH   +  
Sbjct: 428 SEMTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLVGHSGTVYS 487

Query: 125 MKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGEDWLVSTSKDGL 183
             F      L+S S D  + +W   +   L   + H   I  + +     +  + S D  
Sbjct: 488 TSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYFATASHDQT 547

Query: 184 IKIWDLKVQQCIETHIAHTGECWAMGVHED--LLITSGADTQLKLWNL 229
            ++W       +     H  +   +  H +   + T  +D   ++W++
Sbjct: 548 ARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDI 595

 Score = 33.9 bits (76), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 53/135 (39%), Gaps = 16/135 (11%)

Query: 112 LLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKL------RSHKDAIS 165
           + TF+   S +T ++F        +G +DS I +W L  E    KL      R++ + + 
Sbjct: 420 MYTFHNTNSEMTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLV 479

Query: 166 G--------IWCEGEDWLVSTSKDGLIKIWDLKVQQCIETHIAHTGECW--AMGVHEDLL 215
           G         +     +L+S S+D  +++W       +  +  H    W  A        
Sbjct: 480 GHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYF 539

Query: 216 ITSGADTQLKLWNLD 230
            T+  D   +LW+ D
Sbjct: 540 ATASHDQTARLWSCD 554

>TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {ON}
           Anc_8.544 YBR198C
          Length = 1034

 Score = 84.0 bits (206), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 59/257 (22%), Positives = 118/257 (45%), Gaps = 30/257 (11%)

Query: 439 TLVIVGTREGSLQLFDLASSTLLENKED------------AHETAIWSLDITSDGRRLVT 486
           TL   G ++  ++++ L  +++ EN+++             H  A++S++ +   R L++
Sbjct: 718 TLAATGFQDSYIKIWSLEGTSINENEQNYSQINSIFKTLVGHSDAVYSVNFSPCNRFLLS 777

Query: 487 GSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPE-DKFLAIS 545
           GS DKT + W+    + LV      Y    K I D           V  SP  +   A +
Sbjct: 778 GSGDKTARLWSTDTYKGLV-----SYKGHEKPIWD-----------VNFSPTGNNLFATA 821

Query: 546 LLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHK 605
             DNT +V+  D +     L GH   V  +    + + + T S+DK  ++W L  GD  +
Sbjct: 822 SSDNTARVWSCDRVYPVRILAGHLSDVDCVSFHPNGQYVFTGSSDKTSRMWDLSSGDSVR 881

Query: 606 SLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAH-QSEVWSIAITSD 664
               H  ++      P+     ++++DG +  WD    + ++ +  H ++ ++S++    
Sbjct: 882 LFIGHSSAVTATAVSPDGRWLSTANEDGTITVWDIGSGKKLKSMRGHGKNSIYSLSYNKT 941

Query: 665 GTSVISASHDHSLRVWE 681
           G  ++S+  D+S+RVW+
Sbjct: 942 GNILVSSGADNSVRVWD 958

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 58/218 (26%), Positives = 101/218 (46%), Gaps = 12/218 (5%)

Query: 469 ETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTA----DKYLPVMKLIHDTTM 524
           E  + SLD +SD     TG  D  IK W+ +       GT+    ++    +  I  T +
Sbjct: 705 EKNMSSLDFSSDYTLAATGFQDSYIKIWSLE-------GTSINENEQNYSQINSIFKTLV 757

Query: 525 EVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDIS-FDSKL 583
             ++ V SV  SP ++FL     D T +++  D+ K  +S  GH+ P+  ++ S   + L
Sbjct: 758 GHSDAVYSVNFSPCNRFLLSGSGDKTARLWSTDTYKGLVSYKGHEKPIWDVNFSPTGNNL 817

Query: 584 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKF 643
             T+S+D   ++W  D     + L  H   +  V F P     F+ S D   + WD    
Sbjct: 818 FATASSDNTARVWSCDRVYPVRILAGHLSDVDCVSFHPNGQYVFTGSSDKTSRMWDLSSG 877

Query: 644 ECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWE 681
           + ++    H S V + A++ DG  + +A+ D ++ VW+
Sbjct: 878 DSVRLFIGHSSAVTATAVSPDGRWLSTANEDGTITVWD 915

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 69/144 (47%), Gaps = 4/144 (2%)

Query: 90  NLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLV 149
           NL A    D T +VW       +    GH S +  + F   G  + +GS D    +WDL 
Sbjct: 816 NLFATASSDNTARVWSCDRVYPVRILAGHLSDVDCVSFHPNGQYVFTGSSDKTSRMWDLS 875

Query: 150 SEVGLYKLRSHKDAISGIWCEGED-WLVSTSKDGLIKIWDLKVQQCIETHIAH-TGECWA 207
           S   +     H  A++      +  WL + ++DG I +WD+   + +++   H     ++
Sbjct: 876 SGDSVRLFIGHSSAVTATAVSPDGRWLSTANEDGTITVWDIGSGKKLKSMRGHGKNSIYS 935

Query: 208 MGVHE--DLLITSGADTQLKLWNL 229
           +  ++  ++L++SGAD  +++W++
Sbjct: 936 LSYNKTGNILVSSGADNSVRVWDI 959

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 59/115 (51%), Gaps = 2/115 (1%)

Query: 78  AEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISG 137
           ++V  + +H     +  G  D T ++WDL S   +  F GH SA+T       G  L + 
Sbjct: 846 SDVDCVSFHPNGQYVFTGSSDKTSRMWDLSSGDSVRLFIGHSSAVTATAVSPDGRWLSTA 905

Query: 138 SRDSNIIVWDLVSEVGLYKLRSH-KDAISGI-WCEGEDWLVSTSKDGLIKIWDLK 190
           + D  I VWD+ S   L  +R H K++I  + + +  + LVS+  D  +++WD+K
Sbjct: 906 NEDGTITVWDIGSGKKLKSMRGHGKNSIYSLSYNKTGNILVSSGADNSVRVWDIK 960

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 39/182 (21%), Positives = 69/182 (37%), Gaps = 17/182 (9%)

Query: 65  LPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLS-------------KSV 111
           LP+ S+   ++    +S L +  +  L A G+ D  IK+W L                S+
Sbjct: 693 LPSVSMYTYTNTEKNMSSLDFSSDYTLAATGFQDSYIKIWSLEGTSINENEQNYSQINSI 752

Query: 112 LLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAI--SGIWC 169
             T  GH  A+  + F      L+SGS D    +W   +  GL   + H+  I       
Sbjct: 753 FKTLVGHSDAVYSVNFSPCNRFLLSGSGDKTARLWSTDTYKGLVSYKGHEKPIWDVNFSP 812

Query: 170 EGEDWLVSTSKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHED--LLITSGADTQLKLW 227
            G +   + S D   ++W       +     H  +   +  H +   + T  +D   ++W
Sbjct: 813 TGNNLFATASSDNTARVWSCDRVYPVRILAGHLSDVDCVSFHPNGQYVFTGSSDKTSRMW 872

Query: 228 NL 229
           +L
Sbjct: 873 DL 874

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 57/128 (44%), Gaps = 25/128 (19%)

Query: 385 GHRTDIRSVDISD-DDKLLATAS-NGLLKVWNLKTKACIRVF------------DCGYAL 430
           GH   I  V+ S   + L ATAS +   +VW     +C RV+            DC    
Sbjct: 800 GHEKPIWDVNFSPTGNNLFATASSDNTARVW-----SCDRVYPVRILAGHLSDVDC---- 850

Query: 431 TCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSAD 490
              F P G  V  G+ + + +++DL+S   +      H +A+ +  ++ DGR L T + D
Sbjct: 851 -VSFHPNGQYVFTGSSDKTSRMWDLSSGDSVR-LFIGHSSAVTATAVSPDGRWLSTANED 908

Query: 491 KTIKFWNF 498
            TI  W+ 
Sbjct: 909 GTITVWDI 916

>KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 aa]
           {ON} highly similar to uniprot|P38011 Saccharomyces
           cerevisiae YMR116C ASC1 WD repeat protein (G-beta like
           protein) involved in translation regulation required for
           repression of Gcn4p activity in the absence of
           amino-acid starvation core component of the ribosome
           ortholog of mammalian RACK1
          Length = 319

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 95/211 (45%), Gaps = 18/211 (8%)

Query: 484 LVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLA 543
           L++GS DK++  W    ++         +     ++ D T           ++P+ ++  
Sbjct: 33  LLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCT-----------VTPDGEYAL 81

Query: 544 ISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDC 603
            +  D TV+++ L S K      GHK  VLS+ I   +  I+++S DK +K+W    G+C
Sbjct: 82  SASWDKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWNT-LGEC 140

Query: 604 HKSLFAHQDSIMNVKFLP------ESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVW 657
             +L  H D +  V+  P      E+    S+  D +VK W+   F+       H + V 
Sbjct: 141 MVTLLGHNDWVSQVRVAPNETPEDETVTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVN 200

Query: 658 SIAITSDGTSVISASHDHSLRVWEETDDQVF 688
           ++  + DGT V SA  D  + +W  T+ +  
Sbjct: 201 TVTASPDGTLVASAGKDGQIMLWNLTEKEAL 231

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 65/263 (24%), Positives = 121/263 (46%), Gaps = 32/263 (12%)

Query: 432 CKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADK 491
           C   P G   +  + + +++L++LAS   ++ +   H++ + S+ I     ++V+ S DK
Sbjct: 71  CTVTPDGEYALSASWDKTVRLWELASGKCIQ-RFVGHKSDVLSVTIDRRASQIVSASRDK 129

Query: 492 TIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISP----EDKFLAI--S 545
           T+K WN  + E +V                T +  N+ V  VR++P    ED+ + +  +
Sbjct: 130 TVKVWN-TLGECMV----------------TLLGHNDWVSQVRVAPNETPEDETVTVISA 172

Query: 546 LLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHK 605
            +D  VKV+ L S +      GH   V ++  S D  L+ ++  D  I +W L   +   
Sbjct: 173 GMDKVVKVWNLHSFQIEADFIGHNNYVNTVTASPDGTLVASAGKDGQIMLWNLTEKEALY 232

Query: 606 SLFAHQDSIMNVKFLPESHNFFSSSKDGL-------VKYWDGDKFECIQKLAAHQSEVWS 658
           +L A QD +  V F P  +   +++  G+        K  D  K E      A +    S
Sbjct: 233 TLNA-QDEVFAVAFSPNRYWLTAATSSGIKIFNLEERKVVDELKPEFAGYTKAAEPHAIS 291

Query: 659 IAITSDGTSVISASHDHSLRVWE 681
           +A ++DG ++ +   D+ +RVW+
Sbjct: 292 LAWSADGQTLFAGYTDNVIRVWQ 314

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 68/141 (48%), Gaps = 10/141 (7%)

Query: 98  DGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKL 157
           D T+++W+L S   +  F GHKS +  +  D   ++++S SRD  + VW+ + E  +  L
Sbjct: 86  DKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWNTLGEC-MVTL 144

Query: 158 RSHKDAISGIWCEGED-------WLVSTSKDGLIKIWDLKVQQCIETHIAHTGECWAMGV 210
             H D +S +     +        ++S   D ++K+W+L   Q     I H      +  
Sbjct: 145 LGHNDWVSQVRVAPNETPEDETVTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVNTVTA 204

Query: 211 HED--LLITSGADTQLKLWNL 229
             D  L+ ++G D Q+ LWNL
Sbjct: 205 SPDGTLVASAGKDGQIMLWNL 225

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 61/123 (49%), Gaps = 6/123 (4%)

Query: 564 SLYGHKLPVLSIDIS-FDSKLIITSSADKNIKIWGL-----DFGDCHKSLFAHQDSIMNV 617
           +L GH   V S+  S     L+++ S DK++  W L      +G   +S   H   + + 
Sbjct: 12  TLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDC 71

Query: 618 KFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSL 677
              P+     S+S D  V+ W+    +CIQ+   H+S+V S+ I    + ++SAS D ++
Sbjct: 72  TVTPDGEYALSASWDKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTV 131

Query: 678 RVW 680
           +VW
Sbjct: 132 KVW 134

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 57/110 (51%), Gaps = 1/110 (0%)

Query: 87  DETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVW 146
           DET  + +  MD  +KVW+L S  +   F GH + +  +     GT + S  +D  I++W
Sbjct: 164 DETVTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVNTVTASPDGTLVASAGKDGQIMLW 223

Query: 147 DLVSEVGLYKLRSHKDAISGIWCEGEDWLVSTSKDGLIKIWDLKVQQCIE 196
           +L  +  LY L +  +  +  +     WL + +  G IKI++L+ ++ ++
Sbjct: 224 NLTEKEALYTLNAQDEVFAVAFSPNRYWLTAATSSG-IKIFNLEERKVVD 272

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/204 (23%), Positives = 85/204 (41%), Gaps = 24/204 (11%)

Query: 467 AHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEV 526
            H   +    +T DG   ++ S DKT++ W      +L  G   +     K         
Sbjct: 63  GHSHIVQDCTVTPDGEYALSASWDKTVRLW------ELASGKCIQRFVGHK--------- 107

Query: 527 NEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFD------ 580
             DVLSV I      +  +  D TVKV+     +  ++L GH   V  + ++ +      
Sbjct: 108 -SDVLSVTIDRRASQIVSASRDKTVKVWNTLG-ECMVTLLGHNDWVSQVRVAPNETPEDE 165

Query: 581 SKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDG 640
           +  +I++  DK +K+W L           H + +  V   P+     S+ KDG +  W+ 
Sbjct: 166 TVTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVNTVTASPDGTLVASAGKDGQIMLWNL 225

Query: 641 DKFECIQKLAAHQSEVWSIAITSD 664
            + E +  L A Q EV+++A + +
Sbjct: 226 TEKEALYTLNA-QDEVFAVAFSPN 248

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 59/125 (47%), Gaps = 11/125 (8%)

Query: 114 TFNGHKSAITVMKFDVTGTRLI-SGSRDSNIIVWDLVSE-----VGLYKLRSHKDAIS-- 165
           T  GH   +T +        L+ SGSRD ++I W L  +     V +   R H   +   
Sbjct: 12  TLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDC 71

Query: 166 GIWCEGEDWLVSTSKDGLIKIWDLKVQQCIETHIAHTGECWAMGV--HEDLLITSGADTQ 223
            +  +GE + +S S D  +++W+L   +CI+  + H  +  ++ +      ++++  D  
Sbjct: 72  TVTPDGE-YALSASWDKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKT 130

Query: 224 LKLWN 228
           +K+WN
Sbjct: 131 VKVWN 135

>ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]
           {ON} some similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084C
          Length = 718

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 69/286 (24%), Positives = 126/286 (44%), Gaps = 51/286 (17%)

Query: 428 YALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTG 487
           Y  +  F P G  +  G  +  ++++D+A   ++   +  HE  I+SLD    G +LV+G
Sbjct: 438 YIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQ-GHEQDIYSLDYFPSGDKLVSG 496

Query: 488 SADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPED-KFLAISL 546
           S D+T++ W+ +  +  +                 T+ + + V +V +S  D K++A   
Sbjct: 497 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSLGDGKYIAAGS 539

Query: 547 LDNTVKVFYLDSMKFFLSLY---------GHKLPVLSIDISFDSKLIITSSADKNIKIWG 597
           LD  V+V+  D+   FL            GHK  V S+  + D   +++ S D+++K+W 
Sbjct: 540 LDRAVRVW--DAETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWN 597

Query: 598 LDFGD-------------CHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFE 644
           L  G              C  +   H+D +++V          S SKD  V +WD     
Sbjct: 598 LSSGQNNTNAETKPAPGTCEVTYTGHKDFVLSVATTRNDEYILSGSKDRGVLFWDTKSGN 657

Query: 645 CIQKLAAHQSEVWSIAITSDGTSV-------ISASHDHSLRVWEET 683
            +  L  H++ V S+A+ ++G  +        + S D   R+W+ T
Sbjct: 658 PLLMLQGHRNSVISVAV-ANGYPLGPQYCVFATGSGDCKARIWKYT 702

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 81/165 (49%), Gaps = 9/165 (5%)

Query: 530 VLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSA 589
           + SV  SP+ KFLA    D  ++++ +   K  + L GH+  + S+D       +++ S 
Sbjct: 439 IRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSG 498

Query: 590 DKNIKIWGLDFGDCHKSLFAHQDSIMNVKF-LPESHNFFSSSKDGLVKYWDGDKFECIQK 648
           D+ ++IW L  G C  +L + +D +  V   L +     + S D  V+ WD +    +++
Sbjct: 499 DRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSLGDGKYIAAGSLDRAVRVWDAETGFLVER 557

Query: 649 L-------AAHQSEVWSIAITSDGTSVISASHDHSLRVWEETDDQ 686
           L         H+  V+S+  T DG  V+S S D S+++W  +  Q
Sbjct: 558 LDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLSSGQ 602

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 104/237 (43%), Gaps = 34/237 (14%)

Query: 383 LPGHRTDIRSVD-ISDDDKLLATASNGLLKVWNLKTKACIRVFDC--GYALTCKFLPGGT 439
           L GH  DI S+D     DKL++ + +  +++W+L+T  C        G       L  G 
Sbjct: 474 LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSLGDGK 533

Query: 440 LVIVGTREGSLQLFDLASSTLLENKED------AHETAIWSLDITSDGRRLVTGSADKTI 493
            +  G+ + +++++D  +  L+E  +        H+ +++S+  T DG  +V+GS D+++
Sbjct: 534 YIAAGSLDRAVRVWDAETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSV 593

Query: 494 KFWNF-------QVEEDLVPGTADKYLPVMKLIHDTTMEVNED-VLSVRISPEDKFLAIS 545
           K WN          E    PGT            + T   ++D VLSV  +  D+++   
Sbjct: 594 KLWNLSSGQNNTNAETKPAPGTC-----------EVTYTGHKDFVLSVATTRNDEYILSG 642

Query: 546 LLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKL------IITSSADKNIKIW 596
             D  V  +   S    L L GH+  V+S+ ++    L        T S D   +IW
Sbjct: 643 SKDRGVLFWDTKSGNPLLMLQGHRNSVISVAVANGYPLGPQYCVFATGSGDCKARIW 699

 Score = 58.2 bits (139), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 71/151 (47%), Gaps = 14/151 (9%)

Query: 91  LLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVS 150
            LA G  D  I++WD+  K +++   GH+  I  + +  +G +L+SGS D  + +WDL  
Sbjct: 450 FLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDL-- 507

Query: 151 EVGLYKLR-SHKDAISGIWCEGED--WLVSTSKDGLIKIWDLKVQQCIET-------HIA 200
             G   L  S +D ++ +     D  ++ + S D  +++WD +    +E           
Sbjct: 508 RTGQCSLTLSIEDGVTTVAVSLGDGKYIAAGSLDRAVRVWDAETGFLVERLDSENELGTG 567

Query: 201 HTGECWAMGVHED--LLITSGADTQLKLWNL 229
           H    +++    D   +++   D  +KLWNL
Sbjct: 568 HKDSVYSVVFTRDGHGVVSGSLDRSVKLWNL 598

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 55/113 (48%), Gaps = 2/113 (1%)

Query: 570 LPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSS 629
           L + S+  S D K + T + D+ I+IW +        L  H+  I ++ + P      S 
Sbjct: 437 LYIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSG 496

Query: 630 SKDGLVKYWDGDKFECIQKLAAHQSEVWSIAIT-SDGTSVISASHDHSLRVWE 681
           S D  V+ WD    +C   L+  +  V ++A++  DG  + + S D ++RVW+
Sbjct: 497 SGDRTVRIWDLRTGQCSLTLSI-EDGVTTVAVSLGDGKYIAAGSLDRAVRVWD 548

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 91/222 (40%), Gaps = 49/222 (22%)

Query: 39  VITSALENINIWDIKTGELISVLS--DGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGY 96
           V  S    + IWD++TG+    LS  DG+   ++ +   K               +AAG 
Sbjct: 494 VSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSLGDGK--------------YIAAGS 539

Query: 97  MDGTIKVWD---------LLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWD 147
           +D  ++VWD         L S++ L T  GHK ++  + F   G  ++SGS D ++ +W+
Sbjct: 540 LDRAVRVWDAETGFLVERLDSENELGT--GHKDSVYSVVFTRDGHGVVSGSLDRSVKLWN 597

Query: 148 LVS-----------EVGLYKLR--SHKD-AISGIWCEGEDWLVSTSKDGLIKIWDLKVQQ 193
           L S             G  ++    HKD  +S      +++++S SKD  +  WD K   
Sbjct: 598 LSSGQNNTNAETKPAPGTCEVTYTGHKDFVLSVATTRNDEYILSGSKDRGVLFWDTKSGN 657

Query: 194 CIETHIAH--------TGECWAMGVHEDLLITSGADTQLKLW 227
            +     H            + +G    +  T   D + ++W
Sbjct: 658 PLLMLQGHRNSVISVAVANGYPLGPQYCVFATGSGDCKARIW 699

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 83/201 (41%), Gaps = 24/201 (11%)

Query: 47  INIWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDL 106
           I IWDI   +++ VL                 ++  L Y    + L +G  D T+++WDL
Sbjct: 460 IRIWDIAQKKIVMVLQ------------GHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDL 507

Query: 107 LSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRS------- 159
            +    LT +      TV      G  + +GS D  + VWD  +   + +L S       
Sbjct: 508 RTGQCSLTLSIEDGVTTVAVSLGDGKYIAAGSLDRAVRVWDAETGFLVERLDSENELGTG 567

Query: 160 HKDAI-SGIWCEGEDWLVSTSKDGLIKIWDLKVQQ---CIETHIAHTGECWAMGVHEDLL 215
           HKD++ S ++      +VS S D  +K+W+L   Q     ET  A  G C          
Sbjct: 568 HKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLSSGQNNTNAETKPA-PGTCEVTYTGHKDF 626

Query: 216 ITSGADTQLKLWNLDFSKEAG 236
           + S A T+   + L  SK+ G
Sbjct: 627 VLSVATTRNDEYILSGSKDRG 647

>KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON}
           similar to uniprot|P20053 Saccharomyces cerevisiae
           YPR178W PRP4 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 471

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 109/245 (44%), Gaps = 16/245 (6%)

Query: 436 PGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKF 495
           P    V  G+  G +++ D  +  +L + +  H+  I  LD +SD   LVTG AD+ +K 
Sbjct: 192 PNQKSVACGSWHGDVKIIDSETLEILASFDAIHDDKIGGLDWSSDSTLLVTGGADRIVKV 251

Query: 496 WNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFY 555
           W         P + +    V+K  H+        V+ V+  P D+++A +  D T +++ 
Sbjct: 252 WK--------PSSPNDSTAVLKG-HEGR------VVKVKFHPSDRYVASASFDMTWRLWD 296

Query: 556 LDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 615
           ++         GH   V  +D   D  L+ ++  D   +IW +  G     L  H   I 
Sbjct: 297 VERQVELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSIGRIWDMRSGQSLMILEGHAKPIY 356

Query: 616 NVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITS-DGTSVISASHD 674
            V + P  H+  + S DG VK WD  K      + AH + V  +      G +++S+S+D
Sbjct: 357 GVSWSPNGHHVATGSADGTVKVWDIRKVGNPFSILAHNNIVSDVKFDKVSGRTLVSSSYD 416

Query: 675 HSLRV 679
            ++ V
Sbjct: 417 KTVSV 421

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 115/240 (47%), Gaps = 28/240 (11%)

Query: 370 PTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLL-KVWNLKTKACIRVFDCGY 428
           P+SP  +   T  L GH   +  V     D+ +A+AS  +  ++W+++ +  +++ + G+
Sbjct: 254 PSSPNDS---TAVLKGHEGRVVKVKFHPSDRYVASASFDMTWRLWDVERQVELQLQE-GH 309

Query: 429 A--LTC-KFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLV 485
           A  + C  F   G+L+     +   +++D+ S   L   E  H   I+ +  + +G  + 
Sbjct: 310 AKEVYCLDFQCDGSLLCSAGLDSIGRIWDMRSGQSLMILE-GHAKPIYGVSWSPNGHHVA 368

Query: 486 TGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTM-EVNEDVLSVRISPEDKFLAI 544
           TGSAD T+K W+ +   +          P   L H+  + +V  D +S R       L  
Sbjct: 369 TGSADGTVKVWDIRKVGN----------PFSILAHNNIVSDVKFDKVSGRT------LVS 412

Query: 545 SLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCH 604
           S  D TV VF  DS     SL GH   V+SIDIS D   + +S  D+++K+W L  G C+
Sbjct: 413 SSYDKTVSVFASDSWLRLASLKGHTDKVMSIDISHDFSHLYSSGWDRSVKLWKL--GVCN 470

 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 73/162 (45%), Gaps = 2/162 (1%)

Query: 530 VLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYG-HKLPVLSIDISFDSKLIITSS 588
           V  V +SP  K +A       VK+   ++++   S    H   +  +D S DS L++T  
Sbjct: 185 VSGVLLSPNQKSVACGSWHGDVKIIDSETLEILASFDAIHDDKIGGLDWSSDSTLLVTGG 244

Query: 589 ADKNIKIWGLDF-GDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQ 647
           AD+ +K+W      D    L  H+  ++ VKF P      S+S D   + WD ++   +Q
Sbjct: 245 ADRIVKVWKPSSPNDSTAVLKGHEGRVVKVKFHPSDRYVASASFDMTWRLWDVERQVELQ 304

Query: 648 KLAAHQSEVWSIAITSDGTSVISASHDHSLRVWEETDDQVFL 689
               H  EV+ +    DG+ + SA  D   R+W+    Q  +
Sbjct: 305 LQEGHAKEVYCLDFQCDGSLLCSAGLDSIGRIWDMRSGQSLM 346

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 63/263 (23%), Positives = 110/263 (41%), Gaps = 32/263 (12%)

Query: 386 HRTDIRSVDISDDDKLLATA-SNGLLKVWNLKTK----ACIRVFDCGYALTCKFLPGGTL 440
           H   I  +D S D  LL T  ++ ++KVW   +     A ++  + G  +  KF P    
Sbjct: 224 HDDKIGGLDWSSDSTLLVTGGADRIVKVWKPSSPNDSTAVLKGHE-GRVVKVKFHPSDRY 282

Query: 441 VIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQV 500
           V   + + + +L+D+     L+ +E  H   ++ LD   DG  L +   D   + W+ + 
Sbjct: 283 VASASFDMTWRLWDVERQVELQLQE-GHAKEVYCLDFQCDGSLLCSAGLDSIGRIWDMRS 341

Query: 501 EEDL--VPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDS 558
            + L  + G A                  + +  V  SP    +A    D TVKV+ +  
Sbjct: 342 GQSLMILEGHA------------------KPIYGVSWSPNGHHVATGSADGTVKVWDIRK 383

Query: 559 MKFFLSLYGHKLPVLSIDISFD---SKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 615
           +    S+  H   V   D+ FD    + +++SS DK + ++  D      SL  H D +M
Sbjct: 384 VGNPFSILAHNNIV--SDVKFDKVSGRTLVSSSYDKTVSVFASDSWLRLASLKGHTDKVM 441

Query: 616 NVKFLPESHNFFSSSKDGLVKYW 638
           ++    +  + +SS  D  VK W
Sbjct: 442 SIDISHDFSHLYSSGWDRSVKLW 464

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 57/136 (41%), Gaps = 1/136 (0%)

Query: 56  ELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTF 115
            ++ V     P  S  V       V  + +H     +A+   D T ++WD+  +  L   
Sbjct: 247 RIVKVWKPSSPNDSTAVLKGHEGRVVKVKFHPSDRYVASASFDMTWRLWDVERQVELQLQ 306

Query: 116 NGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGEDW 174
            GH   +  + F   G+ L S   DS   +WD+ S   L  L  H   I G+ W      
Sbjct: 307 EGHAKEVYCLDFQCDGSLLCSAGLDSIGRIWDMRSGQSLMILEGHAKPIYGVSWSPNGHH 366

Query: 175 LVSTSKDGLIKIWDLK 190
           + + S DG +K+WD++
Sbjct: 367 VATGSADGTVKVWDIR 382

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 72/155 (46%), Gaps = 4/155 (2%)

Query: 79  EVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGS 138
           EV  L +  + +LL +  +D   ++WD+ S   L+   GH   I  + +   G  + +GS
Sbjct: 312 EVYCLDFQCDGSLLCSAGLDSIGRIWDMRSGQSLMILEGHAKPIYGVSWSPNGHHVATGS 371

Query: 139 RDSNIIVWDLVSEVGLYKLRSHKDAISGIWCE--GEDWLVSTSKDGLIKIWDLKVQQCIE 196
            D  + VWD+      + + +H + +S +  +      LVS+S D  + ++       + 
Sbjct: 372 ADGTVKVWDIRKVGNPFSILAHNNIVSDVKFDKVSGRTLVSSSYDKTVSVFASDSWLRLA 431

Query: 197 THIAHTGECWAMGVHEDL--LITSGADTQLKLWNL 229
           +   HT +  ++ +  D   L +SG D  +KLW L
Sbjct: 432 SLKGHTDKVMSIDISHDFSHLYSSGWDRSVKLWKL 466

>TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {ON}
           Anc_6.363 YCR084C
          Length = 663

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 66/298 (22%), Positives = 124/298 (41%), Gaps = 63/298 (21%)

Query: 428 YALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTG 487
           Y  +  F P G  +  G  +  ++++D+    ++    + HE  I+SLD    G ++V+G
Sbjct: 368 YIRSVCFSPDGKFLATGAEDRLIRIWDITLKKIVM-ILNGHEQDIYSLDYFPSGDKIVSG 426

Query: 488 SADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLL 547
           S D+T++ W+    + L+                 T+ + + V +V +SP+ KF+A   L
Sbjct: 427 SGDRTVRIWDLNTGQCLL-----------------TLSIEDGVTTVAVSPDGKFIAAGSL 469

Query: 548 DNTVKV------FYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLD-- 599
           D  V+V      F ++ +       GH+  V S+  + D K +++ S DK +K+W L   
Sbjct: 470 DRAVRVWDAETGFLVERLDSNELGTGHEDSVYSVVFTKDGKNVVSGSLDKTVKLWNLKQQ 529

Query: 600 -----------------------------FGDCHKSLFAHQDSIMNVKFLPESHNFFSSS 630
                                           C  +   H+D +++V    +     S S
Sbjct: 530 TTSSNDASKINQNSNSHLDSKINKSNNNNSSTCEVTYMGHKDFVLSVATTNDDQMILSGS 589

Query: 631 KDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSV-------ISASHDHSLRVWE 681
           KD  V +WD      +  L  H++ V S+A+ ++G  +        + S D   R+W+
Sbjct: 590 KDRSVLFWDTKSGNPLLMLQGHRNSVISVAV-ANGIPLGPNYGIFATGSGDCKARIWK 646

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/269 (23%), Positives = 126/269 (46%), Gaps = 40/269 (14%)

Query: 383 LPGHRTDIRSVD-ISDDDKLLATASNGLLKVWNLKTKACIRVFDCGYALTCKFL-PGGTL 440
           L GH  DI S+D     DK+++ + +  +++W+L T  C+        +T   + P G  
Sbjct: 404 LNGHEQDIYSLDYFPSGDKIVSGSGDRTVRIWDLNTGQCLLTLSIEDGVTTVAVSPDGKF 463

Query: 441 VIVGTREGSLQLFDLASSTLLENKED-----AHETAIWSLDITSDGRRLVTGSADKTIKF 495
           +  G+ + +++++D  +  L+E  +       HE +++S+  T DG+ +V+GS DKT+K 
Sbjct: 464 IAAGSLDRAVRVWDAETGFLVERLDSNELGTGHEDSVYSVVFTKDGKNVVSGSLDKTVKL 523

Query: 496 WNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFY 555
           WN + +      + D      K+  ++   ++  +            + +   +T +V Y
Sbjct: 524 WNLKQQ---TTSSND----ASKINQNSNSHLDSKINK----------SNNNNSSTCEVTY 566

Query: 556 LDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 615
           +          GHK  VLS+  + D ++I++ S D+++  W    G+    L  H++S++
Sbjct: 567 M----------GHKDFVLSVATTNDDQMILSGSKDRSVLFWDTKSGNPLLMLQGHRNSVI 616

Query: 616 NVKF---LPESHN---FFSSSKDGLVKYW 638
           +V     +P   N   F + S D   + W
Sbjct: 617 SVAVANGIPLGPNYGIFATGSGDCKARIW 645

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 74/148 (50%), Gaps = 10/148 (6%)

Query: 91  LLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVS 150
            LA G  D  I++WD+  K +++  NGH+  I  + +  +G +++SGS D  + +WDL +
Sbjct: 380 FLATGAEDRLIRIWDITLKKIVMILNGHEQDIYSLDYFPSGDKIVSGSGDRTVRIWDLNT 439

Query: 151 EVGLYKLRSHKDAISGIWCEGE-DWLVSTSKDGLIKIWDLKVQQCIET------HIAHTG 203
              L  L S +D ++ +    +  ++ + S D  +++WD +    +E          H  
Sbjct: 440 GQCLLTL-SIEDGVTTVAVSPDGKFIAAGSLDRAVRVWDAETGFLVERLDSNELGTGHED 498

Query: 204 ECWAMGVHED--LLITSGADTQLKLWNL 229
             +++   +D   +++   D  +KLWNL
Sbjct: 499 SVYSVVFTKDGKNVVSGSLDKTVKLWNL 526

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 1/112 (0%)

Query: 570 LPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSS 629
           L + S+  S D K + T + D+ I+IW +        L  H+  I ++ + P      S 
Sbjct: 367 LYIRSVCFSPDGKFLATGAEDRLIRIWDITLKKIVMILNGHEQDIYSLDYFPSGDKIVSG 426

Query: 630 SKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWE 681
           S D  V+ WD +  +C+  L+  +  V ++A++ DG  + + S D ++RVW+
Sbjct: 427 SGDRTVRIWDLNTGQCLLTLSI-EDGVTTVAVSPDGKFIAAGSLDRAVRVWD 477

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 39/76 (51%)

Query: 614 IMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASH 673
           I +V F P+     + ++D L++ WD    + +  L  H+ +++S+     G  ++S S 
Sbjct: 369 IRSVCFSPDGKFLATGAEDRLIRIWDITLKKIVMILNGHEQDIYSLDYFPSGDKIVSGSG 428

Query: 674 DHSLRVWEETDDQVFL 689
           D ++R+W+    Q  L
Sbjct: 429 DRTVRIWDLNTGQCLL 444

 Score = 40.8 bits (94), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 51/110 (46%), Gaps = 23/110 (20%)

Query: 47  INIWDIKTGELISVLS--DGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVW 104
           + IWD+ TG+ +  LS  DG               V+ +    +   +AAG +D  ++VW
Sbjct: 432 VRIWDLNTGQCLLTLSIEDG---------------VTTVAVSPDGKFIAAGSLDRAVRVW 476

Query: 105 DLLSKSVLLTFN------GHKSAITVMKFDVTGTRLISGSRDSNIIVWDL 148
           D  +  ++   +      GH+ ++  + F   G  ++SGS D  + +W+L
Sbjct: 477 DAETGFLVERLDSNELGTGHEDSVYSVVFTKDGKNVVSGSLDKTVKLWNL 526

 Score = 36.6 bits (83), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 39/184 (21%), Positives = 76/184 (41%), Gaps = 46/184 (25%)

Query: 47  INIWDIKTGELISVL-SDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWD 105
           + +WD +TG L+  L S+ L  G  D      +  S +   D  N+++ G +D T+K+W+
Sbjct: 473 VRVWDAETGFLVERLDSNELGTGHED------SVYSVVFTKDGKNVVS-GSLDKTVKLWN 525

Query: 106 LLSKSVL-------------------------------LTFNGHKSAITVMKFDVTGTRL 134
           L  ++                                 +T+ GHK  +  +        +
Sbjct: 526 LKQQTTSSNDASKINQNSNSHLDSKINKSNNNNSSTCEVTYMGHKDFVLSVATTNDDQMI 585

Query: 135 ISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCE-----GEDW--LVSTSKDGLIKIW 187
           +SGS+D +++ WD  S   L  L+ H++++  +        G ++    + S D   +IW
Sbjct: 586 LSGSKDRSVLFWDTKSGNPLLMLQGHRNSVISVAVANGIPLGPNYGIFATGSGDCKARIW 645

Query: 188 DLKV 191
             K+
Sbjct: 646 KYKL 649

>AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL137W
           (SEC27); 1-intron
          Length = 832

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 77/307 (25%), Positives = 138/307 (44%), Gaps = 35/307 (11%)

Query: 387 RTD-IRSVDISDDDK-LLATASNGLLKVWNLKTKACIRVFDCGYA--LTCKFLPGGTLVI 442
           RTD ++ +D    +  +L T  +G  ++WN +T+  +R      A     KF+P  + +I
Sbjct: 12  RTDRVKGIDFHPSEPWVLITLYSGRAEIWNYETQTEVRSISVCEAPVRAGKFIPRKSWII 71

Query: 443 VGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEE 502
           VG+ +  +++F+  +   + + E AH   I +L +      +++ S D T+K WN++   
Sbjct: 72  VGSDDFKIRVFNYNTGEKVVDFE-AHPDYIRALAVHPTRSYVLSASDDLTVKLWNWEKNW 130

Query: 503 DLVPGTADKYLPVMKLIHDTTMEVNED-VLSVRISPED-KFLAISLLDNTVKVFYLDSMK 560
            L                + T E +E  V+SV  +P+D    A + LD+TVK++ L    
Sbjct: 131 AL----------------EQTFEGHEHFVMSVTFNPKDPNTFATACLDHTVKIWSLGQET 174

Query: 561 FFLSLYGHKLPVLSIDISF-------DSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDS 613
              +L  H    L   ++F       D   +ITSS D+ +K+W      C  +L  H  +
Sbjct: 175 SNFTLRAH----LEKGVNFVDYYPFQDKPYLITSSDDRTVKVWDYQTKSCVATLEGHLSN 230

Query: 614 IMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDG-TSVISAS 672
           +    + P      S S+DG VK W+ + ++  + L       W +A    G  + I+A 
Sbjct: 231 VSYAVYHPMLPIIISGSEDGTVKIWNSNTYKLERTLNLGLERSWCVAAHPTGKRNFIAAG 290

Query: 673 HDHSLRV 679
            D+   V
Sbjct: 291 FDNGFTV 297

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/163 (22%), Positives = 72/163 (44%), Gaps = 10/163 (6%)

Query: 75  SKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVL-LTFNGHKSAITVMKFDVTGTR 133
           + P  +  L  H   + + +   D T+K+W+      L  TF GH+  +  + F+     
Sbjct: 95  AHPDYIRALAVHPTRSYVLSASDDLTVKLWNWEKNWALEQTFEGHEHFVMSVTFNPKDPN 154

Query: 134 -LISGSRDSNIIVWDLVSEVGLYKLRSHKDA----ISGIWCEGEDWLVSTSKDGLIKIWD 188
              +   D  + +W L  E   + LR+H +     +     + + +L+++S D  +K+WD
Sbjct: 155 TFATACLDHTVKIWSLGQETSNFTLRAHLEKGVNFVDYYPFQDKPYLITSSDDRTVKVWD 214

Query: 189 LKVQQCIETHIAHTGECWAMGVHEDLL---ITSGADTQLKLWN 228
            + + C+ T   H     +  V+  +L   I+   D  +K+WN
Sbjct: 215 YQTKSCVATLEGHLSNV-SYAVYHPMLPIIISGSEDGTVKIWN 256

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 44/91 (48%), Gaps = 6/91 (6%)

Query: 80  VSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSR 139
           V Y  + D+  L+ +   D T+KVWD  +KS + T  GH S ++   +      +ISGS 
Sbjct: 190 VDYYPFQDKPYLITSS-DDRTVKVWDYQTKSCVATLEGHLSNVSYAVYHPMLPIIISGSE 248

Query: 140 DSNIIVWDLVSEVGLYKL-RSHKDAISGIWC 169
           D  + +W+       YKL R+    +   WC
Sbjct: 249 DGTVKIWN----SNTYKLERTLNLGLERSWC 275

 Score = 40.8 bits (94), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 55/128 (42%), Gaps = 4/128 (3%)

Query: 88  ETNLLAAGYMDGTIKVWDLLSKSVLLTFNGH-KSAITVMKFDVTGTR--LISGSRDSNII 144
           + N  A   +D T+K+W L  ++   T   H +  +  + +     +  LI+ S D  + 
Sbjct: 152 DPNTFATACLDHTVKIWSLGQETSNFTLRAHLEKGVNFVDYYPFQDKPYLITSSDDRTVK 211

Query: 145 VWDLVSEVGLYKLRSHKDAIS-GIWCEGEDWLVSTSKDGLIKIWDLKVQQCIETHIAHTG 203
           VWD  ++  +  L  H   +S  ++      ++S S+DG +KIW+    +   T      
Sbjct: 212 VWDYQTKSCVATLEGHLSNVSYAVYHPMLPIIISGSEDGTVKIWNSNTYKLERTLNLGLE 271

Query: 204 ECWAMGVH 211
             W +  H
Sbjct: 272 RSWCVAAH 279

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 31/141 (21%), Positives = 57/141 (40%), Gaps = 18/141 (12%)

Query: 34  NSPGSVITSALENINIWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLA 93
           + P  + +S    + +WD +T   ++ L   L            + VSY  YH    ++ 
Sbjct: 197 DKPYLITSSDDRTVKVWDYQTKSCVATLEGHL------------SNVSYAVYHPMLPIII 244

Query: 94  AGYMDGTIKVWDLLSKSVLLTFN-GHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEV 152
           +G  DGT+K+W+  +  +  T N G + +  V          I+   D+       V  +
Sbjct: 245 SGSEDGTVKIWNSNTYKLERTLNLGLERSWCVAAHPTGKRNFIAAGFDNGFT----VLAI 300

Query: 153 GLYKLRSHKDAISG-IWCEGE 172
           G  + R   D +   +WC G+
Sbjct: 301 GNDEPRLSLDPVGKLVWCGGK 321

>Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar to
           Ashbya gossypii AEL269C
          Length = 465

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 75/313 (23%), Positives = 139/313 (44%), Gaps = 27/313 (8%)

Query: 377 RLYTIELPGHR----TDIRSVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFD---CGY 428
           +L T+EL G +      +  V +S DD  +A+ +  G +KV N  T   ++ FD    G 
Sbjct: 167 KLRTLELAGSQLVAEKPVSEVCVSKDDVYVASGNWGGHIKVLNSDTLDIVKSFDNVHSGK 226

Query: 429 ALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGS 488
                + P    ++ G  +  +++ +L   +  E K+  H   +  +     G+   + S
Sbjct: 227 VCGLDWHPTANSLLSGGADNLVKITNLDQGSCAELKD--HVGRVCKVKFHPSGKFAASAS 284

Query: 489 ADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLD 548
            D T   W+ +           K L + +L    + EV     ++    +   LA   LD
Sbjct: 285 FDMTWILWDLE-----------KALAI-QLQEGHSREV----FTLGFQTDGSLLASGGLD 328

Query: 549 NTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLF 608
           +   ++ L S +  ++L GH+ P+  +D S +   + T+S D +IKIW L       +L 
Sbjct: 329 SIGLIWDLRSGEPIMNLVGHQKPIYGLDWSPNGYQVATASGDGSIKIWDLRKQSIVSTLL 388

Query: 609 AHQDSIMNVKF-LPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTS 667
           AH++   ++KF     H   S   D  +K ++ D +E I+ L  H  ++ S+ + SDG+ 
Sbjct: 389 AHRNVAFDIKFDKANGHFLVSGGYDRELKIFNADNWELIKTLEGHTDKILSVDLVSDGSK 448

Query: 668 VISASHDHSLRVW 680
             S   D +++ W
Sbjct: 449 FFSTGWDRTVKQW 461

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 75/170 (44%), Gaps = 4/170 (2%)

Query: 65  LPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITV 124
           L  GS          V  + +H      A+   D T  +WDL     +    GH   +  
Sbjct: 253 LDQGSCAELKDHVGRVCKVKFHPSGKFAASASFDMTWILWDLEKALAIQLQEGHSREVFT 312

Query: 125 MKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGEDWLVSTSKDGL 183
           + F   G+ L SG  DS  ++WDL S   +  L  H+  I G+ W      + + S DG 
Sbjct: 313 LGFQTDGSLLASGGLDSIGLIWDLRSGEPIMNLVGHQKPIYGLDWSPNGYQVATASGDGS 372

Query: 184 IKIWDLKVQQCIETHIAHTGECWAM---GVHEDLLITSGADTQLKLWNLD 230
           IKIWDL+ Q  + T +AH    + +     +   L++ G D +LK++N D
Sbjct: 373 IKIWDLRKQSIVSTLLAHRNVAFDIKFDKANGHFLVSGGYDRELKIFNAD 422

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 85/174 (48%), Gaps = 4/174 (2%)

Query: 60  VLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHK 119
           +L D   A +I ++     EV  L +  + +LLA+G +D    +WDL S   ++   GH+
Sbjct: 290 ILWDLEKALAIQLQEGHSREVFTLGFQTDGSLLASGGLDSIGLIWDLRSGEPIMNLVGHQ 349

Query: 120 SAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGED--WLVS 177
             I  + +   G ++ + S D +I +WDL  +  +  L +H++    I  +  +  +LVS
Sbjct: 350 KPIYGLDWSPNGYQVATASGDGSIKIWDLRKQSIVSTLLAHRNVAFDIKFDKANGHFLVS 409

Query: 178 TSKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHED--LLITSGADTQLKLWNL 229
              D  +KI++    + I+T   HT +  ++ +  D     ++G D  +K W L
Sbjct: 410 GGYDRELKIFNADNWELIKTLEGHTDKILSVDLVSDGSKFFSTGWDRTVKQWTL 463

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/228 (21%), Positives = 96/228 (42%), Gaps = 29/228 (12%)

Query: 399 DKLLATASNGLLKVWNLKTKACIRVFD-CGYALTCKFLPGGTLVIVGTREGSLQLFDLAS 457
           + LL+  ++ L+K+ NL   +C  + D  G     KF P G      + + +  L+DL  
Sbjct: 237 NSLLSGGADNLVKITNLDQGSCAELKDHVGRVCKVKFHPSGKFAASASFDMTWILWDLEK 296

Query: 458 STLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLV-------PGTAD 510
           +  ++ +E  H   +++L   +DG  L +G  D     W+ +  E ++       P    
Sbjct: 297 ALAIQLQE-GHSREVFTLGFQTDGSLLASGGLDSIGLIWDLRSGEPIMNLVGHQKPIYGL 355

Query: 511 KYLP----VMKLIHDTTMEV----NEDVLSVRISPED------------KFLAISLLDNT 550
            + P    V     D ++++     + ++S  ++  +             FL     D  
Sbjct: 356 DWSPNGYQVATASGDGSIKIWDLRKQSIVSTLLAHRNVAFDIKFDKANGHFLVSGGYDRE 415

Query: 551 VKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGL 598
           +K+F  D+ +   +L GH   +LS+D+  D     ++  D+ +K W L
Sbjct: 416 LKIFNADNWELIKTLEGHTDKILSVDLVSDGSKFFSTGWDRTVKQWTL 463

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 53/134 (39%), Gaps = 1/134 (0%)

Query: 548 DNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSL 607
           DN VK+  LD       L  H   V  +      K   ++S D    +W L+     +  
Sbjct: 245 DNLVKITNLDQGSC-AELKDHVGRVCKVKFHPSGKFAASASFDMTWILWDLEKALAIQLQ 303

Query: 608 FAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTS 667
             H   +  + F  +     S   D +   WD    E I  L  HQ  ++ +  + +G  
Sbjct: 304 EGHSREVFTLGFQTDGSLLASGGLDSIGLIWDLRSGEPIMNLVGHQKPIYGLDWSPNGYQ 363

Query: 668 VISASHDHSLRVWE 681
           V +AS D S+++W+
Sbjct: 364 VATASGDGSIKIWD 377

>Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON}
           complement(37021..37932) [912 nt, 304 aa]
          Length = 303

 Score = 79.0 bits (193), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 64/272 (23%), Positives = 125/272 (45%), Gaps = 25/272 (9%)

Query: 331 QYKIKSVSFTTVSNTKLEFVVTTSSNSIEYYSIPYEKRDPTSPAPTRLYTIELPGHRTDI 390
           Q+    V+  T++N K + +      +++ Y I     + T+P P   +     GHR ++
Sbjct: 29  QHSDSQVNRLTITNDK-KLLAAAGHQNVKLYDI-----NTTNPNPVASFE----GHRGNV 78

Query: 391 RSVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFDCGYALT-CKFLPGGTLVIVGTREG 448
            S+   +D++ + T+S +G +KVW++++ +  R +     +      P    +I   R+G
Sbjct: 79  TSLSFQNDNRWMVTSSEDGTIKVWDVRSPSVPRTYKHNAPVNEVAIHPNQGELISCDRDG 138

Query: 449 SLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGT 508
           +++++DL  +          +T + SL + +DG  LV  ++      W      D     
Sbjct: 139 NIRIWDLGENQCTHQLTPEDDTPVQSLSLATDGSMLVAANSKGNCYVWEMPNRTD----- 193

Query: 509 ADKYLPVMKL-IHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLD-SMKFFLSLY 566
           A    PV K   HD        +  + +S + KFLA    D+T +++ +D +     +L 
Sbjct: 194 ASNLKPVTKFRAHDAY------ITRILLSSDVKFLATCSADHTARIWSIDDNFNLHTTLD 247

Query: 567 GHKLPVLSIDISFDSKLIITSSADKNIKIWGL 598
           GH+  V     S DS  +IT+S+D  +++W L
Sbjct: 248 GHQRWVWDCAFSADSAYLITASSDHYVRLWDL 279

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 58/230 (25%), Positives = 95/230 (41%), Gaps = 25/230 (10%)

Query: 466 DAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTME 525
           + H   + SL   +D R +VT S D TIK W+  V    VP T     PV          
Sbjct: 72  EGHRGNVTSLSFQNDNRWMVTSSEDGTIKVWD--VRSPSVPRTYKHNAPV---------- 119

Query: 526 VNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHK-LPVLSIDISFDSKLI 584
            NE    V I P    L     D  ++++ L   +    L      PV S+ ++ D  ++
Sbjct: 120 -NE----VAIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTPVQSLSLATDGSML 174

Query: 585 ITSSADKNIKIWGLDFGDCHKSL-----FAHQDSIMNVKFLPESHNFFSS-SKDGLVKYW 638
           + +++  N  +W +       +L     F   D+ +    L     F ++ S D   + W
Sbjct: 175 VAANSKGNCYVWEMPNRTDASNLKPVTKFRAHDAYITRILLSSDVKFLATCSADHTARIW 234

Query: 639 D-GDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWEETDDQV 687
              D F     L  HQ  VW  A ++D   +I+AS DH +R+W+ +  ++
Sbjct: 235 SIDDNFNLHTTLDGHQRWVWDCAFSADSAYLITASSDHYVRLWDLSTREI 284

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 48/201 (23%), Positives = 92/201 (45%), Gaps = 21/201 (10%)

Query: 484 LVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLA 543
           LV+   D TI+FW      + + G   +          T    +  V  + I+ + K LA
Sbjct: 5   LVSAGYDHTIRFW------EALTGVCSR----------TIQHSDSQVNRLTITNDKKLLA 48

Query: 544 ISLLDNTVKVFYLDSMKF--FLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFG 601
            +   N VK++ +++       S  GH+  V S+    D++ ++TSS D  IK+W +   
Sbjct: 49  AAGHQN-VKLYDINTTNPNPVASFEGHRGNVTSLSFQNDNRWMVTSSEDGTIKVWDVRSP 107

Query: 602 DCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAH-QSEVWSIA 660
              ++ + H   +  V   P      S  +DG ++ WD  + +C  +L     + V S++
Sbjct: 108 SVPRT-YKHNAPVNEVAIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTPVQSLS 166

Query: 661 ITSDGTSVISASHDHSLRVWE 681
           + +DG+ +++A+   +  VWE
Sbjct: 167 LATDGSMLVAANSKGNCYVWE 187

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 47/196 (23%), Positives = 82/196 (41%), Gaps = 21/196 (10%)

Query: 45  ENINIWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVW 104
           +N+ ++DI T       ++  P  S +        V+ L + ++   +     DGTIKVW
Sbjct: 53  QNVKLYDINT-------TNPNPVASFE---GHRGNVTSLSFQNDNRWMVTSSEDGTIKVW 102

Query: 105 DLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAI 164
           D+ S SV  T+  H + +  +        LIS  RD NI +WDL      ++L    D  
Sbjct: 103 DVRSPSVPRTYK-HNAPVNEVAIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTP 161

Query: 165 SGIWCEGED--WLVSTSKDGLIKIWDLKVQ------QCIETHIAHTGECWAMGVHEDL-- 214
                   D   LV+ +  G   +W++  +      + +    AH      + +  D+  
Sbjct: 162 VQSLSLATDGSMLVAANSKGNCYVWEMPNRTDASNLKPVTKFRAHDAYITRILLSSDVKF 221

Query: 215 LITSGADTQLKLWNLD 230
           L T  AD   ++W++D
Sbjct: 222 LATCSADHTARIWSID 237

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 61/113 (53%), Gaps = 8/113 (7%)

Query: 86  HDETNLLAAGYMDGTIKVWDL--LSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNI 143
           +D+  L AAG+ +  +K++D+   + + + +F GH+  +T + F      +++ S D  I
Sbjct: 42  NDKKLLAAAGHQN--VKLYDINTTNPNPVASFEGHRGNVTSLSFQNDNRWMVTSSEDGTI 99

Query: 144 IVWDLVSEV--GLYKLRSHKDAISGIWCEGEDWLVSTSKDGLIKIWDLKVQQC 194
            VWD+ S      YK  +  + ++    +GE  L+S  +DG I+IWDL   QC
Sbjct: 100 KVWDVRSPSVPRTYKHNAPVNEVAIHPNQGE--LISCDRDGNIRIWDLGENQC 150

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 46/233 (19%), Positives = 95/233 (40%), Gaps = 18/233 (7%)

Query: 9   EQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISVLSDGLPAG 68
           +   ++ + +TN N     P +      G+V + + +N N W + + E  ++    + + 
Sbjct: 53  QNVKLYDINTTNPN-----PVASFEGHRGNVTSLSFQNDNRWMVTSSEDGTIKVWDVRSP 107

Query: 69  SIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHK-SAITVMKF 127
           S+       A V+ +  H     L +   DG I++WDL              + +  +  
Sbjct: 108 SVPRTYKHNAPVNEVAIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTPVQSLSL 167

Query: 128 DVTGTRLISGSRDSNIIVWDLVSEVG------LYKLRSHKDAISGIWCEGE-DWLVSTSK 180
              G+ L++ +   N  VW++ +         + K R+H   I+ I    +  +L + S 
Sbjct: 168 ATDGSMLVAANSKGNCYVWEMPNRTDASNLKPVTKFRAHDAYITRILLSSDVKFLATCSA 227

Query: 181 DGLIKIW----DLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNL 229
           D   +IW    +  +   ++ H     +C A       LIT+ +D  ++LW+L
Sbjct: 228 DHTARIWSIDDNFNLHTTLDGHQRWVWDC-AFSADSAYLITASSDHYVRLWDL 279

 Score = 43.9 bits (102), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/114 (22%), Positives = 62/114 (54%), Gaps = 4/114 (3%)

Query: 575 IDISFDSKLIITSSADKNIKIWGLDFGDCH--KSLFAHQDSIMNVKFLPESHNFFSSSKD 632
           + I+ D KL+  ++  +N+K++ ++  + +   S   H+ ++ ++ F  ++    +SS+D
Sbjct: 38  LTITNDKKLL-AAAGHQNVKLYDINTTNPNPVASFEGHRGNVTSLSFQNDNRWMVTSSED 96

Query: 633 GLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWEETDDQ 686
           G +K WD  +   + +   H + V  +AI  +   +IS   D ++R+W+  ++Q
Sbjct: 97  GTIKVWDV-RSPSVPRTYKHNAPVNEVAIHPNQGELISCDRDGNIRIWDLGENQ 149

 Score = 36.2 bits (82), Expect = 0.35,   Method: Composition-based stats.
 Identities = 29/131 (22%), Positives = 54/131 (41%), Gaps = 15/131 (11%)

Query: 384 PGHRTDIRSVDISDDDKLLATA-SNGLLKVW---------NLKTKACIRVFDCGYALTCK 433
           P   T ++S+ ++ D  +L  A S G   VW         NLK     R  D   A   +
Sbjct: 156 PEDDTPVQSLSLATDGSMLVAANSKGNCYVWEMPNRTDASNLKPVTKFRAHD---AYITR 212

Query: 434 FLPGGTLVIVGT--REGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADK 491
            L    +  + T   + + +++ +  +  L    D H+  +W    ++D   L+T S+D 
Sbjct: 213 ILLSSDVKFLATCSADHTARIWSIDDNFNLHTTLDGHQRWVWDCAFSADSAYLITASSDH 272

Query: 492 TIKFWNFQVEE 502
            ++ W+    E
Sbjct: 273 YVRLWDLSTRE 283

>KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {ON}
           Anc_6.363 YCR084C
          Length = 665

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 65/260 (25%), Positives = 113/260 (43%), Gaps = 44/260 (16%)

Query: 428 YALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTG 487
           Y  +  F P G  +  G  +  ++++D+    ++   +  H+  ++SLD    G +LV+G
Sbjct: 385 YIRSVCFSPDGKFLATGAEDKLIRIWDIQQRKIVMVLQ-GHDQDVYSLDYFPSGDKLVSG 443

Query: 488 SADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPED-KFLAISL 546
           S D+T++ W      DL  G               T+ + + V +V +SP D KF+A   
Sbjct: 444 SGDRTVRIW------DLKTGQCS-----------LTLSIEDGVTTVAVSPGDGKFIAAGS 486

Query: 547 LDNTVKVFYLDSMKFFLSLY---------GHKLPVLSIDISFDSKLIITSSADKNIKIWG 597
           LD  V+V+  DS   FL            GHK  V S+  + D   +++ S D+++K+W 
Sbjct: 487 LDRAVRVW--DSETGFLVERLDSENELGTGHKDSVYSVVFTKDGNKVVSGSLDRSVKLWN 544

Query: 598 L--------------DFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKF 643
           L                  C  +   H+D +++V          S SKD  V +WD    
Sbjct: 545 LRDNNANSSSNNSNKSNATCDVTYVGHKDFVLSVTTTANDEYILSGSKDRGVLFWDTKSG 604

Query: 644 ECIQKLAAHQSEVWSIAITS 663
             +  L  H++ V S+A+ +
Sbjct: 605 NPLLMLQGHRNSVISVAVAN 624

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 80/163 (49%), Gaps = 9/163 (5%)

Query: 530 VLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSA 589
           + SV  SP+ KFLA    D  ++++ +   K  + L GH   V S+D       +++ S 
Sbjct: 386 IRSVCFSPDGKFLATGAEDKLIRIWDIQQRKIVMVLQGHDQDVYSLDYFPSGDKLVSGSG 445

Query: 590 DKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSS-SKDGLVKYWDGDKFECIQK 648
           D+ ++IW L  G C  +L + +D +  V   P    F ++ S D  V+ WD +    +++
Sbjct: 446 DRTVRIWDLKTGQCSLTL-SIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETGFLVER 504

Query: 649 L-------AAHQSEVWSIAITSDGTSVISASHDHSLRVWEETD 684
           L         H+  V+S+  T DG  V+S S D S+++W   D
Sbjct: 505 LDSENELGTGHKDSVYSVVFTKDGNKVVSGSLDRSVKLWNLRD 547

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 111/236 (47%), Gaps = 19/236 (8%)

Query: 377 RLYTIELPGHRTDIRSVD-ISDDDKLLATASNGLLKVWNLKTKACIRVFDCGYALTCKFL 435
           R   + L GH  D+ S+D     DKL++ + +  +++W+LKT  C         +T   +
Sbjct: 415 RKIVMVLQGHDQDVYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCSLTLSIEDGVTTVAV 474

Query: 436 -PG-GTLVIVGTREGSLQLFDLASSTLLENKED------AHETAIWSLDITSDGRRLVTG 487
            PG G  +  G+ + +++++D  +  L+E  +        H+ +++S+  T DG ++V+G
Sbjct: 475 SPGDGKFIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTKDGNKVVSG 534

Query: 488 SADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNED-VLSVRISPEDKFLAISL 546
           S D+++K WN +   D    ++           D T   ++D VLSV  +  D+++    
Sbjct: 535 SLDRSVKLWNLR---DNNANSSSNNSNKSNATCDVTYVGHKDFVLSVTTTANDEYILSGS 591

Query: 547 LDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKL------IITSSADKNIKIW 596
            D  V  +   S    L L GH+  V+S+ ++  + L        T S D   +IW
Sbjct: 592 KDRGVLFWDTKSGNPLLMLQGHRNSVISVAVANRTPLGPKYQVFATGSGDCRARIW 647

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 96/214 (44%), Gaps = 35/214 (16%)

Query: 49  IWDIKTGELISVLSDGLPAGSIDVKSS---KPAEVS---------------YLH---YHD 87
           I+ + TGELI+ LSD     ++   ++    PA V+               Y+    +  
Sbjct: 334 IYKVSTGELIAKLSDDNANSAVSSNNNDQNAPANVNGANANSGNNTNSNDLYIRSVCFSP 393

Query: 88  ETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWD 147
           +   LA G  D  I++WD+  + +++   GH   +  + +  +G +L+SGS D  + +WD
Sbjct: 394 DGKFLATGAEDKLIRIWDIQQRKIVMVLQGHDQDVYSLDYFPSGDKLVSGSGDRTVRIWD 453

Query: 148 LVSEVGLYKLR-SHKDAISGIWCEGED--WLVSTSKDGLIKIWDLKVQQCIET------- 197
           L  + G   L  S +D ++ +     D  ++ + S D  +++WD +    +E        
Sbjct: 454 L--KTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETGFLVERLDSENEL 511

Query: 198 HIAHTGECWAMGVHED--LLITSGADTQLKLWNL 229
              H    +++   +D   +++   D  +KLWNL
Sbjct: 512 GTGHKDSVYSVVFTKDGNKVVSGSLDRSVKLWNL 545

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/290 (22%), Positives = 124/290 (42%), Gaps = 57/290 (19%)

Query: 390 IRSVDISDDDKLLAT-ASNGLLKVWNLKTKACIRVFDCGY---ALTCKFLPGGTLVIVGT 445
           IRSV  S D K LAT A + L+++W+++ +  + V   G+     +  + P G  ++ G+
Sbjct: 386 IRSVCFSPDGKFLATGAEDKLIRIWDIQQRKIVMVLQ-GHDQDVYSLDYFPSGDKLVSGS 444

Query: 446 REGSLQLFDLASS--TLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQV--- 500
            + +++++DL +   +L  + ED   T   S     DG+ +  GS D+ ++ W+ +    
Sbjct: 445 GDRTVRIWDLKTGQCSLTLSIEDGVTTVAVS---PGDGKFIAAGSLDRAVRVWDSETGFL 501

Query: 501 ------EEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVF 554
                 E +L  GT  K                + V SV  + +   +    LD +VK++
Sbjct: 502 VERLDSENEL--GTGHK----------------DSVYSVVFTKDGNKVVSGSLDRSVKLW 543

Query: 555 YLDSMKFF--------------LSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600
            L                    ++  GHK  VLS+  + + + I++ S D+ +  W    
Sbjct: 544 NLRDNNANSSSNNSNKSNATCDVTYVGHKDFVLSVTTTANDEYILSGSKDRGVLFWDTKS 603

Query: 601 GDCHKSLFAHQDSIMNVKFL------PESHNFFSSSKDGLVKYWDGDKFE 644
           G+    L  H++S+++V         P+   F + S D   + W   K +
Sbjct: 604 GNPLLMLQGHRNSVISVAVANRTPLGPKYQVFATGSGDCRARIWKFSKID 653

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 55/227 (24%), Positives = 91/227 (40%), Gaps = 64/227 (28%)

Query: 47  INIWDIKTGELISVLS--DGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVW 104
           + IWD+KTG+    LS  DG+   ++     K               +AAG +D  ++VW
Sbjct: 449 VRIWDLKTGQCSLTLSIEDGVTTVAVSPGDGK--------------FIAAGSLDRAVRVW 494

Query: 105 D---------LLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDL------- 148
           D         L S++ L T  GHK ++  + F   G +++SGS D ++ +W+L       
Sbjct: 495 DSETGFLVERLDSENELGT--GHKDSVYSVVFTKDGNKVVSGSLDRSVKLWNLRDNNANS 552

Query: 149 -------------VSEVGLYKLRSHKDAISGIWCEGED-WLVSTSKDGLIKIWDLKVQQC 194
                        V+ VG      HKD +  +     D +++S SKD  +  WD K    
Sbjct: 553 SSNNSNKSNATCDVTYVG------HKDFVLSVTTTANDEYILSGSKDRGVLFWDTKSGNP 606

Query: 195 IETHIAHTGECWAMGVHE--------DLLITSGADTQLKLWNLDFSK 233
           +     H     ++ V           +  T   D + ++W   FSK
Sbjct: 607 LLMLQGHRNSVISVAVANRTPLGPKYQVFATGSGDCRARIWK--FSK 651

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 53/113 (46%), Gaps = 2/113 (1%)

Query: 570 LPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSS 629
           L + S+  S D K + T + DK I+IW +        L  H   + ++ + P      S 
Sbjct: 384 LYIRSVCFSPDGKFLATGAEDKLIRIWDIQQRKIVMVLQGHDQDVYSLDYFPSGDKLVSG 443

Query: 630 SKDGLVKYWDGDKFECIQKLAAHQSEVWSIAIT-SDGTSVISASHDHSLRVWE 681
           S D  V+ WD    +C   L+     V ++A++  DG  + + S D ++RVW+
Sbjct: 444 SGDRTVRIWDLKTGQCSLTLSIEDG-VTTVAVSPGDGKFIAAGSLDRAVRVWD 495

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/201 (21%), Positives = 83/201 (41%), Gaps = 34/201 (16%)

Query: 10  QASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISVL--SDGLPA 67
           Q S+   I      V +SP   K  + GS+  +    + +WD +TG L+  L   + L  
Sbjct: 458 QCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRA----VRVWDSETGFLVERLDSENELGT 513

Query: 68  GSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDL--------------LSKSVLL 113
           G  D        V  + +  + N + +G +D ++K+W+L               + +  +
Sbjct: 514 GHKD-------SVYSVVFTKDGNKVVSGSLDRSVKLWNLRDNNANSSSNNSNKSNATCDV 566

Query: 114 TFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGED 173
           T+ GHK  +  +        ++SGS+D  ++ WD  S   L  L+ H++++  +      
Sbjct: 567 TYVGHKDFVLSVTTTANDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVAVANRT 626

Query: 174 WL-------VSTSKDGLIKIW 187
            L        + S D   +IW
Sbjct: 627 PLGPKYQVFATGSGDCRARIW 647

>Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR178W
           (PRP4) - associated with the U4/U6 snRNP [contig 8] FULL
          Length = 474

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/245 (24%), Positives = 107/245 (43%), Gaps = 13/245 (5%)

Query: 436 PGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKF 495
           P G  +  G+  G +++    S  ++ + + AH+  I  +  +SD + L TG AD  +K 
Sbjct: 192 PDGASLAAGSWNGDVKILHPQSLEVVRSLDGAHDDKIGGVAWSSDSQLLATGGADNLVKI 251

Query: 496 WNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFY 555
           WN Q +      +  +   V+   H+        V  V+  P D+F+A +  D T +++ 
Sbjct: 252 WNPQAQ------SHSEASRVVLRGHEAR------VSKVKFHPSDRFVASASFDMTWRLWD 299

Query: 556 LDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 615
           ++         GH   V  +D   D  L+ ++  D    +W +  G     L  H   I 
Sbjct: 300 VERETELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIY 359

Query: 616 NVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAI-TSDGTSVISASHD 674
            V + P  H+  + S DG V+ WD  K      + AH S V  +     +G  ++S+S+D
Sbjct: 360 GVSWSPNGHHVATGSGDGTVQVWDIRKANKPSSILAHNSIVSEVNFEKENGNFLVSSSYD 419

Query: 675 HSLRV 679
            ++ V
Sbjct: 420 RTIGV 424

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 110/235 (46%), Gaps = 23/235 (9%)

Query: 369 DPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLL-KVWNLKTKACIRVFDCG 427
           +P + + +    + L GH   +  V     D+ +A+AS  +  ++W+++ +  +++ + G
Sbjct: 253 NPQAQSHSEASRVVLRGHEARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQE-G 311

Query: 428 YA--LTC-KFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRL 484
           +A  + C  F   G+L+     +    ++D+ +   L   E  H   I+ +  + +G  +
Sbjct: 312 HAKEVYCLDFQCDGSLLCSAGLDSVGHVWDMRTGRSLMVLE-GHAKPIYGVSWSPNGHHV 370

Query: 485 VTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTM-EVNEDVLSVRISPEDKFLA 543
            TGS D T++ W+ +         A+K  P   L H++ + EVN +           FL 
Sbjct: 371 ATGSGDGTVQVWDIR--------KANK--PSSILAHNSIVSEVNFE------KENGNFLV 414

Query: 544 ISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGL 598
            S  D T+ VF   S     SL GH   +LS+DIS     + +S  D+++KIW L
Sbjct: 415 SSSYDRTIGVFATGSWIKLASLQGHTDKILSVDISRGGANLWSSGWDRSVKIWAL 469

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 75/168 (44%), Gaps = 5/168 (2%)

Query: 519 IHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYG-HKLPVLSIDI 577
           +H + +  +  V  V  SP+   LA    +  VK+ +  S++   SL G H   +  +  
Sbjct: 174 LHGSQVVFSRPVSQVARSPDGASLAAGSWNGDVKILHPQSLEVVRSLDGAHDDKIGGVAW 233

Query: 578 SFDSKLIITSSADKNIKIWGLDFGDCHKS----LFAHQDSIMNVKFLPESHNFFSSSKDG 633
           S DS+L+ T  AD  +KIW        ++    L  H+  +  VKF P      S+S D 
Sbjct: 234 SSDSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVSKVKFHPSDRFVASASFDM 293

Query: 634 LVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWE 681
             + WD ++   +Q    H  EV+ +    DG+ + SA  D    VW+
Sbjct: 294 TWRLWDVERETELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSVGHVWD 341

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 58/126 (46%), Gaps = 1/126 (0%)

Query: 78  AEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISG 137
           A VS + +H     +A+   D T ++WD+  ++ L    GH   +  + F   G+ L S 
Sbjct: 272 ARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQEGHAKEVYCLDFQCDGSLLCSA 331

Query: 138 SRDSNIIVWDLVSEVGLYKLRSHKDAISGI-WCEGEDWLVSTSKDGLIKIWDLKVQQCIE 196
             DS   VWD+ +   L  L  H   I G+ W      + + S DG +++WD++      
Sbjct: 332 GLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIRKANKPS 391

Query: 197 THIAHT 202
           + +AH 
Sbjct: 392 SILAHN 397

 Score = 57.8 bits (138), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 64/264 (24%), Positives = 107/264 (40%), Gaps = 29/264 (10%)

Query: 385 GHRTDIRSVDISDDDKLLATA-SNGLLKVWNLKTKA---CIRVFDCGYALTC---KFLPG 437
            H   I  V  S D +LLAT  ++ L+K+WN + ++     RV   G+       KF P 
Sbjct: 223 AHDDKIGGVAWSSDSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVSKVKFHPS 282

Query: 438 GTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWN 497
              V   + + + +L+D+   T L+ +E  H   ++ LD   DG  L +   D     W+
Sbjct: 283 DRFVASASFDMTWRLWDVERETELQLQE-GHAKEVYCLDFQCDGSLLCSAGLDSVGHVWD 341

Query: 498 FQVEEDL--VPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFY 555
            +    L  + G A                  + +  V  SP    +A    D TV+V+ 
Sbjct: 342 MRTGRSLMVLEGHA------------------KPIYGVSWSPNGHHVATGSGDGTVQVWD 383

Query: 556 LDSMKFFLSLYGHKLPVLSIDISFDS-KLIITSSADKNIKIWGLDFGDCHKSLFAHQDSI 614
           +       S+  H   V  ++   ++   +++SS D+ I ++         SL  H D I
Sbjct: 384 IRKANKPSSILAHNSIVSEVNFEKENGNFLVSSSYDRTIGVFATGSWIKLASLQGHTDKI 443

Query: 615 MNVKFLPESHNFFSSSKDGLVKYW 638
           ++V       N +SS  D  VK W
Sbjct: 444 LSVDISRGGANLWSSGWDRSVKIW 467

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 79/160 (49%), Gaps = 16/160 (10%)

Query: 37  GSVITSA-LENI-NIWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAA 94
           GS++ SA L+++ ++WD++TG  + VL             +KP  +  + +    + +A 
Sbjct: 325 GSLLCSAGLDSVGHVWDMRTGRSLMVLE----------GHAKP--IYGVSWSPNGHHVAT 372

Query: 95  GYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDV-TGTRLISGSRDSNIIVWDLVSEVG 153
           G  DGT++VWD+   +   +   H S ++ + F+   G  L+S S D  I V+   S + 
Sbjct: 373 GSGDGTVQVWDIRKANKPSSILAHNSIVSEVNFEKENGNFLVSSSYDRTIGVFATGSWIK 432

Query: 154 LYKLRSHKDAISGI-WCEGEDWLVSTSKDGLIKIWDLKVQ 192
           L  L+ H D I  +    G   L S+  D  +KIW L V+
Sbjct: 433 LASLQGHTDKILSVDISRGGANLWSSGWDRSVKIWALGVR 472

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 74/164 (45%), Gaps = 4/164 (2%)

Query: 70  IDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDV 129
           + ++     EV  L +  + +LL +  +D    VWD+ +   L+   GH   I  + +  
Sbjct: 306 LQLQEGHAKEVYCLDFQCDGSLLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSP 365

Query: 130 TGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGE--DWLVSTSKDGLIKIW 187
            G  + +GS D  + VWD+        + +H   +S +  E E  ++LVS+S D  I ++
Sbjct: 366 NGHHVATGSGDGTVQVWDIRKANKPSSILAHNSIVSEVNFEKENGNFLVSSSYDRTIGVF 425

Query: 188 DLKVQQCIETHIAHTGECWAMGVHEDL--LITSGADTQLKLWNL 229
                  + +   HT +  ++ +      L +SG D  +K+W L
Sbjct: 426 ATGSWIKLASLQGHTDKILSVDISRGGANLWSSGWDRSVKIWAL 469

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 44/206 (21%), Positives = 85/206 (41%), Gaps = 23/206 (11%)

Query: 85  YHDETNLLAAGYMDGTIKVWDLLSKS----VLLTFNGHKSAITVMKFDVTGTRLISGSRD 140
           +  ++ LLA G  D  +K+W+  ++S      +   GH++ ++ +KF  +   + S S D
Sbjct: 233 WSSDSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVSKVKFHPSDRFVASASFD 292

Query: 141 SNIIVWDLVSEVGLYKLRSHKDAISGI--WCEGEDWLVSTSKDGLIKIWDLKVQQCIETH 198
               +WD+  E  L     H   +  +   C+G   L S   D +  +WD++  + +   
Sbjct: 293 MTWRLWDVERETELQLQEGHAKEVYCLDFQCDGS-LLCSAGLDSVGHVWDMRTGRSLMVL 351

Query: 199 IAHT----GECWAMGVHEDLLITSGADTQLKLWNLDFSKEAGSKLIEKGVYDKQSKQRGL 254
             H     G  W+   H   + T   D  +++W++  + +  S L    +          
Sbjct: 352 EGHAKPIYGVSWSPNGHH--VATGSGDGTVQVWDIRKANKPSSILAHNSIVS-------- 401

Query: 255 DIKFSVAPNGTAFFYIQNADKTTEVF 280
           ++ F    NG  F    + D+T  VF
Sbjct: 402 EVNFE-KENGN-FLVSSSYDRTIGVF 425

>TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 104/251 (41%), Gaps = 15/251 (5%)

Query: 431 TCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSAD 490
           + KF P    + VG+ +G ++     S  +  + E+AH   +  +D  S G  L TG  D
Sbjct: 183 SVKFSPDDKHLAVGSWDGGIKTISAGSLNIKSSVENAHTGKVGEVDWNSSGDLLATGGED 242

Query: 491 KTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNT 550
             +K +  Q  E             ++ + D        V   R  P  +++A +  DNT
Sbjct: 243 GLVKLFTVQSGE-------------LRQVADLQGH-ERRVAGCRFHPFGRYIASASFDNT 288

Query: 551 VKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAH 610
            +++  ++    L   GH   V  +    D  L+ ++  D    IW +  G+C   L  H
Sbjct: 289 WRLWDAETNHELLLQEGHGKEVFCLAFQSDGSLLCSAGLDCTGMIWDIRSGNCAMVLSGH 348

Query: 611 QDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITS-DGTSVI 669
              I +V + P      ++S DG V  WD  K    Q L AH S V  I     +G  ++
Sbjct: 349 TKPIYSVDWSPRGFEVATASGDGTVNIWDIRKTNQPQVLLAHNSIVSGIRFEKHNGKFLM 408

Query: 670 SASHDHSLRVW 680
           S  +D ++ V+
Sbjct: 409 SCGYDKNINVY 419

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 72/299 (24%), Positives = 127/299 (42%), Gaps = 26/299 (8%)

Query: 390 IRSVDISDDDKLLATAS-NGLLK---VWNLKTKACIRVFDCGYALTCKFLPGGTLVIVGT 445
           I SV  S DDK LA  S +G +K     +L  K+ +     G      +   G L+  G 
Sbjct: 181 ISSVKFSPDDKHLAVGSWDGGIKTISAGSLNIKSSVENAHTGKVGEVDWNSSGDLLATGG 240

Query: 446 REGSLQLFDLASSTLLENKE-DAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDL 504
            +G ++LF + S  L +  +   HE  +        GR + + S D T + W+ +   +L
Sbjct: 241 EDGLVKLFTVQSGELRQVADLQGHERRVAGCRFHPFGRYIASASFDNTWRLWDAETNHEL 300

Query: 505 VPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLS 564
           +          ++  H       ++V  +    +   L  + LD T  ++ + S    + 
Sbjct: 301 L----------LQEGH------GKEVFCLAFQSDGSLLCSAGLDCTGMIWDIRSGNCAMV 344

Query: 565 LYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESH 624
           L GH  P+ S+D S     + T+S D  + IW +   +  + L AH   +  ++F  E H
Sbjct: 345 LSGHTKPIYSVDWSPRGFEVATASGDGTVNIWDIRKTNQPQVLLAHNSIVSGIRF--EKH 402

Query: 625 N---FFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVW 680
           N     S   D  +  + GD +  I  L  H  ++ ++ + +   SV+SA  D S++ W
Sbjct: 403 NGKFLMSCGYDKNINVYSGDSWNKITILKGHTDKILALDLGTHDGSVVSAGWDRSVKSW 461

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 73/156 (46%), Gaps = 4/156 (2%)

Query: 79  EVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGS 138
           EV  L +  + +LL +  +D T  +WD+ S +  +  +GH   I  + +   G  + + S
Sbjct: 309 EVFCLAFQSDGSLLCSAGLDCTGMIWDIRSGNCAMVLSGHTKPIYSVDWSPRGFEVATAS 368

Query: 139 RDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGED--WLVSTSKDGLIKIWDLKVQQCIE 196
            D  + +WD+        L +H   +SGI  E  +  +L+S   D  I ++       I 
Sbjct: 369 GDGTVNIWDIRKTNQPQVLLAHNSIVSGIRFEKHNGKFLMSCGYDKNINVYSGDSWNKIT 428

Query: 197 THIAHTGECWA--MGVHEDLLITSGADTQLKLWNLD 230
               HT +  A  +G H+  ++++G D  +K WN+D
Sbjct: 429 ILKGHTDKILALDLGTHDGSVVSAGWDRSVKSWNVD 464

 Score = 57.8 bits (138), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 70/155 (45%), Gaps = 3/155 (1%)

Query: 530 VLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSL-YGHKLPVLSIDISFDSKLIITSS 588
           + SV+ SP+DK LA+   D  +K     S+    S+   H   V  +D +    L+ T  
Sbjct: 181 ISSVKFSPDDKHLAVGSWDGGIKTISAGSLNIKSSVENAHTGKVGEVDWNSSGDLLATGG 240

Query: 589 ADKNIKIWGLDFGDCHK--SLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECI 646
            D  +K++ +  G+  +   L  H+  +   +F P      S+S D   + WD +    +
Sbjct: 241 EDGLVKLFTVQSGELRQVADLQGHERRVAGCRFHPFGRYIASASFDNTWRLWDAETNHEL 300

Query: 647 QKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWE 681
                H  EV+ +A  SDG+ + SA  D +  +W+
Sbjct: 301 LLQEGHGKEVFCLAFQSDGSLLCSAGLDCTGMIWD 335

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 63/262 (24%), Positives = 107/262 (40%), Gaps = 23/262 (8%)

Query: 386 HRTDIRSVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFDC-GY---ALTCKFLPGGTL 440
           H   +  VD +    LLAT   +GL+K++ +++    +V D  G+      C+F P G  
Sbjct: 220 HTGKVGEVDWNSSGDLLATGGEDGLVKLFTVQSGELRQVADLQGHERRVAGCRFHPFGRY 279

Query: 441 VIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQV 500
           +   + + + +L+D  ++  L  +E  H   ++ L   SDG  L +   D T   W    
Sbjct: 280 IASASFDNTWRLWDAETNHELLLQE-GHGKEVFCLAFQSDGSLLCSAGLDCTGMIW---- 334

Query: 501 EEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMK 560
             D+  G        M L   T     + + SV  SP    +A +  D TV ++ +    
Sbjct: 335 --DIRSGNC-----AMVLSGHT-----KPIYSVDWSPRGFEVATASGDGTVNIWDIRKTN 382

Query: 561 FFLSLYGHKLPVLSIDIS-FDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKF 619
               L  H   V  I     + K +++   DKNI ++  D  +    L  H D I+ +  
Sbjct: 383 QPQVLLAHNSIVSGIRFEKHNGKFLMSCGYDKNINVYSGDSWNKITILKGHTDKILALDL 442

Query: 620 LPESHNFFSSSKDGLVKYWDGD 641
                +  S+  D  VK W+ D
Sbjct: 443 GTHDGSVVSAGWDRSVKSWNVD 464

>SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 aa]
           {ON} similar to uniprot|P41811 Saccharomyces cerevisiae
           YGL137W SEC27 Involved in beta'-subunit of yeast
           coatomer
          Length = 878

 Score = 80.1 bits (196), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 70/312 (22%), Positives = 143/312 (45%), Gaps = 27/312 (8%)

Query: 385 GHRTD-IRSVDISDDDK-LLATASNGLLKVWNLKTKACIRVFDCG--YALTCKFLPGGTL 440
           G+R+D ++ +D+   +  +L+T  +G +++WN +T+  +R  +         +F+     
Sbjct: 10  GNRSDRVKGIDLHPTEPWVLSTLYSGRVEIWNYETQTEVRSIEVTDTPVRAGRFIARKNW 69

Query: 441 VIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQV 500
           ++VG+ +  +++F+  +   + + E  H   I S+ +      +++ S D TIK WN++ 
Sbjct: 70  IVVGSDDFKIRVFNYNTGEKVTDFE-GHPDYIRSIAVHPTRPYVLSASDDMTIKLWNWEK 128

Query: 501 EEDLVPGTADKYLPVMKLIHDTTMEVNED-VLSVRISPED-KFLAISLLDNTVKVFYLDS 558
              L                + T E +E  V+ V  +P+D    A + LD+TVK++ L  
Sbjct: 129 NWAL----------------EQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQ 172

Query: 559 MKFFLSLYGHKLPVLSIDISF---DSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 615
                ++  H+   ++    +   D   +ITSS D+++KIW      C  +L  H  ++ 
Sbjct: 173 QSPNFTMTAHETRGVNFVDYYPLQDKPYLITSSDDRSVKIWDYQTKSCVATLEGHMANVS 232

Query: 616 NVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDG-TSVISASHD 674
              F P      S S+DG VK W+ + ++  + L       W +A    G  + +++  D
Sbjct: 233 YAIFHPSLPIIISGSEDGTVKIWNANTYKLEKTLNLGLERSWCVAAHPTGKRNYVASGFD 292

Query: 675 HSLRVWEETDDQ 686
           +   V    +D+
Sbjct: 293 NGFNVLSMGNDE 304

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 64/144 (44%), Gaps = 8/144 (5%)

Query: 98  DGTIKVWDLLSKSVL-LTFNGHKSAITVMKFDVTGTR-LISGSRDSNIIVWDLVSEVGLY 155
           D TIK+W+      L  TF GH+  +  + F+        S   D  + +W L  +   +
Sbjct: 118 DMTIKLWNWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQSPNF 177

Query: 156 KLRSHK----DAISGIWCEGEDWLVSTSKDGLIKIWDLKVQQCIETHIAHTGECWAMGVH 211
            + +H+    + +     + + +L+++S D  +KIWD + + C+ T   H         H
Sbjct: 178 TMTAHETRGVNFVDYYPLQDKPYLITSSDDRSVKIWDYQTKSCVATLEGHMANVSYAIFH 237

Query: 212 EDL--LITSGADTQLKLWNLDFSK 233
             L  +I+   D  +K+WN +  K
Sbjct: 238 PSLPIIISGSEDGTVKIWNANTYK 261

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 59/128 (46%), Gaps = 4/128 (3%)

Query: 88  ETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKS-AITVMKFDVTGTR--LISGSRDSNII 144
           + N  A+  +D T+K+W L  +S   T   H++  +  + +     +  LI+ S D ++ 
Sbjct: 152 DPNTFASACLDHTVKIWSLGQQSPNFTMTAHETRGVNFVDYYPLQDKPYLITSSDDRSVK 211

Query: 145 VWDLVSEVGLYKLRSHKDAIS-GIWCEGEDWLVSTSKDGLIKIWDLKVQQCIETHIAHTG 203
           +WD  ++  +  L  H   +S  I+      ++S S+DG +KIW+    +  +T      
Sbjct: 212 IWDYQTKSCVATLEGHMANVSYAIFHPSLPIIISGSEDGTVKIWNANTYKLEKTLNLGLE 271

Query: 204 ECWAMGVH 211
             W +  H
Sbjct: 272 RSWCVAAH 279

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 44/91 (48%), Gaps = 6/91 (6%)

Query: 80  VSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSR 139
           V Y    D+  L+ +   D ++K+WD  +KS + T  GH + ++   F  +   +ISGS 
Sbjct: 190 VDYYPLQDKPYLITSS-DDRSVKIWDYQTKSCVATLEGHMANVSYAIFHPSLPIIISGSE 248

Query: 140 DSNIIVWDLVSEVGLYKL-RSHKDAISGIWC 169
           D  + +W+       YKL ++    +   WC
Sbjct: 249 DGTVKIWN----ANTYKLEKTLNLGLERSWC 275

 Score = 34.3 bits (77), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 38/83 (45%), Gaps = 12/83 (14%)

Query: 34  NSPGSVITSALENINIWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLA 93
           + P  + +S   ++ IWD +T   ++ L   +            A VSY  +H    ++ 
Sbjct: 197 DKPYLITSSDDRSVKIWDYQTKSCVATLEGHM------------ANVSYAIFHPSLPIII 244

Query: 94  AGYMDGTIKVWDLLSKSVLLTFN 116
           +G  DGT+K+W+  +  +  T N
Sbjct: 245 SGSEDGTVKIWNANTYKLEKTLN 267

>NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 103/230 (44%), Gaps = 22/230 (9%)

Query: 460 LLENKEDAHETAIWSLDITSDGRR--LVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMK 517
           +L    + H   + SL  TS G+   L++GS DKT+  W    ++         +     
Sbjct: 8   VLRGTLEGHNGWVTSL-ATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSH 66

Query: 518 LIHDTTMEVNEDVLSVRISPEDKFLAISL-LDNTVKVFYLDSMKFFLSLYGHKLPVLSID 576
           ++ D T+             +D   A+S   D T++++ + + + +    GHK  V+S+ 
Sbjct: 67  IVQDCTLT------------QDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVA 114

Query: 577 ISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHN-----FFSSSK 631
           I   + +II+ S DK IK+W +  G C  +L  H D +  V+  P   N       S+  
Sbjct: 115 IDRKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGN 173

Query: 632 DGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWE 681
           D +VK W+ ++F+       H   V ++  + DGT + SA  D  + +W 
Sbjct: 174 DKMVKAWNLNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWN 223

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 71/152 (46%), Gaps = 10/152 (6%)

Query: 86  HDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIV 145
            D    L+A + D T+++WD+ +      F GHKS +  +  D   + +ISGSRD  I V
Sbjct: 75  QDGAYALSASW-DKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKV 133

Query: 146 WDLVSEVGLYKLRSHKDAISGIWCEGEDW------LVSTSKDGLIKIWDLKVQQCIETHI 199
           W +  +  L  L  H D +S +     D       ++S   D ++K W+L   Q     +
Sbjct: 134 WTIKGQC-LATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIEADFV 192

Query: 200 AHTGECWAMGVHED--LLITSGADTQLKLWNL 229
            H G    +    D  L+ ++G D ++ LWNL
Sbjct: 193 GHNGNVNTVTASPDGTLIASAGKDGEIMLWNL 224

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 90/203 (44%), Gaps = 23/203 (11%)

Query: 467 AHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEV 526
            H   +    +T DG   ++ S DKT++ W+    E     T  +++      H +    
Sbjct: 63  GHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGE-----TYQRFVG-----HKS---- 108

Query: 527 NEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGH-----KLPVLSIDISFDS 581
             DV+SV I  +   +     D T+KV+ +   +   +L GH     ++ +   D + DS
Sbjct: 109 --DVMSVAIDRKASMIISGSRDKTIKVWTIKG-QCLATLLGHNDWVSQVRIAPTDQNDDS 165

Query: 582 KLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGD 641
             +I++  DK +K W L+          H  ++  V   P+     S+ KDG +  W+  
Sbjct: 166 VTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNLA 225

Query: 642 KFECIQKLAAHQSEVWSIAITSD 664
           + + +  L+A Q EV+++A + +
Sbjct: 226 EKKAMYTLSA-QDEVFALAFSPN 247

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 63/139 (45%), Gaps = 9/139 (6%)

Query: 557 DSMKFFL---SLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDS 613
           D  KF +   S  GH   V    ++ D    +++S DK +++W +  G+ ++    H+  
Sbjct: 50  DDQKFGVPVRSFKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSD 109

Query: 614 IMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITS-----DGTSV 668
           +M+V    ++    S S+D  +K W   K +C+  L  H   V  + I       D  +V
Sbjct: 110 VMSVAIDRKASMIISGSRDKTIKVWT-IKGQCLATLLGHNDWVSQVRIAPTDQNDDSVTV 168

Query: 669 ISASHDHSLRVWEETDDQV 687
           ISA +D  ++ W     Q+
Sbjct: 169 ISAGNDKMVKAWNLNQFQI 187

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 72/164 (43%), Gaps = 19/164 (11%)

Query: 88  ETNLLAAGYMDGTIKVWDLLSKS-----VLLTFNGHKSAITVMKFDVTGTRLISGSRDSN 142
           + NLL +G  D T+  W L          + +F GH   +        G   +S S D  
Sbjct: 29  QPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTQDGAYALSASWDKT 88

Query: 143 IIVWDLVSEVGLYKLRSHK-DAISGIWCEGEDWLVSTSKDGLIKIWDLKVQQCIETHIAH 201
           + +WD+ +     +   HK D +S         ++S S+D  IK+W +K  QC+ T + H
Sbjct: 89  LRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIK-GQCLATLLGH 147

Query: 202 TGECWAMGV-------HED--LLITSGADTQLKLWNLD-FSKEA 235
               W   V       ++D   +I++G D  +K WNL+ F  EA
Sbjct: 148 ND--WVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIEA 189

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 51/110 (46%), Gaps = 2/110 (1%)

Query: 87  DETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVW 146
           D   +++AG  D  +K W+L    +   F GH   +  +     GT + S  +D  I++W
Sbjct: 164 DSVTVISAGN-DKMVKAWNLNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLW 222

Query: 147 DLVSEVGLYKLRSHKDAISGIWCEGEDWLVSTSKDGLIKIWDLKVQQCIE 196
           +L  +  +Y L +  +  +  +     WL + +  G IKI+ L  Q  ++
Sbjct: 223 NLAEKKAMYTLSAQDEVFALAFSPNRYWLAAATASG-IKIFCLDPQSLVD 271

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 55/275 (20%), Positives = 115/275 (41%), Gaps = 46/275 (16%)

Query: 385 GHRTDIRSVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFDCGY---ALTCKFLPGGTL 440
           GH   ++   ++ D     +AS +  L++W++ T    + F  G+    ++       ++
Sbjct: 63  GHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRF-VGHKSDVMSVAIDRKASM 121

Query: 441 VIVGTREGSLQLFDLAS---STLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWN 497
           +I G+R+ +++++ +     +TLL + +   +  I   D   D   +++   DK +K WN
Sbjct: 122 IISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWN 181

Query: 498 ---FQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVF 554
              FQ+E D V              H      N +V +V  SP+   +A +  D  + ++
Sbjct: 182 LNQFQIEADFVG-------------H------NGNVNTVTASPDGTLIASAGKDGEIMLW 222

Query: 555 YLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLD-----------FGDC 603
            L   K   +L      V ++  S +   +  ++A   IKI+ LD           F   
Sbjct: 223 NLAEKKAMYTLSAQD-EVFALAFSPNRYWLAAATA-SGIKIFCLDPQSLVDDLRPEFAGY 280

Query: 604 HKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYW 638
           +KS   H    +++ +  +    F+   D +++ W
Sbjct: 281 NKSAEPHA---VSLAWSADGQTLFAGYTDSVIRVW 312

>NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 bp,
           318 aa] {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 103/230 (44%), Gaps = 22/230 (9%)

Query: 460 LLENKEDAHETAIWSLDITSDGRR--LVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMK 517
           +L    + H   + SL  TS G+   L++GS DKT+  W    ++         +     
Sbjct: 8   VLRGTLEGHNGWVTSL-ATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSH 66

Query: 518 LIHDTTMEVNEDVLSVRISPEDKFLAISL-LDNTVKVFYLDSMKFFLSLYGHKLPVLSID 576
           ++ D T+             +D   A+S   D T++++ + + + +    GHK  V+S+ 
Sbjct: 67  IVQDCTLT------------QDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVA 114

Query: 577 ISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHN-----FFSSSK 631
           I   + +II+ S DK IK+W +  G C  +L  H D +  V+  P   N       S+  
Sbjct: 115 IDRKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGN 173

Query: 632 DGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWE 681
           D +VK W+ ++F+       H   V ++  + DGT + SA  D  + +W 
Sbjct: 174 DKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLWN 223

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 72/152 (47%), Gaps = 10/152 (6%)

Query: 86  HDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIV 145
            D    L+A + D T+++WD+ +      F GHKS +  +  D   + +ISGSRD  I V
Sbjct: 75  QDGAYALSASW-DKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKV 133

Query: 146 WDLVSEVGLYKLRSHKDAISGIWCEGEDW------LVSTSKDGLIKIWDLKVQQCIETHI 199
           W +  +  L  L  H D +S +     D       ++S   D ++K W+L   Q     +
Sbjct: 134 WTIKGQC-LATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADFV 192

Query: 200 AHTGECWAMGVHED--LLITSGADTQLKLWNL 229
            H G   A+    D  L+ ++G D ++ LWNL
Sbjct: 193 GHNGNVNAVTASPDGTLIASAGKDGEIMLWNL 224

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 63/139 (45%), Gaps = 9/139 (6%)

Query: 557 DSMKFFL---SLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDS 613
           D  KF +   S  GH   V    ++ D    +++S DK +++W +  G+ ++    H+  
Sbjct: 50  DDQKFGVPVRSFKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSD 109

Query: 614 IMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITS-----DGTSV 668
           +M+V    ++    S S+D  +K W   K +C+  L  H   V  + I       D  +V
Sbjct: 110 VMSVAIDRKASMIISGSRDKTIKVWT-IKGQCLATLLGHNDWVSQVRIAPTDQNDDAVTV 168

Query: 669 ISASHDHSLRVWEETDDQV 687
           ISA +D  ++ W     Q+
Sbjct: 169 ISAGNDKMVKAWNLNQFQI 187

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 90/203 (44%), Gaps = 23/203 (11%)

Query: 467 AHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEV 526
            H   +    +T DG   ++ S DKT++ W+    E     T  +++      H +    
Sbjct: 63  GHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGE-----TYQRFVG-----HKS---- 108

Query: 527 NEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGH-----KLPVLSIDISFDS 581
             DV+SV I  +   +     D T+KV+ +   +   +L GH     ++ +   D + D+
Sbjct: 109 --DVMSVAIDRKASMIISGSRDKTIKVWTIKG-QCLATLLGHNDWVSQVRIAPTDQNDDA 165

Query: 582 KLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGD 641
             +I++  DK +K W L+          H  ++  V   P+     S+ KDG +  W+  
Sbjct: 166 VTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLWNLA 225

Query: 642 KFECIQKLAAHQSEVWSIAITSD 664
           + + +  L+A Q EV+S+A + +
Sbjct: 226 EKKAMYTLSA-QDEVFSLAFSPN 247

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 72/164 (43%), Gaps = 19/164 (11%)

Query: 88  ETNLLAAGYMDGTIKVWDLLSKS-----VLLTFNGHKSAITVMKFDVTGTRLISGSRDSN 142
           + NLL +G  D T+  W L          + +F GH   +        G   +S S D  
Sbjct: 29  QPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTQDGAYALSASWDKT 88

Query: 143 IIVWDLVSEVGLYKLRSHK-DAISGIWCEGEDWLVSTSKDGLIKIWDLKVQQCIETHIAH 201
           + +WD+ +     +   HK D +S         ++S S+D  IK+W +K  QC+ T + H
Sbjct: 89  LRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIK-GQCLATLLGH 147

Query: 202 TGECWAMGV-------HEDL--LITSGADTQLKLWNLD-FSKEA 235
               W   V       ++D   +I++G D  +K WNL+ F  EA
Sbjct: 148 ND--WVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEA 189

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 51/110 (46%), Gaps = 2/110 (1%)

Query: 87  DETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVW 146
           D   +++AG  D  +K W+L    +   F GH   +  +     GT + S  +D  I++W
Sbjct: 164 DAVTVISAGN-DKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLW 222

Query: 147 DLVSEVGLYKLRSHKDAISGIWCEGEDWLVSTSKDGLIKIWDLKVQQCIE 196
           +L  +  +Y L +  +  S  +     WL + +  G IKI+ L  Q  I+
Sbjct: 223 NLAEKKAMYTLSAQDEVFSLAFSPNRYWLAAATASG-IKIFCLDPQSLID 271

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 56/275 (20%), Positives = 115/275 (41%), Gaps = 46/275 (16%)

Query: 385 GHRTDIRSVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFDCGY---ALTCKFLPGGTL 440
           GH   ++   ++ D     +AS +  L++W++ T    + F  G+    ++       ++
Sbjct: 63  GHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRF-VGHKSDVMSVAIDRKASM 121

Query: 441 VIVGTREGSLQLFDLAS---STLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWN 497
           +I G+R+ +++++ +     +TLL + +   +  I   D   D   +++   DK +K WN
Sbjct: 122 IISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWN 181

Query: 498 ---FQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVF 554
              FQ+E D V              H      N +V +V  SP+   +A +  D  + ++
Sbjct: 182 LNQFQIEADFVG-------------H------NGNVNAVTASPDGTLIASAGKDGEIMLW 222

Query: 555 YLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLD-----------FGDC 603
            L   K   +L      V S+  S +   +  ++A   IKI+ LD           F   
Sbjct: 223 NLAEKKAMYTLSAQD-EVFSLAFSPNRYWLAAATA-SGIKIFCLDPQSLIDDLRPEFAGY 280

Query: 604 HKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYW 638
           +KS   H    +++ +  +    F+   D +++ W
Sbjct: 281 NKSAEPHA---VSLAWSADGQTLFAGYTDSVIRVW 312

>ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 104/231 (45%), Gaps = 17/231 (7%)

Query: 371 TSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFDCGYA 429
           T+P P         GHR ++ SV    D+K +AT+S +G +KVW+++  +  R +     
Sbjct: 63  TNPNPV----ASFEGHRGNVTSVSFQQDNKWMATSSEDGTIKVWDVRAPSIPRNYKLNAP 118

Query: 430 LTCKFL-PGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGS 488
           +    + P    +I   R+G ++++DL  +          +T + SL + SDG  LV  +
Sbjct: 119 VNEVVIHPNQGELISCDRDGHIRIWDLGENQCTHQLTPEDDTPLQSLSLASDGSMLVAAN 178

Query: 489 ADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLD 548
                  W      D     A    PV K     T      +  + +S + K LA    D
Sbjct: 179 NKGNCYVWEMPNRTD-----ASNLKPVTKFRSHNTY-----ITRILLSSDVKHLATCSAD 228

Query: 549 NTVKVFYLD-SMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGL 598
           +T +V+ +D + K   +L GH+  V     S DS  ++T+S+D  +++W L
Sbjct: 229 HTARVWSVDDNFKLETTLDGHQRWVWDCAFSADSAYLMTASSDHYVRLWDL 279

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 90/201 (44%), Gaps = 21/201 (10%)

Query: 484 LVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLA 543
           LV+   D TI+FW      + + G   +          T    +  V  + I+ + K LA
Sbjct: 5   LVSAGYDHTIRFW------EALTGVCSR----------TIQHSDSQVNRLEITNDKKLLA 48

Query: 544 ISLLDNTVKVFYLDSMKF--FLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFG 601
            +   N V+++ + +       S  GH+  V S+    D+K + TSS D  IK+W +   
Sbjct: 49  AAGHQN-VRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNKWMATSSEDGTIKVWDVRAP 107

Query: 602 DCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAH-QSEVWSIA 660
              ++ +     +  V   P      S  +DG ++ WD  + +C  +L     + + S++
Sbjct: 108 SIPRN-YKLNAPVNEVVIHPNQGELISCDRDGHIRIWDLGENQCTHQLTPEDDTPLQSLS 166

Query: 661 ITSDGTSVISASHDHSLRVWE 681
           + SDG+ +++A++  +  VWE
Sbjct: 167 LASDGSMLVAANNKGNCYVWE 187

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/224 (20%), Positives = 88/224 (39%), Gaps = 25/224 (11%)

Query: 466 DAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTME 525
           + H   + S+    D + + T S D TIK W+ +      P     Y            +
Sbjct: 72  EGHRGNVTSVSFQQDNKWMATSSEDGTIKVWDVRA-----PSIPRNY------------K 114

Query: 526 VNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHK-LPVLSIDISFDSKLI 584
           +N  V  V I P    L     D  ++++ L   +    L      P+ S+ ++ D  ++
Sbjct: 115 LNAPVNEVVIHPNQGELISCDRDGHIRIWDLGENQCTHQLTPEDDTPLQSLSLASDGSML 174

Query: 585 ITSSADKNIKIWGLDFGDCHKSL------FAHQDSIMNVKFLPESHNFFSSSKDGLVKYW 638
           + ++   N  +W +       +L       +H   I  +    +  +  + S D   + W
Sbjct: 175 VAANNKGNCYVWEMPNRTDASNLKPVTKFRSHNTYITRILLSSDVKHLATCSADHTARVW 234

Query: 639 D-GDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWE 681
              D F+    L  HQ  VW  A ++D   +++AS DH +R+W+
Sbjct: 235 SVDDNFKLETTLDGHQRWVWDCAFSADSAYLMTASSDHYVRLWD 278

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 73/164 (44%), Gaps = 8/164 (4%)

Query: 529 DVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSS 588
           +V SV    ++K++A S  D T+KV+ + +     + Y    PV  + I  +   +I+  
Sbjct: 77  NVTSVSFQQDNKWMATSSEDGTIKVWDVRAPSIPRN-YKLNAPVNEVVIHPNQGELISCD 135

Query: 589 ADKNIKIWGLDFGDCHKSLFAHQDS-IMNVKFLPESHNFFSSSKDGLVKYW------DGD 641
            D +I+IW L    C   L    D+ + ++    +     +++  G    W      D  
Sbjct: 136 RDGHIRIWDLGENQCTHQLTPEDDTPLQSLSLASDGSMLVAANNKGNCYVWEMPNRTDAS 195

Query: 642 KFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWEETDD 685
             + + K  +H + +  I ++SD   + + S DH+ RVW   D+
Sbjct: 196 NLKPVTKFRSHNTYITRILLSSDVKHLATCSADHTARVWSVDDN 239

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 59/112 (52%), Gaps = 8/112 (7%)

Query: 87  DETNLLAAGYMDGTIKVWDLLS--KSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNII 144
           D+  L AAG+ +  ++++D+ +   + + +F GH+  +T + F      + + S D  I 
Sbjct: 43  DKKLLAAAGHQN--VRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNKWMATSSEDGTIK 100

Query: 145 VWDLVSE--VGLYKLRSHKDAISGIWCEGEDWLVSTSKDGLIKIWDLKVQQC 194
           VWD+ +      YKL +  + +     +GE  L+S  +DG I+IWDL   QC
Sbjct: 101 VWDVRAPSIPRNYKLNAPVNEVVIHPNQGE--LISCDRDGHIRIWDLGENQC 150

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/233 (20%), Positives = 94/233 (40%), Gaps = 18/233 (7%)

Query: 9   EQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISVLSDGLPAG 68
           +   ++ + +TN N     P +      G+V + + +  N W   + E  ++    + A 
Sbjct: 53  QNVRLYDIRTTNPN-----PVASFEGHRGNVTSVSFQQDNKWMATSSEDGTIKVWDVRAP 107

Query: 69  SIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGH-KSAITVMKF 127
           SI       A V+ +  H     L +   DG I++WDL              + +  +  
Sbjct: 108 SIPRNYKLNAPVNEVVIHPNQGELISCDRDGHIRIWDLGENQCTHQLTPEDDTPLQSLSL 167

Query: 128 DVTGTRLISGSRDSNIIVWDLVSEVG------LYKLRSHKDAISGIWCEGE-DWLVSTSK 180
              G+ L++ +   N  VW++ +         + K RSH   I+ I    +   L + S 
Sbjct: 168 ASDGSMLVAANNKGNCYVWEMPNRTDASNLKPVTKFRSHNTYITRILLSSDVKHLATCSA 227

Query: 181 DGLIKIW----DLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNL 229
           D   ++W    + K++  ++ H     +C A       L+T+ +D  ++LW+L
Sbjct: 228 DHTARVWSVDDNFKLETTLDGHQRWVWDC-AFSADSAYLMTASSDHYVRLWDL 279

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 25/128 (19%), Positives = 54/128 (42%), Gaps = 9/128 (7%)

Query: 384 PGHRTDIRSVDISDDDKLLATASN-GLLKVWNLKTKA------CIRVFDCGYALTCKFLP 436
           P   T ++S+ ++ D  +L  A+N G   VW +  +        +  F        + L 
Sbjct: 156 PEDDTPLQSLSLASDGSMLVAANNKGNCYVWEMPNRTDASNLKPVTKFRSHNTYITRILL 215

Query: 437 GGTLVIVGT--REGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIK 494
              +  + T   + + +++ +  +  LE   D H+  +W    ++D   L+T S+D  ++
Sbjct: 216 SSDVKHLATCSADHTARVWSVDDNFKLETTLDGHQRWVWDCAFSADSAYLMTASSDHYVR 275

Query: 495 FWNFQVEE 502
            W+    E
Sbjct: 276 LWDLSTRE 283

>Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 64/271 (23%), Positives = 121/271 (44%), Gaps = 23/271 (8%)

Query: 331 QYKIKSVSFTTVSNTKLEFVVTTSSNSIEYYSIPYEKRDPTSPAPTRLYTIELPGHRTDI 390
           Q+    V+   ++N K + + T    ++  Y I       T+P P         GHR ++
Sbjct: 29  QHSDSQVNRLEITNDK-KLLATAGHQNVRLYDI-----RTTNPNPV----ASFEGHRGNV 78

Query: 391 RSVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFDCGYALTCKFL-PGGTLVIVGTREG 448
            SV    D++ + T+S +G +KVW++++ +  R +     +    + P    +I   R+G
Sbjct: 79  TSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDG 138

Query: 449 SLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGT 508
           +++++DL  +          +T++ SL + SDG  L   ++      W      D     
Sbjct: 139 NIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPNHTD----- 193

Query: 509 ADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYL-DSMKFFLSLYG 567
           A    PV K    +T      +  + +S + K LA    D+T +V+ + D  K   +L G
Sbjct: 194 ASHLKPVTKFRAHSTY-----ITRILLSSDVKHLATCSADHTARVWSIEDDFKLETTLDG 248

Query: 568 HKLPVLSIDISFDSKLIITSSADKNIKIWGL 598
           H+  V     S DS  ++T+S+D  +++W L
Sbjct: 249 HQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 90/201 (44%), Gaps = 21/201 (10%)

Query: 484 LVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLA 543
           LV+   D TI+FW      + + G   +          T    +  V  + I+ + K LA
Sbjct: 5   LVSAGYDHTIRFW------EALTGVCSR----------TIQHSDSQVNRLEITNDKKLLA 48

Query: 544 ISLLDNTVKVFYLDSMKF--FLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFG 601
            +   N V+++ + +       S  GH+  V S+    D++ ++TSS D  IK+W +   
Sbjct: 49  TAGHQN-VRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSP 107

Query: 602 DCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAH-QSEVWSIA 660
              ++ + H   +  V   P      S  +DG ++ WD  + +C  +L     + + S++
Sbjct: 108 SIPRN-YKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLS 166

Query: 661 ITSDGTSVISASHDHSLRVWE 681
           + SDG+ + +A+   +  VWE
Sbjct: 167 MASDGSMLAAANSKGNCYVWE 187

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 73/164 (44%), Gaps = 8/164 (4%)

Query: 529 DVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSS 588
           +V SV    +++++  S  D T+KV+ + S     + Y H  PV  + I  +   +I+  
Sbjct: 77  NVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRN-YKHNAPVNEVVIHPNQGELISCD 135

Query: 589 ADKNIKIWGLDFGDCHKSLFAHQD-SIMNVKFLPESHNFFSSSKDGLVKYW------DGD 641
            D NI+IW L    C   L    D S+ ++    +     +++  G    W      D  
Sbjct: 136 RDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPNHTDAS 195

Query: 642 KFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWEETDD 685
             + + K  AH + +  I ++SD   + + S DH+ RVW   DD
Sbjct: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIEDD 239

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 56/304 (18%), Positives = 121/304 (39%), Gaps = 68/304 (22%)

Query: 388 TDIRSVDISDDDKLLATASNGLLKVWNLKT--KACIRVFDC--GYALTCKFLPGGTLVIV 443
           + +  ++I++D KLLATA +  +++++++T     +  F+   G   +  F      ++ 
Sbjct: 33  SQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVT 92

Query: 444 GTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEED 503
            + +G+++++D+ S ++  N +  H   +  + I  +   L++   D  I+ W+      
Sbjct: 93  SSEDGTIKVWDVRSPSIPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWD------ 144

Query: 504 LVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDS----- 558
                    L   +  H  T E +  + S+ ++ +   LA +       V+ + +     
Sbjct: 145 ---------LGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPNHTDAS 195

Query: 559 -MKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNV 617
            +K       H   +  I +S D K + T SAD   ++W ++                  
Sbjct: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIE------------------ 237

Query: 618 KFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSL 677
                                  D F+    L  HQ  VW  A ++D   +++AS DH +
Sbjct: 238 -----------------------DDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYV 274

Query: 678 RVWE 681
           R+W+
Sbjct: 275 RLWD 278

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 66/123 (53%), Gaps = 11/123 (8%)

Query: 78  AEVSYLHYHDETNLLA-AGYMDGTIKVWDLLS--KSVLLTFNGHKSAITVMKFDVTGTRL 134
           ++V+ L   ++  LLA AG+ +  ++++D+ +   + + +F GH+  +T + F      +
Sbjct: 33  SQVNRLEITNDKKLLATAGHQN--VRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWM 90

Query: 135 ISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWC---EGEDWLVSTSKDGLIKIWDLKV 191
           ++ S D  I VWD+ S   + +   H   ++ +     +GE  L+S  +DG I+IWDL  
Sbjct: 91  VTSSEDGTIKVWDVRSP-SIPRNYKHNAPVNEVVIHPNQGE--LISCDRDGNIRIWDLGE 147

Query: 192 QQC 194
            QC
Sbjct: 148 NQC 150

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 53/122 (43%), Gaps = 11/122 (9%)

Query: 41  TSALENINIWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGT 100
           T+  +N+ ++DI+T       ++  P  S +        VS+     +   +     DGT
Sbjct: 49  TAGHQNVRLYDIRT-------TNPNPVASFEGHRGNVTSVSF---QQDNRWMVTSSEDGT 98

Query: 101 IKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSH 160
           IKVWD+ S S+   +  H + +  +        LIS  RD NI +WDL      ++L   
Sbjct: 99  IKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPE 157

Query: 161 KD 162
            D
Sbjct: 158 DD 159

 Score = 34.7 bits (78), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 27/128 (21%), Positives = 52/128 (40%), Gaps = 9/128 (7%)

Query: 384 PGHRTDIRSVDISDDDKLLATA-SNGLLKVWNLKTKA------CIRVFDCGYALTCKFLP 436
           P   T ++S+ ++ D  +LA A S G   VW +           +  F        + L 
Sbjct: 156 PEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILL 215

Query: 437 GGTLVIVGT--REGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIK 494
              +  + T   + + +++ +     LE   D H+  +W    ++D   LVT S+D  ++
Sbjct: 216 SSDVKHLATCSADHTARVWSIEDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVR 275

Query: 495 FWNFQVEE 502
            W+    E
Sbjct: 276 LWDLSTRE 283

>Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score = 76.3 bits (186), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 64/271 (23%), Positives = 121/271 (44%), Gaps = 23/271 (8%)

Query: 331 QYKIKSVSFTTVSNTKLEFVVTTSSNSIEYYSIPYEKRDPTSPAPTRLYTIELPGHRTDI 390
           Q+    V+   ++N K + + T    ++  Y I       T+P P         GHR ++
Sbjct: 29  QHSDSQVNRLEITNDK-KLLATAGHQNVRLYDIR-----TTNPNPV----ASFEGHRGNV 78

Query: 391 RSVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFDCGYALTCKFL-PGGTLVIVGTREG 448
            SV    D++ + T+S +G +KVW++++ +  R +     +    + P    +I   R+G
Sbjct: 79  TSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDG 138

Query: 449 SLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGT 508
           +++++DL  +          +T++ SL + SDG  L   ++      W      D     
Sbjct: 139 NIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPNRTD----- 193

Query: 509 ADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDS-MKFFLSLYG 567
           A    PV K    +T      +  + +S + K LA    D+T +V+ +D   K   +L G
Sbjct: 194 ASHLKPVTKFRAHSTY-----ITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDG 248

Query: 568 HKLPVLSIDISFDSKLIITSSADKNIKIWGL 598
           H+  V     S DS  ++T+S+D  +++W L
Sbjct: 249 HQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 90/201 (44%), Gaps = 21/201 (10%)

Query: 484 LVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLA 543
           LV+   D TI+FW      + + G   +          T    +  V  + I+ + K LA
Sbjct: 5   LVSAGYDHTIRFW------EALTGVCSR----------TIQHSDSQVNRLEITNDKKLLA 48

Query: 544 ISLLDNTVKVFYLDSMKF--FLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFG 601
            +   N V+++ + +       S  GH+  V S+    D++ ++TSS D  IK+W +   
Sbjct: 49  TAGHQN-VRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSP 107

Query: 602 DCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAH-QSEVWSIA 660
              ++ + H   +  V   P      S  +DG ++ WD  + +C  +L     + + S++
Sbjct: 108 SIPRN-YKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLS 166

Query: 661 ITSDGTSVISASHDHSLRVWE 681
           + SDG+ + +A+   +  VWE
Sbjct: 167 MASDGSMLAAANSKGNCYVWE 187

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 73/164 (44%), Gaps = 8/164 (4%)

Query: 529 DVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSS 588
           +V SV    +++++  S  D T+KV+ + S     + Y H  PV  + I  +   +I+  
Sbjct: 77  NVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRN-YKHNAPVNEVVIHPNQGELISCD 135

Query: 589 ADKNIKIWGLDFGDCHKSLFAHQD-SIMNVKFLPESHNFFSSSKDGLVKYW------DGD 641
            D NI+IW L    C   L    D S+ ++    +     +++  G    W      D  
Sbjct: 136 RDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPNRTDAS 195

Query: 642 KFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWEETDD 685
             + + K  AH + +  I ++SD   + + S DH+ RVW   DD
Sbjct: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/304 (18%), Positives = 121/304 (39%), Gaps = 68/304 (22%)

Query: 388 TDIRSVDISDDDKLLATASNGLLKVWNLKT--KACIRVFDC--GYALTCKFLPGGTLVIV 443
           + +  ++I++D KLLATA +  +++++++T     +  F+   G   +  F      ++ 
Sbjct: 33  SQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVT 92

Query: 444 GTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEED 503
            + +G+++++D+ S ++  N +  H   +  + I  +   L++   D  I+ W+      
Sbjct: 93  SSEDGTIKVWDVRSPSIPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWD------ 144

Query: 504 LVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDS----- 558
                    L   +  H  T E +  + S+ ++ +   LA +       V+ + +     
Sbjct: 145 ---------LGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPNRTDAS 195

Query: 559 -MKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNV 617
            +K       H   +  I +S D K + T SAD   ++W +D                  
Sbjct: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSID------------------ 237

Query: 618 KFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSL 677
                                  D F+    L  HQ  VW  A ++D   +++AS DH +
Sbjct: 238 -----------------------DDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYV 274

Query: 678 RVWE 681
           R+W+
Sbjct: 275 RLWD 278

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 66/123 (53%), Gaps = 11/123 (8%)

Query: 78  AEVSYLHYHDETNLLA-AGYMDGTIKVWDLLS--KSVLLTFNGHKSAITVMKFDVTGTRL 134
           ++V+ L   ++  LLA AG+ +  ++++D+ +   + + +F GH+  +T + F      +
Sbjct: 33  SQVNRLEITNDKKLLATAGHQN--VRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWM 90

Query: 135 ISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWC---EGEDWLVSTSKDGLIKIWDLKV 191
           ++ S D  I VWD+ S   + +   H   ++ +     +GE  L+S  +DG I+IWDL  
Sbjct: 91  VTSSEDGTIKVWDVRSP-SIPRNYKHNAPVNEVVIHPNQGE--LISCDRDGNIRIWDLGE 147

Query: 192 QQC 194
            QC
Sbjct: 148 NQC 150

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 53/122 (43%), Gaps = 11/122 (9%)

Query: 41  TSALENINIWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGT 100
           T+  +N+ ++DI+T       ++  P  S +        VS+     +   +     DGT
Sbjct: 49  TAGHQNVRLYDIRT-------TNPNPVASFEGHRGNVTSVSF---QQDNRWMVTSSEDGT 98

Query: 101 IKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSH 160
           IKVWD+ S S+   +  H + +  +        LIS  RD NI +WDL      ++L   
Sbjct: 99  IKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPE 157

Query: 161 KD 162
            D
Sbjct: 158 DD 159

 Score = 35.4 bits (80), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 27/128 (21%), Positives = 53/128 (41%), Gaps = 9/128 (7%)

Query: 384 PGHRTDIRSVDISDDDKLLATA-SNGLLKVWNLKTKA------CIRVFDCGYALTCKFLP 436
           P   T ++S+ ++ D  +LA A S G   VW +  +        +  F        + L 
Sbjct: 156 PEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPNRTDASHLKPVTKFRAHSTYITRILL 215

Query: 437 GGTLVIVGT--REGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIK 494
              +  + T   + + +++ +     LE   D H+  +W    ++D   LVT S+D  ++
Sbjct: 216 SSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVR 275

Query: 495 FWNFQVEE 502
            W+    E
Sbjct: 276 LWDLSTRE 283

>Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa]
           {ON} complement(166721..169273) [2553 nt, 851 aa]
          Length = 850

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 48/217 (22%), Positives = 98/217 (45%), Gaps = 18/217 (8%)

Query: 467 AHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEV 526
            H   ++S   ++    L++ S DKT++ W+ Q ++ LV     +               
Sbjct: 572 GHSGTVYSTSFSAGDEYLLSASEDKTVRLWSVQDDKPLVSYKGHE--------------- 616

Query: 527 NEDVLSVRISPE-DKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLII 585
            + V  V  SP  +   A +  D T +++  D +     + GH   V  +    + + I 
Sbjct: 617 -KPVWDVEFSPSCNNLFATASNDQTARLWSCDRVYPLRVMAGHLNDVDCVSFHSNGRYIF 675

Query: 586 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFEC 645
           T S+DK +++W ++ GD  +    H  ++ ++   P+     + S DG++  WD      
Sbjct: 676 TGSSDKTVRMWDINTGDSVRLFMGHNSTVTSLSVSPDGKWISTGSDDGIITIWDIGSGRK 735

Query: 646 IQKLAAH-QSEVWSIAITSDGTSVISASHDHSLRVWE 681
           ++ +  H +S + S++   +GT ++S   D S+RVW+
Sbjct: 736 LKNMRGHGKSSIHSLSYNPEGTLLVSGGADQSVRVWD 772

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 95/213 (44%), Gaps = 11/213 (5%)

Query: 474 SLDITSDGRRLVTGSADKTIKFWNFQ----VEEDLVPGTADKYLPVMKLIHDTTMEVNED 529
           SL+ +++ +   +G  D  IK W+       E D +P           + H  T      
Sbjct: 523 SLEFSNNYKLAASGFQDSYIKIWSLDGYPLSENDEMPNNPISSTCKTFIGHSGT------ 576

Query: 530 VLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFD-SKLIITSS 588
           V S   S  D++L  +  D TV+++ +   K  +S  GH+ PV  ++ S   + L  T+S
Sbjct: 577 VYSTSFSAGDEYLLSASEDKTVRLWSVQDDKPLVSYKGHEKPVWDVEFSPSCNNLFATAS 636

Query: 589 ADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQK 648
            D+  ++W  D     + +  H + +  V F       F+ S D  V+ WD +  + ++ 
Sbjct: 637 NDQTARLWSCDRVYPLRVMAGHLNDVDCVSFHSNGRYIFTGSSDKTVRMWDINTGDSVRL 696

Query: 649 LAAHQSEVWSIAITSDGTSVISASHDHSLRVWE 681
              H S V S++++ DG  + + S D  + +W+
Sbjct: 697 FMGHNSTVTSLSVSPDGKWISTGSDDGIITIWD 729

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 65/145 (44%), Gaps = 4/145 (2%)

Query: 90  NLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLV 149
           NL A    D T ++W       L    GH + +  + F   G  + +GS D  + +WD+ 
Sbjct: 630 NLFATASNDQTARLWSCDRVYPLRVMAGHLNDVDCVSFHSNGRYIFTGSSDKTVRMWDIN 689

Query: 150 SEVGLYKLRSHKDAISGIWCEGE-DWLVSTSKDGLIKIWDLKVQQCIETHIAH---TGEC 205
           +   +     H   ++ +    +  W+ + S DG+I IWD+   + ++    H   +   
Sbjct: 690 TGDSVRLFMGHNSTVTSLSVSPDGKWISTGSDDGIITIWDIGSGRKLKNMRGHGKSSIHS 749

Query: 206 WAMGVHEDLLITSGADTQLKLWNLD 230
            +      LL++ GAD  +++W+L+
Sbjct: 750 LSYNPEGTLLVSGGADQSVRVWDLN 774

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 71/138 (51%), Gaps = 9/138 (6%)

Query: 377 RLYTIE-LPGHRTDIRSVDISDDDKLLAT-ASNGLLKVWNLKTKACIRVFDCGYALTCKF 434
           R+Y +  + GH  D+  V    + + + T +S+  +++W++ T   +R+F  G+  T   
Sbjct: 648 RVYPLRVMAGHLNDVDCVSFHSNGRYIFTGSSDKTVRMWDINTGDSVRLF-MGHNSTVTS 706

Query: 435 L---PGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADK 491
           L   P G  +  G+ +G + ++D+ S   L+N     +++I SL    +G  LV+G AD+
Sbjct: 707 LSVSPDGKWISTGSDDGIITIWDIGSGRKLKNMRGHGKSSIHSLSYNPEGTLLVSGGADQ 766

Query: 492 TIKFWNFQ---VEEDLVP 506
           +++ W+      E  L P
Sbjct: 767 SVRVWDLNKGTFEPSLTP 784

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 55/113 (48%), Gaps = 2/113 (1%)

Query: 79  EVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGS 138
           +V  + +H     +  G  D T+++WD+ +   +  F GH S +T +     G  + +GS
Sbjct: 661 DVDCVSFHSNGRYIFTGSSDKTVRMWDINTGDSVRLFMGHNSTVTSLSVSPDGKWISTGS 720

Query: 139 RDSNIIVWDLVSEVGLYKLRSH-KDAISGIWCEGED-WLVSTSKDGLIKIWDL 189
            D  I +WD+ S   L  +R H K +I  +    E   LVS   D  +++WDL
Sbjct: 721 DDGIITIWDIGSGRKLKNMRGHGKSSIHSLSYNPEGTLLVSGGADQSVRVWDL 773

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 61/276 (22%), Positives = 117/276 (42%), Gaps = 42/276 (15%)

Query: 389 DIRSVDISDDDKLLATA-SNGLLKVWNL--------------KTKACIRVF--DCGYALT 431
           ++ S++ S++ KL A+   +  +K+W+L                 +  + F    G   +
Sbjct: 520 NMTSLEFSNNYKLAASGFQDSYIKIWSLDGYPLSENDEMPNNPISSTCKTFIGHSGTVYS 579

Query: 432 CKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRL-VTGSAD 490
             F  G   ++  + + +++L+ +     L + +  HE  +W ++ +     L  T S D
Sbjct: 580 TSFSAGDEYLLSASEDKTVRLWSVQDDKPLVSYK-GHEKPVWDVEFSPSCNNLFATASND 638

Query: 491 KTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNT 550
           +T + W           + D+  P+  +          DV  V      +++     D T
Sbjct: 639 QTARLW-----------SCDRVYPLRVMAGHLN-----DVDCVSFHSNGRYIFTGSSDKT 682

Query: 551 VKVFYL---DSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSL 607
           V+++ +   DS++ F+   GH   V S+ +S D K I T S D  I IW +  G   K++
Sbjct: 683 VRMWDINTGDSVRLFM---GHNSTVTSLSVSPDGKWISTGSDDGIITIWDIGSGRKLKNM 739

Query: 608 FAH-QDSIMNVKFLPESHNFFSSSKDGLVKYWDGDK 642
             H + SI ++ + PE     S   D  V+ WD +K
Sbjct: 740 RGHGKSSIHSLSYNPEGTLLVSGGADQSVRVWDLNK 775

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 70/324 (21%), Positives = 134/324 (41%), Gaps = 56/324 (17%)

Query: 311 QNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSN-------------- 356
           Q  K + SS  M   QV      + SVS  T  NT+        SN              
Sbjct: 488 QKFKNATSSFSMDNLQV-----SLPSVSIYTFHNTQKNMTSLEFSNNYKLAASGFQDSYI 542

Query: 357 ---SIEYYSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATAS-NGLLKV 412
              S++ Y +      P +P  +   T    GH   + S   S  D+ L +AS +  +++
Sbjct: 543 KIWSLDGYPLSENDEMPNNPISSTCKT--FIGHSGTVYSTSFSAGDEYLLSASEDKTVRL 600

Query: 413 WNLKTKACI--------RVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENK 464
           W+++    +         V+D  ++ +C       L    + + + +L+       L   
Sbjct: 601 WSVQDDKPLVSYKGHEKPVWDVEFSPSC-----NNLFATASNDQTARLWSCDRVYPLRVM 655

Query: 465 EDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTM 524
              H   +  +   S+GR + TGS+DKT++ W+          T D     M   H++T 
Sbjct: 656 A-GHLNDVDCVSFHSNGRYIFTGSSDKTVRMWDIN--------TGDSVRLFMG--HNST- 703

Query: 525 EVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGH-KLPVLSIDISFDSKL 583
                V S+ +SP+ K+++    D  + ++ + S +   ++ GH K  + S+  + +  L
Sbjct: 704 -----VTSLSVSPDGKWISTGSDDGIITIWDIGSGRKLKNMRGHGKSSIHSLSYNPEGTL 758

Query: 584 IITSSADKNIKIWGLDFGDCHKSL 607
           +++  AD+++++W L+ G    SL
Sbjct: 759 LVSGGADQSVRVWDLNKGTFEPSL 782

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 53/108 (49%), Gaps = 13/108 (12%)

Query: 42  SALENINIWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTI 101
           S+ + + +WDI TG+            S+ +     + V+ L    +   ++ G  DG I
Sbjct: 678 SSDKTVRMWDINTGD------------SVRLFMGHNSTVTSLSVSPDGKWISTGSDDGII 725

Query: 102 KVWDLLSKSVLLTFNGH-KSAITVMKFDVTGTRLISGSRDSNIIVWDL 148
            +WD+ S   L    GH KS+I  + ++  GT L+SG  D ++ VWDL
Sbjct: 726 TIWDIGSGRKLKNMRGHGKSSIHSLSYNPEGTLLVSGGADQSVRVWDL 773

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/184 (19%), Positives = 72/184 (39%), Gaps = 18/184 (9%)

Query: 65  LPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDL----LSK----------S 110
           LP+ SI    +    ++ L + +   L A+G+ D  IK+W L    LS+          S
Sbjct: 506 LPSVSIYTFHNTQKNMTSLEFSNNYKLAASGFQDSYIKIWSLDGYPLSENDEMPNNPISS 565

Query: 111 VLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCE 170
              TF GH   +    F      L+S S D  + +W +  +  L   + H+  +  +   
Sbjct: 566 TCKTFIGHSGTVYSTSFSAGDEYLLSASEDKTVRLWSVQDDKPLVSYKGHEKPVWDVEFS 625

Query: 171 G--EDWLVSTSKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHED--LLITSGADTQLKL 226
               +   + S D   ++W       +     H  +   +  H +   + T  +D  +++
Sbjct: 626 PSCNNLFATASNDQTARLWSCDRVYPLRVMAGHLNDVDCVSFHSNGRYIFTGSSDKTVRM 685

Query: 227 WNLD 230
           W+++
Sbjct: 686 WDIN 689

>TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 888
           aa] {ON} 
          Length = 888

 Score = 78.6 bits (192), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 73/287 (25%), Positives = 127/287 (44%), Gaps = 25/287 (8%)

Query: 401 LLATASNGLLKVWNLKTKACIRVFDCGYA--LTCKFLPGGTLVIVGTREGSLQLFDLASS 458
           +L T  +G +++WN +T+  +R          + +F+     ++VG+ +  +++F+  + 
Sbjct: 28  VLTTLYSGRIEIWNYETETEVRSIQVTETPVRSGRFIARKNWIVVGSDDFRIRIFNYNTG 87

Query: 459 TLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKL 518
             + + E AH   I S+ +      +++GS D T+K WN++    L              
Sbjct: 88  EKVSDFE-AHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWEKNWAL-------------- 132

Query: 519 IHDTTMEVNED-VLSVRISPEDK-FLAISLLDNTVKVFYL-DSMKFFLSLYGHKLPVLSI 575
             + T E +E  V+SV  +P+D    A   LD TVKV+ L  S   F    G +  V  +
Sbjct: 133 --EQTFEGHEHFVMSVAFNPKDPSTFASGCLDRTVKVWSLGQSSPNFTLTTGQEKGVNYV 190

Query: 576 DISF--DSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDG 633
           D     D   +ITSS D ++KIW      C  +L  H  ++    F P      S S+DG
Sbjct: 191 DYYPLPDKPYLITSSDDFSVKIWDYQTKSCVATLEGHMSNVSFAVFHPSLPIIVSGSEDG 250

Query: 634 LVKYWDGDKFECIQKLAAHQSEVWSIAITSDG-TSVISASHDHSLRV 679
            VK W    ++ ++ +       W +A    G  + I+A  D+   V
Sbjct: 251 TVKLWSSTTYKVLKTMNLGLERAWCVATHPTGKKNYIAAGFDNGFSV 297

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 80/190 (42%), Gaps = 20/190 (10%)

Query: 47  INIWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDL 106
           I I++  TGE +S               + P  +  +  H     + +G  D T+K+W+ 
Sbjct: 79  IRIFNYNTGEKVSDFE------------AHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNW 126

Query: 107 LSKSVL-LTFNGHKSAITVMKFDVTG-TRLISGSRDSNIIVWDLVSEVGLYKLRSHKDA- 163
                L  TF GH+  +  + F+    +   SG  D  + VW L      + L + ++  
Sbjct: 127 EKNWALEQTFEGHEHFVMSVAFNPKDPSTFASGCLDRTVKVWSLGQSSPNFTLTTGQEKG 186

Query: 164 ---ISGIWCEGEDWLVSTSKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDL-LITSG 219
              +       + +L+++S D  +KIWD + + C+ T   H         H  L +I SG
Sbjct: 187 VNYVDYYPLPDKPYLITSSDDFSVKIWDYQTKSCVATLEGHMSNVSFAVFHPSLPIIVSG 246

Query: 220 A-DTQLKLWN 228
           + D  +KLW+
Sbjct: 247 SEDGTVKLWS 256

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 56/124 (45%), Gaps = 4/124 (3%)

Query: 92  LAAGYMDGTIKVWDLLSKSVLLTFN-GHKSAITVMKFDVTGTR--LISGSRDSNIIVWDL 148
            A+G +D T+KVW L   S   T   G +  +  + +     +  LI+ S D ++ +WD 
Sbjct: 156 FASGCLDRTVKVWSLGQSSPNFTLTTGQEKGVNYVDYYPLPDKPYLITSSDDFSVKIWDY 215

Query: 149 VSEVGLYKLRSHKDAIS-GIWCEGEDWLVSTSKDGLIKIWDLKVQQCIETHIAHTGECWA 207
            ++  +  L  H   +S  ++      +VS S+DG +K+W     + ++T        W 
Sbjct: 216 QTKSCVATLEGHMSNVSFAVFHPSLPIIVSGSEDGTVKLWSSTTYKVLKTMNLGLERAWC 275

Query: 208 MGVH 211
           +  H
Sbjct: 276 VATH 279

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 72/168 (42%), Gaps = 3/168 (1%)

Query: 516 MKL-IHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLS 574
           MKL I  T    ++ V  +   P + ++  +L    ++++  ++     S+   + PV S
Sbjct: 1   MKLDITKTFTSRSDRVKGIDFHPVEPWVLTTLYSGRIEIWNYETETEVRSIQVTETPVRS 60

Query: 575 IDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGL 634
                    I+  S D  I+I+  + G+      AH D I ++   P      S S D  
Sbjct: 61  GRFIARKNWIVVGSDDFRIRIFNYNTGEKVSDFEAHPDYIRSIAVHPTKPYVLSGSDDLT 120

Query: 635 VKYWDGDK-FECIQKLAAHQSEVWSIAITS-DGTSVISASHDHSLRVW 680
           VK W+ +K +   Q    H+  V S+A    D ++  S   D +++VW
Sbjct: 121 VKLWNWEKNWALEQTFEGHEHFVMSVAFNPKDPSTFASGCLDRTVKVW 168

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 57/116 (49%), Gaps = 9/116 (7%)

Query: 58  ISVLSDGLPAGSIDVKSSKPAEVSYLHYH---DETNLLAAGYMDGTIKVWDLLSKSVLLT 114
           + V S G  + +  + + +   V+Y+ Y+   D+  L+ +   D ++K+WD  +KS + T
Sbjct: 165 VKVWSLGQSSPNFTLTTGQEKGVNYVDYYPLPDKPYLITSS-DDFSVKIWDYQTKSCVAT 223

Query: 115 FNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYK-LRSHKDAISGIWC 169
             GH S ++   F  +   ++SGS D  + +W   +    YK L++    +   WC
Sbjct: 224 LEGHMSNVSFAVFHPSLPIIVSGSEDGTVKLWSSTT----YKVLKTMNLGLERAWC 275

 Score = 32.0 bits (71), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 48/100 (48%), Gaps = 7/100 (7%)

Query: 132 TRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAI-SGIWCEGEDWLVSTSKDGLIKIWDLK 190
           T L SG     I +W+  +E  +  ++  +  + SG +   ++W+V  S D  I+I++  
Sbjct: 30  TTLYSG----RIEIWNYETETEVRSIQVTETPVRSGRFIARKNWIVVGSDDFRIRIFNYN 85

Query: 191 VQQCIETHIAHTGECWAMGVH--EDLLITSGADTQLKLWN 228
             + +    AH     ++ VH  +  +++   D  +KLWN
Sbjct: 86  TGEKVSDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWN 125

>Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score = 75.9 bits (185), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 64/271 (23%), Positives = 120/271 (44%), Gaps = 23/271 (8%)

Query: 331 QYKIKSVSFTTVSNTKLEFVVTTSSNSIEYYSIPYEKRDPTSPAPTRLYTIELPGHRTDI 390
           Q+    V+   ++N K + + T    ++  Y I       T+P P         GHR ++
Sbjct: 29  QHSDSQVNRLEITNDK-KLLATAGHQNVRLYDIR-----TTNPNPV----ASFEGHRGNV 78

Query: 391 RSVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFDCGYALTCKFL-PGGTLVIVGTREG 448
            SV    D++ + T+S +G +KVW++++ +  R +     +    + P    +I   R+G
Sbjct: 79  TSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDG 138

Query: 449 SLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGT 508
           +++++DL  +          +T++ SL + SDG  L   +       W      D     
Sbjct: 139 NIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTD----- 193

Query: 509 ADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDS-MKFFLSLYG 567
           A    PV K    +T      +  + +S + K LA    D+T +V+ +D   K   +L G
Sbjct: 194 ASHLKPVTKFRAHSTY-----ITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDG 248

Query: 568 HKLPVLSIDISFDSKLIITSSADKNIKIWGL 598
           H+  V     S DS  ++T+S+D  +++W L
Sbjct: 249 HQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 90/201 (44%), Gaps = 21/201 (10%)

Query: 484 LVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLA 543
           LV+   D TI+FW      + + G   +          T    +  V  + I+ + K LA
Sbjct: 5   LVSAGYDHTIRFW------EALTGVCSR----------TIQHSDSQVNRLEITNDKKLLA 48

Query: 544 ISLLDNTVKVFYLDSMKF--FLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFG 601
            +   N V+++ + +       S  GH+  V S+    D++ ++TSS D  IK+W +   
Sbjct: 49  TAGHQN-VRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSP 107

Query: 602 DCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAH-QSEVWSIA 660
              ++ + H   +  V   P      S  +DG ++ WD  + +C  +L     + + S++
Sbjct: 108 SIPRN-YKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLS 166

Query: 661 ITSDGTSVISASHDHSLRVWE 681
           + SDG+ + +A+   +  VWE
Sbjct: 167 MASDGSMLAAANTKGNCYVWE 187

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 73/164 (44%), Gaps = 8/164 (4%)

Query: 529 DVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSS 588
           +V SV    +++++  S  D T+KV+ + S     + Y H  PV  + I  +   +I+  
Sbjct: 77  NVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRN-YKHNAPVNEVVIHPNQGELISCD 135

Query: 589 ADKNIKIWGLDFGDCHKSLFAHQD-SIMNVKFLPESHNFFSSSKDGLVKYW------DGD 641
            D NI+IW L    C   L    D S+ ++    +     +++  G    W      D  
Sbjct: 136 RDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDAS 195

Query: 642 KFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWEETDD 685
             + + K  AH + +  I ++SD   + + S DH+ RVW   DD
Sbjct: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/302 (18%), Positives = 120/302 (39%), Gaps = 68/302 (22%)

Query: 390 IRSVDISDDDKLLATASNGLLKVWNLKT--KACIRVFDC--GYALTCKFLPGGTLVIVGT 445
           +  ++I++D KLLATA +  +++++++T     +  F+   G   +  F      ++  +
Sbjct: 35  VNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSS 94

Query: 446 REGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLV 505
            +G+++++D+ S ++  N +  H   +  + I  +   L++   D  I+ W+        
Sbjct: 95  EDGTIKVWDVRSPSIPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWD-------- 144

Query: 506 PGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDS------M 559
                  L   +  H  T E +  + S+ ++ +   LA +       V+ + +      +
Sbjct: 145 -------LGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHL 197

Query: 560 KFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKF 619
           K       H   +  I +S D K + T SAD   ++W +D                    
Sbjct: 198 KPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSID-------------------- 237

Query: 620 LPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRV 679
                                D F+    L  HQ  VW  A ++D   +++AS DH +R+
Sbjct: 238 ---------------------DDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRL 276

Query: 680 WE 681
           W+
Sbjct: 277 WD 278

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 66/123 (53%), Gaps = 11/123 (8%)

Query: 78  AEVSYLHYHDETNLLA-AGYMDGTIKVWDLLS--KSVLLTFNGHKSAITVMKFDVTGTRL 134
           ++V+ L   ++  LLA AG+ +  ++++D+ +   + + +F GH+  +T + F      +
Sbjct: 33  SQVNRLEITNDKKLLATAGHQN--VRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWM 90

Query: 135 ISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWC---EGEDWLVSTSKDGLIKIWDLKV 191
           ++ S D  I VWD+ S   + +   H   ++ +     +GE  L+S  +DG I+IWDL  
Sbjct: 91  VTSSEDGTIKVWDVRSP-SIPRNYKHNAPVNEVVIHPNQGE--LISCDRDGNIRIWDLGE 147

Query: 192 QQC 194
            QC
Sbjct: 148 NQC 150

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 53/122 (43%), Gaps = 11/122 (9%)

Query: 41  TSALENINIWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGT 100
           T+  +N+ ++DI+T       ++  P  S +        VS+     +   +     DGT
Sbjct: 49  TAGHQNVRLYDIRT-------TNPNPVASFEGHRGNVTSVSF---QQDNRWMVTSSEDGT 98

Query: 101 IKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSH 160
           IKVWD+ S S+   +  H + +  +        LIS  RD NI +WDL      ++L   
Sbjct: 99  IKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPE 157

Query: 161 KD 162
            D
Sbjct: 158 DD 159

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 21/42 (50%)

Query: 461 LENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEE 502
           LE   D H+  +W    ++D   LVT S+D  ++ W+    E
Sbjct: 242 LETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRE 283

>YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protein
           required for the transport of amino acid permease Gap1p
           from the Golgi to the cell surface; component of the TOR
           signaling pathway; associates with both Tor1p and Tor2p;
           contains a WD-repeat
          Length = 303

 Score = 75.9 bits (185), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 64/271 (23%), Positives = 120/271 (44%), Gaps = 23/271 (8%)

Query: 331 QYKIKSVSFTTVSNTKLEFVVTTSSNSIEYYSIPYEKRDPTSPAPTRLYTIELPGHRTDI 390
           Q+    V+   ++N K + + T    ++  Y I       T+P P         GHR ++
Sbjct: 29  QHSDSQVNRLEITNDK-KLLATAGHQNVRLYDIR-----TTNPNPV----ASFEGHRGNV 78

Query: 391 RSVDISDDDKLLATAS-NGLLKVWNLKTKACIRVFDCGYALTCKFL-PGGTLVIVGTREG 448
            SV    D++ + T+S +G +KVW++++ +  R +     +    + P    +I   R+G
Sbjct: 79  TSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDG 138

Query: 449 SLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLVPGT 508
           +++++DL  +          +T++ SL + SDG  L   +       W      D     
Sbjct: 139 NIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTD----- 193

Query: 509 ADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDS-MKFFLSLYG 567
           A    PV K    +T      +  + +S + K LA    D+T +V+ +D   K   +L G
Sbjct: 194 ASHLKPVTKFRAHSTY-----ITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDG 248

Query: 568 HKLPVLSIDISFDSKLIITSSADKNIKIWGL 598
           H+  V     S DS  ++T+S+D  +++W L
Sbjct: 249 HQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 90/201 (44%), Gaps = 21/201 (10%)

Query: 484 LVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLA 543
           LV+   D TI+FW      + + G   +          T    +  V  + I+ + K LA
Sbjct: 5   LVSAGYDHTIRFW------EALTGVCSR----------TIQHSDSQVNRLEITNDKKLLA 48

Query: 544 ISLLDNTVKVFYLDSMKF--FLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFG 601
            +   N V+++ + +       S  GH+  V S+    D++ ++TSS D  IK+W +   
Sbjct: 49  TAGHQN-VRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSP 107

Query: 602 DCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAH-QSEVWSIA 660
              ++ + H   +  V   P      S  +DG ++ WD  + +C  +L     + + S++
Sbjct: 108 SIPRN-YKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLS 166

Query: 661 ITSDGTSVISASHDHSLRVWE 681
           + SDG+ + +A+   +  VWE
Sbjct: 167 MASDGSMLAAANTKGNCYVWE 187

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 73/164 (44%), Gaps = 8/164 (4%)

Query: 529 DVLSVRISPEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSS 588
           +V SV    +++++  S  D T+KV+ + S     + Y H  PV  + I  +   +I+  
Sbjct: 77  NVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRN-YKHNAPVNEVVIHPNQGELISCD 135

Query: 589 ADKNIKIWGLDFGDCHKSLFAHQD-SIMNVKFLPESHNFFSSSKDGLVKYW------DGD 641
            D NI+IW L    C   L    D S+ ++    +     +++  G    W      D  
Sbjct: 136 RDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDAS 195

Query: 642 KFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVWEETDD 685
             + + K  AH + +  I ++SD   + + S DH+ RVW   DD
Sbjct: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/302 (18%), Positives = 120/302 (39%), Gaps = 68/302 (22%)

Query: 390 IRSVDISDDDKLLATASNGLLKVWNLKT--KACIRVFDC--GYALTCKFLPGGTLVIVGT 445
           +  ++I++D KLLATA +  +++++++T     +  F+   G   +  F      ++  +
Sbjct: 35  VNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSS 94

Query: 446 REGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEEDLV 505
            +G+++++D+ S ++  N +  H   +  + I  +   L++   D  I+ W+        
Sbjct: 95  EDGTIKVWDVRSPSIPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWD-------- 144

Query: 506 PGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDKFLAISLLDNTVKVFYLDS------M 559
                  L   +  H  T E +  + S+ ++ +   LA +       V+ + +      +
Sbjct: 145 -------LGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHL 197

Query: 560 KFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKF 619
           K       H   +  I +S D K + T SAD   ++W +D                    
Sbjct: 198 KPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSID-------------------- 237

Query: 620 LPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRV 679
                                D F+    L  HQ  VW  A ++D   +++AS DH +R+
Sbjct: 238 ---------------------DDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRL 276

Query: 680 WE 681
           W+
Sbjct: 277 WD 278

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 66/123 (53%), Gaps = 11/123 (8%)

Query: 78  AEVSYLHYHDETNLLA-AGYMDGTIKVWDLLS--KSVLLTFNGHKSAITVMKFDVTGTRL 134
           ++V+ L   ++  LLA AG+ +  ++++D+ +   + + +F GH+  +T + F      +
Sbjct: 33  SQVNRLEITNDKKLLATAGHQN--VRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWM 90

Query: 135 ISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWC---EGEDWLVSTSKDGLIKIWDLKV 191
           ++ S D  I VWD+ S   + +   H   ++ +     +GE  L+S  +DG I+IWDL  
Sbjct: 91  VTSSEDGTIKVWDVRSP-SIPRNYKHNAPVNEVVIHPNQGE--LISCDRDGNIRIWDLGE 147

Query: 192 QQC 194
            QC
Sbjct: 148 NQC 150

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 53/122 (43%), Gaps = 11/122 (9%)

Query: 41  TSALENINIWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGT 100
           T+  +N+ ++DI+T       ++  P  S +        VS+     +   +     DGT
Sbjct: 49  TAGHQNVRLYDIRT-------TNPNPVASFEGHRGNVTSVSF---QQDNRWMVTSSEDGT 98

Query: 101 IKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSH 160
           IKVWD+ S S+   +  H + +  +        LIS  RD NI +WDL      ++L   
Sbjct: 99  IKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPE 157

Query: 161 KD 162
            D
Sbjct: 158 DD 159

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 21/42 (50%)

Query: 461 LENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVEE 502
           LE   D H+  +W    ++D   LVT S+D  ++ W+    E
Sbjct: 242 LETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRE 283

>KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.239
           YGL137W
          Length = 911

 Score = 78.2 bits (191), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 77/304 (25%), Positives = 135/304 (44%), Gaps = 27/304 (8%)

Query: 386 HRTD-IRSVDISDDDK-LLATASNGLLKVWNLKTKACIRVFDCGYA--LTCKFLPGGTLV 441
           +R+D ++ +D    +  +L T  +G +++WN +T+  +R            +F+     +
Sbjct: 11  NRSDRVKGIDFHPSEPWVLTTLYSGKIEIWNYETQQEVRSIHVTETPVRAGRFIARKNWI 70

Query: 442 IVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSDGRRLVTGSADKTIKFWNFQVE 501
           +VG+ +  L++F+  +   + + E AH   I S+ +      ++TGS D T+K WN++  
Sbjct: 71  VVGSDDFRLRIFNYNTGEKISDFE-AHPDYIRSIAVHPTKPYVITGSDDLTVKLWNWEKN 129

Query: 502 EDLVPGTADKYLPVMKLIHDTTMEVNED-VLSVRISPED-KFLAISLLDNTVKVFYL-DS 558
             L                + T E ++  V+SV  +P+D    A   LD TVKV+ L  S
Sbjct: 130 WAL----------------EQTFEGHDHFVMSVAFNPKDPNTFASGCLDRTVKVWSLGQS 173

Query: 559 MKFFLSLYGHKLPVLSIDISF--DSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMN 616
              F  + G +  V  +D     D   ++T+S D  +KIW      C  +L  H  ++  
Sbjct: 174 QPNFTLVTGQEKGVNYVDYYPLPDKPYLLTASDDMTVKIWDYQTKSCVATLEGHMANVSF 233

Query: 617 VKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDG-TSVISASHDH 675
             F P      S S+DG VK W+   ++  + L       W IA    G  + I+A  D+
Sbjct: 234 AIFHPTLPIIISGSEDGTVKIWNSSTYKIEKTLNLGLERSWCIASHPTGKKNYIAAGFDN 293

Query: 676 SLRV 679
              V
Sbjct: 294 GFTV 297

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 74/190 (38%), Gaps = 20/190 (10%)

Query: 47  INIWDIKTGELISVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDL 106
           + I++  TGE IS               + P  +  +  H     +  G  D T+K+W+ 
Sbjct: 79  LRIFNYNTGEKISDFE------------AHPDYIRSIAVHPTKPYVITGSDDLTVKLWNW 126

Query: 107 LSKSVL-LTFNGHKSAITVMKFDVTGTR-LISGSRDSNIIVWDLVSEVGLYKLRSHKDA- 163
                L  TF GH   +  + F+        SG  D  + VW L      + L + ++  
Sbjct: 127 EKNWALEQTFEGHDHFVMSVAFNPKDPNTFASGCLDRTVKVWSLGQSQPNFTLVTGQEKG 186

Query: 164 ---ISGIWCEGEDWLVSTSKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDL--LITS 218
              +       + +L++ S D  +KIWD + + C+ T   H         H  L  +I+ 
Sbjct: 187 VNYVDYYPLPDKPYLLTASDDMTVKIWDYQTKSCVATLEGHMANVSFAIFHPTLPIIISG 246

Query: 219 GADTQLKLWN 228
             D  +K+WN
Sbjct: 247 SEDGTVKIWN 256

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 57/128 (44%), Gaps = 4/128 (3%)

Query: 88  ETNLLAAGYMDGTIKVWDL-LSKSVLLTFNGHKSAITVMKFDVTGTR--LISGSRDSNII 144
           + N  A+G +D T+KVW L  S+       G +  +  + +     +  L++ S D  + 
Sbjct: 152 DPNTFASGCLDRTVKVWSLGQSQPNFTLVTGQEKGVNYVDYYPLPDKPYLLTASDDMTVK 211

Query: 145 VWDLVSEVGLYKLRSHKDAIS-GIWCEGEDWLVSTSKDGLIKIWDLKVQQCIETHIAHTG 203
           +WD  ++  +  L  H   +S  I+      ++S S+DG +KIW+    +  +T      
Sbjct: 212 IWDYQTKSCVATLEGHMANVSFAIFHPTLPIIISGSEDGTVKIWNSSTYKIEKTLNLGLE 271

Query: 204 ECWAMGVH 211
             W +  H
Sbjct: 272 RSWCIASH 279

 Score = 33.5 bits (75), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/109 (21%), Positives = 47/109 (43%)

Query: 572 VLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSK 631
           V  ID       ++T+     I+IW  +     +S+   +  +   +F+   +     S 
Sbjct: 16  VKGIDFHPSEPWVLTTLYSGKIEIWNYETQQEVRSIHVTETPVRAGRFIARKNWIVVGSD 75

Query: 632 DGLVKYWDGDKFECIQKLAAHQSEVWSIAITSDGTSVISASHDHSLRVW 680
           D  ++ ++ +  E I    AH   + SIA+      VI+ S D ++++W
Sbjct: 76  DFRLRIFNYNTGEKISDFEAHPDYIRSIAVHPTKPYVITGSDDLTVKLW 124

>TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 75.5 bits (184), Expect = 7e-14,   Method: Compositional matrix adj