Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1035.261.317ON83583540710.0
TPHA0O014801.317ON82482022620.0
TDEL0D018601.317ON80981422350.0
ZYRO0G20724g1.317ON81281121920.0
TBLA0F013301.317ON82782421460.0
KAFR0A017301.317ON82182220430.0
NDAI0G057401.317ON85785220400.0
NCAS0A092201.317ON83182620100.0
SAKL0D06974g1.317ON81382119850.0
KLTH0H10736g1.317ON81083119800.0
Kwal_14.25871.317ON80882419520.0
CAGL0J05236g1.317ON84284119330.0
AEL166C1.317ON80681219080.0
Ecym_62881.317ON80682118900.0
KNAG0C058301.317ON83082518860.0
Skud_10.1591.317ON83183918170.0
KLLA0F01705g1.317ON78780718030.0
Suva_6.1381.317ON83083817700.0
Smik_10.1781.317ON83183917520.0
YJL062W (LAS21)1.317ON83084717500.0
NDAI0H003204.28ON10343744823e-49
Ecym_55594.28ON10143444762e-48
KLLA0C17534g4.28ON10053404672e-47
ZYRO0B01034g4.28ON10093794583e-46
KAFR0I014104.28ON10163984531e-45
CAGL0G04015g4.28ON10193514486e-45
SAKL0H25542g4.28ON10133444451e-44
TDEL0F016904.28ON10053424442e-44
KLTH0E06094g4.28ON10163454414e-44
Kwal_55.20667singletonOFF6024024297e-44
Kwal_YGOB_55.206644.28ON9564024371e-43
KNAG0J028204.28ON10173384371e-43
TBLA0A085004.28ON10653454343e-43
Kpol_478.14.28ON10093524325e-43
YLL031C (GPI13)4.28ON10173394281e-42
AGR126C4.28ON10134134236e-42
TPHA0F003104.28ON10263654211e-41
Suva_10.414.28ON10173404173e-41
Skud_12.364.28ON10163424131e-40
NCAS0C058004.28ON10113434121e-40
Smik_12.254.28ON10173394093e-40
TPHA0K021804.28ON10283213881e-37
YKL165C (MCD4)1.184ON9193321825e-13
Smik_11.641.184ON9453301721e-11
Skud_11.601.184ON9193331711e-11
Suva_11.581.184ON9193281673e-11
KLLA0B07249g1.184ON9193391665e-11
TDEL0C036901.184ON9203251621e-10
CAGL0M08448g1.184ON9213291622e-10
KNAG0C010801.184ON9313221622e-10
NCAS0B082601.184ON9243261612e-10
AEL113C1.184ON9253211612e-10
TPHA0A028001.184ON9203761602e-10
ZYRO0G18458g1.184ON9213251551e-09
SAKL0C05434g1.184ON10354071541e-09
NDAI0A009801.184ON9253261513e-09
KAFR0G005001.184ON9224001461e-08
Ecym_80941.184ON9263301461e-08
Kpol_2001.281.184ON9193231451e-08
TBLA0C058401.184ON9473251442e-08
KLTH0F04884g1.184ON9223291371e-07
Kwal_33.138561.184ON9224011362e-07
TBLA0E014804.28ON1040321990.004
Kwal_27.116078.441ON227115742.3
NCAS0F034603.478ON39366709.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1035.26
         (835 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1035.26 s1035 complement(61260..63767) [2508 bp, 835 aa] {O...  1572   0.0  
TPHA0O01480 Chr15 complement(296533..299007) [2475 bp, 824 aa] {...   875   0.0  
TDEL0D01860 Chr4 (363606..366035) [2430 bp, 809 aa] {ON} Anc_1.3...   865   0.0  
ZYRO0G20724g Chr7 complement(1705835..1708273) [2439 bp, 812 aa]...   848   0.0  
TBLA0F01330 Chr6 complement(333140..335623) [2484 bp, 827 aa] {O...   831   0.0  
KAFR0A01730 Chr1 complement(352169..354634) [2466 bp, 821 aa] {O...   791   0.0  
NDAI0G05740 Chr7 (1421943..1424516) [2574 bp, 857 aa] {ON} Anc_1...   790   0.0  
NCAS0A09220 Chr1 complement(1823213..1825708) [2496 bp, 831 aa] ...   778   0.0  
SAKL0D06974g Chr4 complement(576570..579011) [2442 bp, 813 aa] {...   769   0.0  
KLTH0H10736g Chr8 complement(924558..926990) [2433 bp, 810 aa] {...   767   0.0  
Kwal_14.2587 s14 complement(824261..826687) [2427 bp, 808 aa] {O...   756   0.0  
CAGL0J05236g Chr10 complement(504544..507072) [2529 bp, 842 aa] ...   749   0.0  
AEL166C Chr5 complement(322853..325273) [2421 bp, 806 aa] {ON} S...   739   0.0  
Ecym_6288 Chr6 (540338..542758) [2421 bp, 806 aa] {ON} similar t...   732   0.0  
KNAG0C05830 Chr3 (1132645..1135137) [2493 bp, 830 aa] {ON} Anc_1...   731   0.0  
Skud_10.159 Chr10 complement(299147..301642) [2496 bp, 831 aa] {...   704   0.0  
KLLA0F01705g Chr6 complement(159469..161832) [2364 bp, 787 aa] {...   699   0.0  
Suva_6.138 Chr6 complement(231325..233817) [2493 bp, 830 aa] {ON...   686   0.0  
Smik_10.178 Chr10 (309109..311604) [2496 bp, 831 aa] {ON} YJL062...   679   0.0  
YJL062W Chr10 (317284..319776) [2493 bp, 830 aa] {ON}  LAS21Inte...   678   0.0  
NDAI0H00320 Chr8 complement(57504..60608) [3105 bp, 1034 aa] {ON...   190   3e-49
Ecym_5559 Chr5 (1131115..1134159) [3045 bp, 1014 aa] {ON} simila...   187   2e-48
KLLA0C17534g Chr3 (1540967..1543984) [3018 bp, 1005 aa] {ON} sim...   184   2e-47
ZYRO0B01034g Chr2 (87543..90572) [3030 bp, 1009 aa] {ON} similar...   181   3e-46
KAFR0I01410 Chr9 (294241..297291) [3051 bp, 1016 aa] {ON} Anc_4....   179   1e-45
CAGL0G04015g Chr7 (379330..382389) [3060 bp, 1019 aa] {ON} highl...   177   6e-45
SAKL0H25542g Chr8 (2236849..2239890) [3042 bp, 1013 aa] {ON} sim...   176   1e-44
TDEL0F01690 Chr6 (313714..316731) [3018 bp, 1005 aa] {ON} Anc_4....   175   2e-44
KLTH0E06094g Chr5 complement(550258..553308) [3051 bp, 1016 aa] ...   174   4e-44
Kwal_55.20667 s55 complement(511335..513140) [1806 bp, 602 aa] {...   169   7e-44
Kwal_YGOB_55.20664 s55 complement(510269..511291,511293..513140)...   172   1e-43
KNAG0J02820 Chr10 (539098..542151) [3054 bp, 1017 aa] {ON} Anc_4...   172   1e-43
TBLA0A08500 Chr1 complement(2089018..2092215) [3198 bp, 1065 aa]...   171   3e-43
Kpol_478.1 s478 complement(442..3471) [3030 bp, 1009 aa] {ON} co...   171   5e-43
YLL031C Chr12 complement(77152..80205) [3054 bp, 1017 aa] {ON}  ...   169   1e-42
AGR126C Chr7 complement(989235..992276) [3042 bp, 1013 aa] {ON} ...   167   6e-42
TPHA0F00310 Chr6 complement(59665..62745) [3081 bp, 1026 aa] {ON...   166   1e-41
Suva_10.41 Chr10 complement(81579..84632) [3054 bp, 1017 aa] {ON...   165   3e-41
Skud_12.36 Chr12 complement(68300..71350) [3051 bp, 1016 aa] {ON...   163   1e-40
NCAS0C05800 Chr3 (1193195..1196230) [3036 bp, 1011 aa] {ON} Anc_...   163   1e-40
Smik_12.25 Chr12 complement(61505..64558) [3054 bp, 1017 aa] {ON...   162   3e-40
TPHA0K02180 Chr11 (466234..469320) [3087 bp, 1028 aa] {ON} Anc_4...   154   1e-37
YKL165C Chr11 complement(137932..140691) [2760 bp, 919 aa] {ON} ...    75   5e-13
Smik_11.64 Chr11 complement(123662..126499) [2838 bp, 945 aa] {O...    71   1e-11
Skud_11.60 Chr11 complement(124115..126874) [2760 bp, 919 aa] {O...    70   1e-11
Suva_11.58 Chr11 complement(123117..125876) [2760 bp, 919 aa] {O...    69   3e-11
KLLA0B07249g Chr2 complement(630336..633095) [2760 bp, 919 aa] {...    69   5e-11
TDEL0C03690 Chr3 (648638..651400) [2763 bp, 920 aa] {ON} Anc_1.1...    67   1e-10
CAGL0M08448g Chr13 complement(841439..844204) [2766 bp, 921 aa] ...    67   2e-10
KNAG0C01080 Chr3 complement(209716..212511) [2796 bp, 931 aa] {O...    67   2e-10
NCAS0B08260 Chr2 (1574633..1577407) [2775 bp, 924 aa] {ON} Anc_1...    67   2e-10
AEL113C Chr5 complement(409096..411873) [2778 bp, 925 aa] {ON} S...    67   2e-10
TPHA0A02800 Chr1 complement(603610..606372) [2763 bp, 920 aa] {O...    66   2e-10
ZYRO0G18458g Chr7 (1522413..1525178) [2766 bp, 921 aa] {ON} high...    64   1e-09
SAKL0C05434g Chr3 complement(516536..519643) [3108 bp, 1035 aa] ...    64   1e-09
NDAI0A00980 Chr1 complement(201468..204245) [2778 bp, 925 aa] {O...    63   3e-09
KAFR0G00500 Chr7 complement(134741..137509) [2769 bp, 922 aa] {O...    61   1e-08
Ecym_8094 Chr8 (200835..203615) [2781 bp, 926 aa] {ON} similar t...    61   1e-08
Kpol_2001.28 s2001 (81621..83408,83411..84382) [2760 bp, 919 aa]...    60   1e-08
TBLA0C05840 Chr3 complement(1411740..1414583) [2844 bp, 947 aa] ...    60   2e-08
KLTH0F04884g Chr6 complement(431251..434019) [2769 bp, 922 aa] {...    57   1e-07
Kwal_33.13856 s33 complement(424296..427064) [2769 bp, 922 aa] {...    57   2e-07
TBLA0E01480 Chr5 complement(337267..340389) [3123 bp, 1040 aa] {...    43   0.004
Kwal_27.11607 s27 (873092..873775) [684 bp, 227 aa] {ON} YDR226W...    33   2.3  
NCAS0F03460 Chr6 (693881..695062) [1182 bp, 393 aa] {ON} Anc_3.4...    32   9.6  

>Kpol_1035.26 s1035 complement(61260..63767) [2508 bp, 835 aa] {ON}
           complement(61260..63767) [2508 nt, 836 aa]
          Length = 835

 Score = 1572 bits (4071), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 773/835 (92%), Positives = 773/835 (92%)

Query: 1   MKVXXXXXXXXXXXXSVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVID 60
           MKV            SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVID
Sbjct: 1   MKVLQLTAILIIQLISVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVID 60

Query: 61  ALRSDFLFDQDISQFNYIHELSNNGYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAIL 120
           ALRSDFLFDQDISQFNYIHELSNNGYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAIL
Sbjct: 61  ALRSDFLFDQDISQFNYIHELSNNGYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAIL 120

Query: 121 NVAEDDSSSNLKNQDSWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFE 180
           NVAEDDSSSNLKNQDSWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFE
Sbjct: 121 NVAEDDSSSNLKNQDSWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFE 180

Query: 181 QVDHNVTRHLEKQIKEKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFE 240
           QVDHNVTRHLEKQIKEKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFE
Sbjct: 181 QVDHNVTRHLEKQIKEKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFE 240

Query: 241 TVGQDENTLICVMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIK 300
           TVGQDENTLICVMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIK
Sbjct: 241 TVGQDENTLICVMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIK 300

Query: 301 SVNVAPEEDKQYKFLTQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIKL 360
           SVNVAPEEDKQYKFLTQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIKL
Sbjct: 301 SVNVAPEEDKQYKFLTQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIKL 360

Query: 361 QENFRQLMIVSNNKDIRQLYESYDFENTEIKDIISEMKDIQGELTSSATNYNVPXXXXXX 420
           QENFRQLMIVSNNKDIRQLYESYDFENTEIKDIISEMKDIQGELTSSATNYNVP      
Sbjct: 361 QENFRQLMIVSNNKDIRQLYESYDFENTEIKDIISEMKDIQGELTSSATNYNVPLLYLGL 420

Query: 421 XXXXXXXXXXSFWFYFSVLEVDFKNVXXXXXXXXXXXXXXXXXFVEEEHQIWWWIITGLI 480
                     SFWFYFSVLEVDFKNV                 FVEEEHQIWWWIITGLI
Sbjct: 421 GLIFILTLTISFWFYFSVLEVDFKNVLIVIISLLIGLSSFASSFVEEEHQIWWWIITGLI 480

Query: 481 TVSAINLPDQKIAHLVMFVCVRIIRGWNNSGQKYSYDRTISILLNTEYEDFQWYLNIATI 540
           TVSAINLPDQKIAHLVMFVCVRIIRGWNNSGQKYSYDRTISILLNTEYEDFQWYLNIATI
Sbjct: 481 TVSAINLPDQKIAHLVMFVCVRIIRGWNNSGQKYSYDRTISILLNTEYEDFQWYLNIATI 540

Query: 541 LYIMLKDSTDNLISFMFSYNLGSVCILYKVCWTIINQDHVPEPIYKAAIYICRRLSRDYS 600
           LYIMLKDSTDNLISFMFSYNLGSVCILYKVCWTIINQDHVPEPIYKAAIYICRRLSRDYS
Sbjct: 541 LYIMLKDSTDNLISFMFSYNLGSVCILYKVCWTIINQDHVPEPIYKAAIYICRRLSRDYS 600

Query: 601 LQDISVVEENLIPIARFFFYSVLAIVIAIYGSAKLKLIKNPIKDIQKTLTFLLIFQSPSS 660
           LQDISVVEENLIPIARFFFYSVLAIVIAIYGSAKLKLIKNPIKDIQKTLTFLLIFQSPSS
Sbjct: 601 LQDISVVEENLIPIARFFFYSVLAIVIAIYGSAKLKLIKNPIKDIQKTLTFLLIFQSPSS 660

Query: 661 YIGLFMVYDIXXXXXXXXXXXXXXXXXMITSTISLVLQYFTFFQFGGTNSIATADLTNAY 720
           YIGLFMVYDI                 MITSTISLVLQYFTFFQFGGTNSIATADLTNAY
Sbjct: 661 YIGLFMVYDILQSSLSSLLVNQYSSNVMITSTISLVLQYFTFFQFGGTNSIATADLTNAY 720

Query: 721 NGVSEDYNIYFVGFLMCVSNFAPAIYWAMFPWKVIYNQIKPNNKWNVFAENKLPIVYFNC 780
           NGVSEDYNIYFVGFLMCVSNFAPAIYWAMFPWKVIYNQIKPNNKWNVFAENKLPIVYFNC
Sbjct: 721 NGVSEDYNIYFVGFLMCVSNFAPAIYWAMFPWKVIYNQIKPNNKWNVFAENKLPIVYFNC 780

Query: 781 IAGCFLLLSCFILRYHLFIWSVFSPKLCYYATWNIFMNLIVGWVLEIAVLSMVDK 835
           IAGCFLLLSCFILRYHLFIWSVFSPKLCYYATWNIFMNLIVGWVLEIAVLSMVDK
Sbjct: 781 IAGCFLLLSCFILRYHLFIWSVFSPKLCYYATWNIFMNLIVGWVLEIAVLSMVDK 835

>TPHA0O01480 Chr15 complement(296533..299007) [2475 bp, 824 aa] {ON}
           Anc_1.317 YJL062W
          Length = 824

 Score =  875 bits (2262), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/820 (55%), Positives = 571/820 (69%), Gaps = 18/820 (2%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQF 75
           ++ IFC+GFFPSKNVL+G   F    + QL  KP F KLV VVIDALRSDFL+++  S F
Sbjct: 13  AITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDFLYEEQNSHF 72

Query: 76  NYIHELSNNGYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKNQD 135
           +++H + N+G AWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD SS+LK+QD
Sbjct: 73  HFVHRVLNSGEAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSSLKDQD 132

Query: 136 SWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQVDHNVTRHLEKQIK 195
           SW MQF KH K IRFFGDDTWLKLFP  IF+EYEGTNSFFVSDFEQVD NVTRHLEKQ K
Sbjct: 133 SWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFFVSDFEQVDLNVTRHLEKQFK 192

Query: 196 EKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQDENTLICVMGD 255
           EK  WD LILHYLGLDHIGHKGG  SKFM  KH EMDSI+++++ ++G  E+TL+CVMGD
Sbjct: 193 EKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILEDIYNSIGDTEDTLLCVMGD 252

Query: 256 HGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQYKFL 315
           HGMN  GNHGGSS GETSAGL +ISKK K    P DQ    LPIK      EE+K YKFL
Sbjct: 253 HGMNNGGNHGGSSSGETSAGLTMISKKFKKLAKPKDQINTVLPIKWNENLTEEEKDYKFL 312

Query: 316 TQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIKLQENFRQLMIVSNNKD 375
           + +QQVD VPTLSALFN+P P N+VGV++P +L LLDPKL R KL+ENF QL  +S +  
Sbjct: 313 SFVQQVDFVPTLSALFNLPMPINSVGVLIPELLRLLDPKLTRTKLKENFSQLTELSKSLT 372

Query: 376 IRQLYESYDFENTEIKDIISEMKDIQGELTSSATNYNVPXXXXXXXXXXXXXXXXSFWFY 435
            R +Y + DF+N  I+DIIS+M+ +Q EL  SATNYN+                      
Sbjct: 373 TRNIYNAIDFQNDTIEDIISQMQSVQSELMKSATNYNMNAIYIAIILLSIVTLI------ 426

Query: 436 FSVLEVDFK----NVXXXXXXXXXXXXXXXXXFVEEEHQIWWWIITGLITVSAINLPDQK 491
             ++   F     N+                 F+EEEHQIWWW+ITG+   S +   D K
Sbjct: 427 --IIHKAFSNYKFNILPVAVSLIIGLSSFASSFIEEEHQIWWWLITGMCAFSLVYNSDSK 484

Query: 492 IAHLVMFVCVRIIRGWNNSGQKYSYDRTISILLNTEYEDFQWYLNIATILYIMLKDSTDN 551
            ++ ++F+C+R+IRGWNNSGQKY Y   +S LL  +Y ++QWYLN +TILY M K S +N
Sbjct: 485 FSNFIVFLCLRLIRGWNNSGQKYYYPFALSSLLKLKYVNYQWYLNTSTILYFMFKGSMNN 544

Query: 552 LISFMFSYNLGSVCILYKVCWTIINQDHVPEPIYKAAIYICRRLSRDYSLQDISVVEENL 611
             SFM S+ L ++C++YKV W I+NQ+HVP+ I    + +C  L    ++  + + E  L
Sbjct: 545 FPSFMSSFLLANLCLMYKVSWAIVNQEHVPDTIKHYVLVLCTHLMSARNVAPLQLFESTL 604

Query: 612 IPIARFFFYSVLAI--VIAIYGSAKLKLIKNPIKDIQKTLTFLLIFQSPSSYIGLFMVYD 669
           IP+AR FF  V+ +  +  + G      + NP+ +I+K + FLLIFQ+    IGL++++ 
Sbjct: 605 IPLARLFFCCVVILLSLTLVIGKLSPTRLGNPVSNIKKIIIFLLIFQTSPENIGLYLLFG 664

Query: 670 IXXXXXXXXXXXXXXXXXMITSTISLVLQYFTFFQFGGTNSIATADLTNAYNGVSEDYNI 729
           I                  + +TISLV+QYFTF+QFG TNSIAT DLTNAYNGVSEDYNI
Sbjct: 665 ILETNLTDIIDKHYSGNTQLITTISLVMQYFTFYQFGNTNSIATIDLTNAYNGVSEDYNI 724

Query: 730 YFVGFLMCVSNFAPAIYWAMFPWKVIYNQIKPNNKWNVFAENKLPIVYFNCIAGCFLLLS 789
           YFVG++M +SN+APAIYW+MFPW +  N+     KW  F E K  I+ FNCI+G FLL++
Sbjct: 725 YFVGWMMSISNYAPAIYWSMFPWIIDDNK----QKWKKFIERKNIILLFNCISGLFLLIT 780

Query: 790 CFILRYHLFIWSVFSPKLCYYATWNIFMNLIVGWVLEIAV 829
           C ILRYHLFIWSVFSPKLCYY  WNIFMN+I+GW+LE  V
Sbjct: 781 CTILRYHLFIWSVFSPKLCYYMMWNIFMNVIIGWILETLV 820

>TDEL0D01860 Chr4 (363606..366035) [2430 bp, 809 aa] {ON} Anc_1.317
           YJL062W
          Length = 809

 Score =  865 bits (2235), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/814 (54%), Positives = 554/814 (68%), Gaps = 23/814 (2%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQF 75
           +V +FC GFFP K VL+ +A F      Q  AKP FNKLVLVVIDALRSDFLF++  S+F
Sbjct: 15  AVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDALRSDFLFEKSNSKF 74

Query: 76  NYIHELSNNGYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKNQD 135
           +++H L N G AWGFTA+SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNL +QD
Sbjct: 75  SFLHSLLNEGSAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLNDQD 134

Query: 136 SWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQVDHNVTRHLEKQIK 195
           SW  QF  HGKK+RFFGDDTWLKLFP E F EY+GTNSFFVSDFEQVDHNVTRHL KQ+ 
Sbjct: 135 SWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDFEQVDHNVTRHLPKQLN 194

Query: 196 EKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQDENTLICVMGD 255
            + +WDALILHYLGLDHIGHKGGP S+FM  K  EMD I+K ++E V  D+ TLICVMGD
Sbjct: 195 NQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYENV--DDETLICVMGD 252

Query: 256 HGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQYKFL 315
           HGMN+VGNHGGSS GETSA L LISKKL+ +  P++Q GV+LP++  N   E D  Y++L
Sbjct: 253 HGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQ--NADGEVD--YQYL 308

Query: 316 TQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIKLQENFRQLMIVSNNKD 375
           T+IQQVDIVPTL+ALFN P PKN+VG+++   L+LLDPKL +IKL EN +QL  +SN  +
Sbjct: 309 TRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKIKLLENLKQLDSISNGHE 368

Query: 376 IRQLYESYDFENTEIKDIISEMKDIQGELTSSATNYNVPXXXXXXXXXXXXXXXXSFWFY 435
           + Q       +   I  +   MKDIQ +LT SATNYN                  +    
Sbjct: 369 VIQ-------DEANIDQLYDLMKDIQSDLTRSATNYNYD-LMGMGLALLVITTIITVLVG 420

Query: 436 FSVLEVDFKNVXXXXXXXXXXXXXXXXXFVEEEHQIWWWIITGLITVSAINLPDQKIAHL 495
            + +E                       FVEEEHQIWWWI TG    S++ L D+K  H 
Sbjct: 421 SNRMEFGHPFFFTMIVSLLIGLSSFGSSFVEEEHQIWWWISTGATLASSVYLVDEKYTHF 480

Query: 496 VMFVCVRIIRGWNNSGQKYSYDRTISILLNTEYEDFQWYLNIATILYIMLKDSTDNLISF 555
           V+ VC+RIIR WNNSGQK+  + T+  +L     + QWYLN   I+   LK S+ ++++F
Sbjct: 481 VILVCLRIIRAWNNSGQKHFNENTVFDILKRNPTE-QWYLNFFAIVICGLKGSSGDIVTF 539

Query: 556 MFSYNLGSVCILYKVCWTIINQDHVPEPIYKAAIYICRRLSRDYSLQDISVVEENLIPIA 615
           M S+ L ++C++YKV W ++N++ VP  +Y+ A   C  +  D +     V +++LIP+A
Sbjct: 540 MCSFVLTALCLVYKVTWALVNRETVPHWLYEVAYKSCSIMMGDTT----DVFDKSLIPLA 595

Query: 616 RFFFYSVLAIVIAIYGSAKLKLIKNPIKDIQKTLTFLLIFQSPSSYIGLFMVYDIXXXXX 675
           + FF      V     + K+   KN    I   +T LLIFQS S  I LF V+D+     
Sbjct: 596 QLFFRCFAGCVAVAVVACKMGGNKNS-HAISTFITLLLIFQSQSPNIPLFFVFDVLKSSL 654

Query: 676 XXXXXXXXXXXXMITSTISLVLQYFTFFQFGGTNSIATADLTNAYNGVSEDYNIYFVGFL 735
                        + S +SL+LQYFTFF FGGTNSIAT DL+NAYNGVSE+YNIY VGF+
Sbjct: 655 NKIVSKRYNSDAYMISAVSLILQYFTFFHFGGTNSIATVDLSNAYNGVSENYNIYAVGFM 714

Query: 736 MCVSNFAPAIYWAMFPWKVIYNQIKPNNKWNVFAENKLPIVYFNCIAGCFLLLSCFILRY 795
           MCVSNFAP+IYW+ F W ++Y   K N KW+ F ++KL  + FNCI+GC L+ +C  LR+
Sbjct: 715 MCVSNFAPSIYWSTFTWNLLY---KTNKKWHNFFQSKLTFLMFNCISGCCLMFACVALRF 771

Query: 796 HLFIWSVFSPKLCYYATWNIFMNLIVGWVLEIAV 829
           HLFIWSVFSPKLCYYATWNIFMNL++GW+LEI +
Sbjct: 772 HLFIWSVFSPKLCYYATWNIFMNLVIGWILEIPL 805

>ZYRO0G20724g Chr7 complement(1705835..1708273) [2439 bp, 812 aa]
           {ON} similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062W LAS21 Integral plasma membrane protein involved
           in the synthesis of the glycosylphosphatidylinositol
           (GPI) core structure mutations affect cell wall
           integrity
          Length = 812

 Score =  848 bits (2192), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/811 (52%), Positives = 557/811 (68%), Gaps = 21/811 (2%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQF 75
           ++ IFC GFFP KNVL+G+A F I S  Q  +KP F+K VL+V+DALRSDF+F++ IS F
Sbjct: 15  AIFIFCCGFFPQKNVLKGNADFIIESSIQTQSKPVFDKFVLIVVDALRSDFVFEESISNF 74

Query: 76  NYIHELSNNGYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKNQD 135
            ++H L N+G AWGFTA+SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLK QD
Sbjct: 75  KFVHSLINDGEAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKEQD 134

Query: 136 SWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQVDHNVTRHLEKQIK 195
           SW  QF + GKK+RFFGDDTWLKLFP + F EYEGTNSFFVSDFEQVD NVTRHL  Q++
Sbjct: 135 SWLKQFVRQGKKMRFFGDDTWLKLFPLDFFQEYEGTNSFFVSDFEQVDLNVTRHLPHQLE 194

Query: 196 EKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQDENTLICVMGD 255
            + DWD LILHYLGLDHIGHKGG  S FM  KH EMDSI+KN++E V  DENTL+CVMGD
Sbjct: 195 TQKDWDVLILHYLGLDHIGHKGGARSVFMPGKHAEMDSIVKNIYENV--DENTLVCVMGD 252

Query: 256 HGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQYKFL 315
           HGMNEVGNHGGSSPGETS+ LV+ISKKLK F+ P  Q+ V LPI +     + +  Y +L
Sbjct: 253 HGMNEVGNHGGSSPGETSSALVMISKKLKQFQPPLHQRDVHLPITT--QFQDGEVNYDYL 310

Query: 316 TQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIKLQENFRQLMIVSNNKD 375
           T++QQVD VPTL+ALFNIP PKNNVG+++P  L+LLD K+  IK+++NF QL  +     
Sbjct: 311 TKVQQVDFVPTLAALFNIPIPKNNVGIIIPDFLQLLDSKMAAIKVKDNFNQLASL----- 365

Query: 376 IRQLYESYDFENTEIKDIISEMKDIQGELTSSATNYNVPXXXXXXXXXXXXXXXXSFWFY 435
              L  + + +N  I +   +MKD+Q  LT SATNY  P                + W+ 
Sbjct: 366 ---LGRTLEVKNESINEEFEQMKDLQEVLTKSATNYKYP-ILAAGFGLLTVLTAVALWYG 421

Query: 436 FSVLEVDFKNVXXXXXXXXXXXXXXXXXFVEEEHQIWWWIITGLITVSAINLPDQKIAHL 495
            S++++   ++                 FVEEEHQIWWW+ITG + +S + L      H 
Sbjct: 422 ISIMQLSKSSLLTIVLSLLLGIATFSSSFVEEEHQIWWWVITGALLLSQLYLRKALGLHF 481

Query: 496 VMFVCVRIIRGWNNSGQKYSYDRTISILLNTEYEDFQWYLNIATILYIMLKDSTDNLISF 555
           V FVCVR+IRGWNNSGQKY+YD TI  LL       QWYLNI TI  + L  S  + +SF
Sbjct: 482 VCFVCVRLIRGWNNSGQKYTYDNTIFELLKAN-PGVQWYLNILTIFTVGLGGSLGDRLSF 540

Query: 556 MFSYNLGSVCILYKVCWTIINQDHVPEPIYKAAIYICRRLSRDYSLQDISVVEENLIPIA 615
           + S++L ++C  YK+ W I+N++ VP  + + A   C   +++++  +  V  + L+P+A
Sbjct: 541 ILSFSLCALCGSYKISWAIVNREDVPFWMQELAFKSCLFFTKEHTNPE-EVFGKALVPMA 599

Query: 616 RFFFYSVLAIVIAIYGSAKLKLIKNPIKDIQKTLTFLLIFQSPSSYIGLFMVYDIXXXXX 675
           +FFF   +A ++    ++K+ + K    ++   L+ LL+FQSP++ I LF ++++     
Sbjct: 600 QFFFKYFIACLVVKISASKIGVCK---ANLFSMLSILLMFQSPTANIPLFFIFEVLRAAL 656

Query: 676 XXXXXXXXXXXXMITSTISLVLQYFTFFQFGGTNSIATADLTNAYNGVSEDYNIYFVGFL 735
                          S  SL+LQYFTF+QFGGTNSIA+ DL+NAYNGV E+YNIY VGF+
Sbjct: 657 SRLFTDYYGSNTYFVSLSSLLLQYFTFYQFGGTNSIASIDLSNAYNGVPENYNIYLVGFM 716

Query: 736 MCVSNFAPAIYWAMFPWKVIYNQIKPNNKWNVFAENKLPIVYFNCIAGCFLLLSCFILRY 795
           M VSNFAP IYW+++   +   +   + KW ++AE K+P + FNC+ G FLL++C++ R+
Sbjct: 717 MFVSNFAPTIYWSLYKSTIPRPE---SRKWILYAEQKIPFLIFNCVVGVFLLIACYVFRF 773

Query: 796 HLFIWSVFSPKLCYYATWNIFMNLIVGWVLE 826
           HLFIWSVFSPKLCY+ +WNIFMN+I+   LE
Sbjct: 774 HLFIWSVFSPKLCYFVSWNIFMNIIIECGLE 804

>TBLA0F01330 Chr6 complement(333140..335623) [2484 bp, 827 aa] {ON}
           Anc_1.317 YJL062W
          Length = 827

 Score =  831 bits (2146), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/824 (53%), Positives = 556/824 (67%), Gaps = 33/824 (4%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQF 75
           +V IFCIGFFP K+VL G + F+I    Q  A P F+KL+LVVIDALRSDF+FD +IS F
Sbjct: 16  AVFIFCIGFFPQKSVLNGSSTFQIEKSLQQEAPPVFSKLILVVIDALRSDFIFDSNISNF 75

Query: 76  NYIHELSNNGYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKNQD 135
            + H L NNG AWGFTA+SNPPTVTLPRLKG+TTGSTPNFLDAILNVAEDD+SSNLK+QD
Sbjct: 76  PFTHSLLNNGNAWGFTAYSNPPTVTLPRLKGLTTGSTPNFLDAILNVAEDDNSSNLKDQD 135

Query: 136 SWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQVDHNVTRHLEKQIK 195
           S   QF  + KKIRFFGDDTWLKLFP + F E+EGTNSFFVSDF QVD+NVTRH+ KQ++
Sbjct: 136 SLLNQFYLNNKKIRFFGDDTWLKLFPLDYFEEHEGTNSFFVSDFTQVDNNVTRHIPKQLQ 195

Query: 196 EKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQDENTLICVMGD 255
           EKNDWD LILHYLGLDHIGHKGGP SKFM  KH EMD II+ L+E +  D + L+C++GD
Sbjct: 196 EKNDWDVLILHYLGLDHIGHKGGPRSKFMPTKHEEMDGIIRQLYENL--DNDGLLCILGD 253

Query: 256 HGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDK-QYKF 314
           HGMNE+GNHGGSS GETSA +V  S KL NFE+PS QK +KLPI      P ED+  +K+
Sbjct: 254 HGMNELGNHGGSSNGETSAAMVFASPKLSNFELPSKQKEIKLPI----TKPSEDENSFKY 309

Query: 315 LTQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELL-DPKLFRIKLQENFRQLMIVSNN 373
           LT+IQQVD VPT++ LFN+P P+N+VG+++  +L+LL + KL  IKL+EN++QL+     
Sbjct: 310 LTEIQQVDFVPTIATLFNLPIPRNSVGIIIEPLLKLLRNSKLESIKLKENYKQLL----- 364

Query: 374 KDIRQLYESY-DFENTEIKDIISEMKDIQGELTSSATNYNVPXXXXXXXXXXXXXXXXSF 432
            D+  ++ +  D  + E  ++ ++M  IQ +LT SATNY                     
Sbjct: 365 -DLAHIHSTMDDISSLEDFELFTKMVSIQEDLTRSATNY-----FYEFLAAGIISSIIGT 418

Query: 433 WFYFSVLEVDFK----NVXXXXXXXXXXXXXXXXXFVEEEHQIWWWIITGLITVSAINLP 488
             Y  ++  D K     +                 FVEEEHQIWWWI+TGLIT+S    P
Sbjct: 419 ILYAVLITKDLKFNGIEIISIIISLLIGLSMFGSSFVEEEHQIWWWIVTGLITLSLYLKP 478

Query: 489 DQKIAHLVMFVCVRIIRGWNNSGQKYSYDRTIS-ILLNTEYEDFQWYLNIATILYIMLKD 547
           + K+ HL +F+CVR+IRGWNNSGQKY Y+ TIS IL   EY+D QWYL +ATI ++   D
Sbjct: 479 NTKLLHLTLFICVRLIRGWNNSGQKYVYESTISNILSRIEYKDMQWYLILATITFVSFND 538

Query: 548 STDNLISFMFSYNLGSVCILYKVCWTIINQDHVPEPIYKAAIYICRRLSRDYSLQDISVV 607
           S  NL +F  S +LG +   +KV W+I N + VP  I   A  + + L  D S +DI + 
Sbjct: 539 SMKNLPTFAMSLSLGVLVFSFKVSWSITNGEKVPFVIKDMARTVVKLLFPDES-KDI-IF 596

Query: 608 EENLIPIARFFFYSVLAIVIAIYGSAKLKL---IKNPIKDIQKTLTFLLIFQSPSSYIGL 664
              L P+A+ FF+  L  ++      KLK+   + N   ++ K +  + I Q+  S I +
Sbjct: 597 SLALNPLAQLFFHCTLGFLVIKLLIQKLKIDKTVDNIFDELTKVMNLVAIMQTRPSNIPM 656

Query: 665 FMVYDIXXXXXXXXXXXXXXXXXMITSTISLVLQYFTFFQFGGTNSIATADLTNAYNGVS 724
           F V++I                  +TS  SLVLQ+FTFFQFGGTNSIAT DL+NAYNGVS
Sbjct: 657 FCVFEIMKMILVKIIKHDYNSNPYVTSIASLVLQHFTFFQFGGTNSIATVDLSNAYNGVS 716

Query: 725 EDYNIYFVGFLMCVSNFAPAIYWAMFPWKVIYNQIKPN--NKWNVFAENKLPIVYFNCIA 782
           E+YNIY+VG LM ++NFAP+IYWA+F W ++Y+    +   + N      LP++++  I 
Sbjct: 717 ENYNIYYVGLLMTIANFAPSIYWAVFSWDILYSYDTNSILRRQNFMKSKVLPLLFY-FII 775

Query: 783 GCFLLLSCFILRYHLFIWSVFSPKLCYYATWNIFMNLIVGWVLE 826
           GCFL LSCFILRYHLFIWSVFSPKLCYY  W+IFMN IVGWV E
Sbjct: 776 GCFLFLSCFILRYHLFIWSVFSPKLCYYVAWSIFMNCIVGWVFE 819

>KAFR0A01730 Chr1 complement(352169..354634) [2466 bp, 821 aa] {ON}
           Anc_1.317 YJL062W
          Length = 821

 Score =  791 bits (2043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/822 (49%), Positives = 537/822 (65%), Gaps = 18/822 (2%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQF 75
           SVL+F IGFFP KNV+ G+A F I+   Q   K  F KLVL+VIDALRSDFLFD+  S F
Sbjct: 15  SVLLFAIGFFPQKNVMNGNATFSINKKLQEETKQPFKKLVLIVIDALRSDFLFDESSSNF 74

Query: 76  NYIHELSNNGYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKNQD 135
           +++H   N+G AWG+TA+SNPPTVTLPRLKGITTGSTPNFLDA+LNVAEDDSSSN+K+QD
Sbjct: 75  HFVHSKLNSGEAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDALLNVAEDDSSSNVKDQD 134

Query: 136 SWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQVDHNVTRHLEKQIK 195
           SW  QF   G ++RFFGDDTWLKLFP E F +YEGTNSFFVSDFEQVD NVTRH+ +Q++
Sbjct: 135 SWLKQFHSKGYRMRFFGDDTWLKLFPLEFFNDYEGTNSFFVSDFEQVDLNVTRHIPRQLE 194

Query: 196 EKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQDENTLICVMGD 255
           +  DWD LILHYLGLDHIGHKGG  SKFM  KHREMD I+  L++ +  DE+TL+ VMGD
Sbjct: 195 KTEDWDVLILHYLGLDHIGHKGGANSKFMPAKHREMDQIVGKLYDNL--DEDTLLIVMGD 252

Query: 256 HGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQYKFL 315
           HGMN+ GNHGGSS GETSAGLV  SKKL  F++P  Q   +LPI S          Y++L
Sbjct: 253 HGMNDAGNHGGSSAGETSAGLVFFSKKLSKFKIPIRQLNARLPITS------NSSDYQYL 306

Query: 316 TQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIKLQENFRQLMIVSNNKD 375
           TQ+QQ+D+VPTL+AL+N+P PKN+VGV++P  L+LLDP +   KL EN++QL+ +S  + 
Sbjct: 307 TQVQQMDLVPTLAALYNVPIPKNSVGVIIPDFLQLLDPNIIDTKLLENYKQLLELSKVEY 366

Query: 376 IRQLYESYDFENTEIKDIISEMKDIQGELTSSATNYNVPXXXXXXXXXXXXXXXXSFWFY 435
             +L+    F+  +  +    MK +Q +L ++ T Y+                  + + +
Sbjct: 367 DDELFNLNVFDLEKRSECQRIMKTLQEKLIAATTEYDYTMLAIGCFMSLVLTLVMAIFSF 426

Query: 436 FSVLEVDFKNVXXXXXXXXXXXXXXXXXFVEEEHQIWWWIITGLITVSAINLPDQKIAHL 495
           F +    +                    FVEEEHQIWWW+ITG + +SA         H 
Sbjct: 427 FQMASNKYF-FASVLLASILGFSCFGSSFVEEEHQIWWWVITGCLFISAAK-TMHYFEHS 484

Query: 496 VMFVCVRIIRGWNNSGQKYSYDRTISILLNTEYEDFQWYLNIATILYIMLKDSTDNLISF 555
           V+ +C+R+IRGWNN+GQK  Y   IS +L  E    QW LN  T   I L  + +++  F
Sbjct: 485 VILLCLRLIRGWNNTGQKTVYPYVISKILE-ENSTLQWNLNALTFFVISLNGNQNSMWGF 543

Query: 556 MFSYNLGSVCILYKVCWTIINQDHVPEPIYKAAIYICRRLSRDYSLQDISVVEENLIPIA 615
           + S  LG +C+ YK  W ++N++ VP  I +  +  C    +D + +D S     LIP+A
Sbjct: 544 ISSSTLGILCLAYKATWAVVNKEIVPWYI-QNIMDNCASFFQDGNKKDYS---STLIPMA 599

Query: 616 RFFFYSVLAIVI--AIYGSAKLKLIKNPIKDIQKTLTFLLIFQSPSSYIGLFMVYDIXXX 673
            FF +SV AI+    ++G          +K I K +T L++F S S  I  F++++I   
Sbjct: 600 SFFLHSVAAIIFFTLLWGKFNKHHPSFSLKCISKYVTILMMFLSSSVNIPQFLIFEIMRS 659

Query: 674 XXXXXXXXXXXXXXMITSTISLVLQYFTFFQFGGTNSIATADLTNAYNGVSEDYNIYFVG 733
                          +TS ISL LQ F FFQFGGTNSIAT D++NAY+G+SE+YNIY +G
Sbjct: 660 FISKILKKHYNSNIYLTSLISLCLQNFAFFQFGGTNSIATIDISNAYHGISENYNIYVIG 719

Query: 734 FLMCVSNFAPAIYWAMFPWKVIYNQIKPN-NKWNVFAENKLPIVYFNCIAGCFLLLSCFI 792
            LM +SNFAP+IYWAMF W +IY+  + N NKW  F ++K+P   FNCI G  L+L+C +
Sbjct: 720 VLMVLSNFAPSIYWAMFSWDIIYDIKETNFNKWASFTKSKIPTSLFNCIVGLCLMLACVM 779

Query: 793 LRYHLFIWSVFSPKLCYYATWNIFMNLIVGWVLEIAVLSMVD 834
            RYHLF+WSVFSPKLCY+  WN+FMN I GWVLE+ +LS+ +
Sbjct: 780 FRYHLFVWSVFSPKLCYFVGWNLFMNAIFGWVLEVLLLSITN 821

>NDAI0G05740 Chr7 (1421943..1424516) [2574 bp, 857 aa] {ON}
           Anc_1.317 YJL062W
          Length = 857

 Score =  790 bits (2040), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/852 (49%), Positives = 553/852 (64%), Gaps = 51/852 (5%)

Query: 20  FCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQFNYIH 79
           F  GFFP K V++GD+ F+I++  Q   +P FNKLVL+VIDALRSDFLFD   S F+++H
Sbjct: 19  FATGFFPQKTVIKGDSQFQINATLQSQTRPTFNKLVLIVIDALRSDFLFDSQKSHFHFVH 78

Query: 80  ELSNNGYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKNQDSWPM 139
              N G AWGFTA+SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD SS L++QDS   
Sbjct: 79  SQLNKGTAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDISSTLEDQDSLIK 138

Query: 140 QFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQVDHNVTRHLEKQIKEKND 199
           QF   GK ++FFGDDTWLKLFPH  F+E+EGTNSFFVSDFE VD NVTRHL +Q+   ND
Sbjct: 139 QFYMQGKNLKFFGDDTWLKLFPHHWFSEFEGTNSFFVSDFEIVDKNVTRHLPEQLA-AND 197

Query: 200 WDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQ----DENTLICVMGD 255
            D LILHYLGLDHIGHK G +SKFM  KH EMD IIK ++E+       D+NTL+ VMGD
Sbjct: 198 ADVLILHYLGLDHIGHKDGASSKFMKHKHLEMDEIIKMIYESTQYSNEYDDNTLMVVMGD 257

Query: 256 HGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQYKFL 315
           HGMNEVGNHGGSS GETSAG+V +S+KL  +  P +Q   ++P+   N+  E    +++L
Sbjct: 258 HGMNEVGNHGGSSAGETSAGMVFLSEKLAKYSTPQEQMNFEVPLLP-NLNEEGQNNFQYL 316

Query: 316 TQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIKLQENFRQLMIVSNNKD 375
             IQQVD+VPTL+ LF +P PKN+VGV++P  L++LDP++   K++EN+ QL+ +S  K 
Sbjct: 317 NSIQQVDLVPTLATLFGLPIPKNSVGVIIPEFLQMLDPQIISTKIKENYNQLLQLS--KK 374

Query: 376 IRQLYESYDFE-----NTEIKDIISEMKDIQGELTSSATNYNVPXXXXXXXXXXXXXXXX 430
               YE Y+F+     N EI  + +EMK+IQ ELT +ATNYN                  
Sbjct: 375 SANEYE-YNFDSDLDVNQEI--LQNEMKNIQNELTKTATNYNYNLLIIGYSILVISTLFT 431

Query: 431 SF--WFYFSVLEVDFKNVXXXXXXXXXXXXXXXXXFVEEEHQIWWWIITGLITVSAINL- 487
           S   W  +S   + F+ +                 FVEEEHQIWWWI TG ITVS ++  
Sbjct: 432 SLLIWKDYSKKNI-FQLIPITVISIMLGVSTFSSSFVEEEHQIWWWITTGFITVSLVSTL 490

Query: 488 -------PDQKIA-HLVMFVCVRIIRGWNNSGQKYSYDRTISILLNTEYEDFQWYLNIAT 539
                  P + I  HL++F C RI+RGW+NSGQKY YD  +S +L + + + QWYLN+ T
Sbjct: 491 TLQNGFSPLKTILYHLIIFGCARILRGWSNSGQKYIYDHVLSNVLKS-HTNIQWYLNLLT 549

Query: 540 ILYIML-KDSTDNLISFMFSYNLGSVCILYKVCWTIINQDHVPEPIYKAAIYICRRLSRD 598
           IL I   KDST N   F  ++ L  +C +YKV W I+N ++VP+  Y +    C  L   
Sbjct: 550 ILIIGFQKDSTSNFFKFTITFFLSVLCFIYKVNWAIVNNENVPDWFYASTYEACSILIGP 609

Query: 599 YSLQDISVVEENLIPIARFFFYSVLAIVIAIYGSAKLKLIKNP-----IKDIQKTLTFLL 653
            +    +  +++LIP+A  F  +++  +I     +K+ + KN      I DI K +  LL
Sbjct: 610 TA----TTFQDSLIPMANLFLKAIVTTIIGRIIYSKIFIGKNNKDSLLIPDIVKYIKLLL 665

Query: 654 IFQSPSSYIGLFMVYDIX---------XXXXXXXXXXXXXXXXMITSTISLVLQYFTFFQ 704
           IF++ S+ I  F++++I                           +   ISL+LQ FTFFQ
Sbjct: 666 IFETSSTKISQFLIFEIINHIWPKLLNLVKDTSDNDIANSIELSLIPLISLILQNFTFFQ 725

Query: 705 FGGTNSIATADLTNAYNGVSEDYNIYFVGFLMCVSNFAPAIYWAMFPWKVIYNQIK---P 761
           FGGTNSIAT D++NAY+G+SE+YNIY VG  M +SNFAP+IYW +  W  +YN       
Sbjct: 726 FGGTNSIATIDISNAYHGISENYNIYQVGLFMTISNFAPSIYWTIITWPTLYNSTSITNK 785

Query: 762 NNKWNVFAENKLPIVYFNCIAGCFLLLSCFILRYHLFIWSVFSPKLCYYATWNIFMNLIV 821
           N+KW +FA NKLPI++FNCI GC LL SC+ILRYHLFIWSVFSPKLCY+  WN+FMN IV
Sbjct: 786 NSKWIIFASNKLPILFFNCIVGCCLLASCYILRYHLFIWSVFSPKLCYFLGWNLFMNSIV 845

Query: 822 GWVLEIAVLSMV 833
           G+++E  ++++ 
Sbjct: 846 GYIVEGLIVALA 857

>NCAS0A09220 Chr1 complement(1823213..1825708) [2496 bp, 831 aa]
           {ON} Anc_1.317 YJL062W
          Length = 831

 Score =  778 bits (2010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/826 (50%), Positives = 543/826 (65%), Gaps = 30/826 (3%)

Query: 21  CIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQFNYIHE 80
            IGFFP KNVL+G A F  +S+ Q   KP F KLVLVVIDALRSDFLFD+  S F++IH 
Sbjct: 21  AIGFFPQKNVLKGLADFHYNSEQQRETKPVFQKLVLVVIDALRSDFLFDETNSHFHFIHS 80

Query: 81  LSNNGYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKNQDSWPMQ 140
             N G AWGFTA+SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD S+ L +QDS   Q
Sbjct: 81  QLNEGTAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSTTLADQDSLLAQ 140

Query: 141 FAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQVDHNVTRHLEKQIKEKNDW 200
           F    KKI FFGDDTWLKLFP + F E EGTNSFFVSDFE VD NV+RHL KQ+K  +DW
Sbjct: 141 FHLQNKKINFFGDDTWLKLFPRDWFNEVEGTNSFFVSDFEVVDTNVSRHLTKQLKHNHDW 200

Query: 201 DALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQDENTLICVMGDHGMNE 260
           D LI+HYLGLDHIGHK G +SKFM  KH EMD+I++ ++E +  D++TL+ VMGDHGMNE
Sbjct: 201 DVLIMHYLGLDHIGHKDGASSKFMPEKHIEMDNIVRQVYENI--DDDTLLVVMGDHGMNE 258

Query: 261 VGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQYKFLTQIQQ 320
           VGNHGGSS GETSAGLV +S KLK  E+P  Q+ + LPIK      + D+ ++FLT +QQ
Sbjct: 259 VGNHGGSSAGETSAGLVFLSNKLKKGELPLKQRHLNLPIKR-----QTDENFQFLTSVQQ 313

Query: 321 VDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIKLQENFRQLMIVSNNKDIRQLY 380
           +D+VPTL+ LFNIP PKNNVG+++P  L+ L   +  IKL EN+ QL+ +S  +D+  + 
Sbjct: 314 IDLVPTLATLFNIPIPKNNVGIVIPEFLQFLRKDMINIKLMENYHQLLQLSKGQDLPNI- 372

Query: 381 ESYDFENTEIKDIISEMKDIQGELTSSATNYNVPXXXXXXXXXXXXXXXXSFWFYFSVLE 440
               F++ + K+I+++MK+IQ ELT +ATNYN                     F  +   
Sbjct: 373 ---PFDHMDSKNIMNKMKEIQDELTKNATNYNYSYLGRGYLLLIFTTVTVFIVFILNQKS 429

Query: 441 V-DFKNVXXXXXXXXXXXXXXXXXFVEEEHQIWWWIITGLITVSAINL----PDQKIA-- 493
           +     +                 FVEEEHQIWWWIITG I  S I      P +     
Sbjct: 430 LYCATTIITIVISLLVGLSSFGSSFVEEEHQIWWWIITGSIMFSCIETLISNPSKSTVFN 489

Query: 494 HLVMFVCVRIIRGWNNSGQKYSYDRTISILLNTEYEDFQWYLNIATILYIMLKDS-TDNL 552
           H ++ VC RIIRGWNNSGQK+ Y+  ++ +L   Y    WYL   TI YI LK++   + 
Sbjct: 490 HFLIAVCARIIRGWNNSGQKHVYEFILTNILKNHYNTL-WYLICTTIYYIGLKNTIRTDF 548

Query: 553 ISFMFSYNLGSVCILYKVCWTIINQDHVPEPIY---KAAIYICRRLSRDYSLQDISVVEE 609
           +SF+  + + ++C +YK+ W I+N + VPE  Y   K A  I  ++   +S +D    +E
Sbjct: 549 LSFLGPFFMTTLCFVYKLDWAIVNNESVPEWFYVITKEASDILLKVG--HSPKD--AFKE 604

Query: 610 NLIPIARFFFYSVLAIV-IAIYGSAKLKLIKNPIKDIQKTLTFLLIFQSPSSYIGLFMVY 668
            L+P+A  F+ + +A+V I I         K    DI   ++ LLIFQS ++ I  F+V+
Sbjct: 605 ALLPLATLFYQTFVALVSIRIIFLVFFSRRKTFFDDISNYISLLLIFQSTATNIPQFLVF 664

Query: 669 D-IXXXXXXXXXXXXXXXXXMITSTISLVLQYFTFFQFGGTNSIATADLTNAYNGVSEDY 727
           + +                      ISL+LQ FTFFQFGGTNSIAT D++NAY+G+SE+Y
Sbjct: 665 EFLKKSITKVLQNYHQENKNNYLPLISLILQSFTFFQFGGTNSIATIDISNAYHGISENY 724

Query: 728 NIYFVGFLMCVSNFAPAIYWAMFPWKVIYNQI-KPNNKWNVFAENKLPIVYFNCIAGCFL 786
           NIY VG  M +SNFAP+IYW +  W ++Y +I + ++KWN++ +NKLP++ FNCI GC L
Sbjct: 725 NIYLVGIFMTISNFAPSIYWIISMWPILYAEIPESSSKWNIYFKNKLPLLVFNCIVGCCL 784

Query: 787 LLSCFILRYHLFIWSVFSPKLCYYATWNIFMNLIVGWVLEIAVLSM 832
           L +C+ILRYHLFIWSVFSPKLCY+  WN+FMN +VGW++E  ++++
Sbjct: 785 LAACYILRYHLFIWSVFSPKLCYFLGWNVFMNFVVGWLVEGTLVAL 830

>SAKL0D06974g Chr4 complement(576570..579011) [2442 bp, 813 aa] {ON}
           similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062W LAS21 Integral plasma membrane protein involved
           in the synthesis of the glycosylphosphatidylinositol
           (GPI) core structure mutations affect cell wall
           integrity
          Length = 813

 Score =  769 bits (1985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/821 (47%), Positives = 530/821 (64%), Gaps = 27/821 (3%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQF 75
           ++  F IGFFP K+VL+GDA F      Q  + P F KLVLVVIDALRSDFLF +  S+F
Sbjct: 15  AIFTFSIGFFPQKSVLQGDASFLYLPQQQSRSDPVFRKLVLVVIDALRSDFLFQESNSKF 74

Query: 76  NYIHELSNNGYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKNQD 135
           N++H+L N+G AWG+TA+SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD SS+L +QD
Sbjct: 75  NFVHQLLNDGAAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDLSSSLNDQD 134

Query: 136 SWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQVDHNVTRHLEKQIK 195
           SW  QF  + K+I+FFGDDTWLKLFP E F EYEGTNSFFVSDFEQVD NVTRHL  Q  
Sbjct: 135 SWLRQFHNNNKRIKFFGDDTWLKLFPLEFFQEYEGTNSFFVSDFEQVDLNVTRHLPHQFS 194

Query: 196 EKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQDENTLICVMGD 255
            K++WD LILHYLGLDHIGHKGG +S+FM  K  EMD++IK ++E++  D +TL+CVMGD
Sbjct: 195 HKDEWDVLILHYLGLDHIGHKGGSSSRFMPGKQEEMDNVIKQIYESM--DRDTLLCVMGD 252

Query: 256 HGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQYKFL 315
           HGMN++GNHGGSS GETSA L  IS KLK F+ P  Q+   LP+K      E  + YK+L
Sbjct: 253 HGMNDLGNHGGSSNGETSAALTFISPKLKQFQPPVTQRNAHLPLK------EHSENYKYL 306

Query: 316 TQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIKLQENFRQLM-IVSNNK 374
            ++QQ+D+VPTL++LFN+P PKN++G+++   L+L   +L  IK+ +NF QLM I+    
Sbjct: 307 DEVQQIDLVPTLASLFNLPIPKNSLGIIITDFLQLFPGELAEIKITDNFHQLMNIIGETP 366

Query: 375 DIRQLYESYDFENTEIKDIISEMKDIQGELTSSATNYNVPXXXXXXXXXXXXXXXXSFWF 434
                      +  +I++ + +MK IQ  L  + TNYN                  +  F
Sbjct: 367 S----------DTKDIQNSVEKMKRIQSTLAKATTNYNYQLISIGYIILLLVTVATT-GF 415

Query: 435 YFSVLEVDFKNVXXXXXXXXXXXXXXXXXFVEEEHQIWWWIITGLITVSAINLPDQKIAH 494
             S++++++ +                  FVEEE Q+WWWI TG++ +SAI +P + I H
Sbjct: 416 TLSLVKLNYDSALLLGVSFTLGISTFGSSFVEEEQQLWWWISTGILLLSAILVPQEIINH 475

Query: 495 LVMFVCVRIIRGWNNSGQKYSYDRTISILLNTEYEDFQWYLNIATILYIMLKDSTDNL-- 552
           L++F C+R+IRGWNNSGQK+ YD T+  LL   +  + W LN  TI       +      
Sbjct: 476 LLVFTCLRLIRGWNNSGQKFIYDCTLYELLKV-HTSWNWALNALTIFVTSFTCTLGERGP 534

Query: 553 ISFMFSYNLGSVCILYKVCWTIINQDHVPEPIYKAAIYICRRLSRDYSLQDISVVEENLI 612
           +SF+ S+ L ++C++YK  W+++N + + + +       C  L  D   +D+    ++L+
Sbjct: 535 LSFVSSFLLATLCLVYKGTWSVVNGEQISQWLKAVIRKSCILLLDDTDNRDM--YTDSLV 592

Query: 613 PIARFFFYSVLAIVIAIYGSAKLKLIKNP-IKDIQKTLTFLLIFQSPSSYIGLFMVYDIX 671
           P+AR FF   L +++      KL   K    KDI   ++ +LI Q+ S+ I  F+V+ I 
Sbjct: 593 PMARLFFQITLTLILFRIALNKLMDRKTKYFKDIHSIVSMILILQTSSANIPQFLVFWIL 652

Query: 672 XXXXXXXXXXXXXXXXMITSTISLVLQYFTFFQFGGTNSIATADLTNAYNGVSEDYNIYF 731
                           ++   ISL+LQ  TFFQFGGTNSIAT +LTNAYNG+S DYNI+ 
Sbjct: 653 QDRLKYLLTAYTPSDCLVM-VISLILQNLTFFQFGGTNSIATVNLTNAYNGISGDYNIHV 711

Query: 732 VGFLMCVSNFAPAIYWAMFPWKVIYNQIKPNNKWNVFAENKLPIVYFNCIAGCFLLLSCF 791
           VG LMC+ NFAP+IYW+M     ++   K  +KW +F   +LP + F  I GCF++ SC 
Sbjct: 712 VGLLMCIGNFAPSIYWSMATLPTLFENKKNTDKWEIFFATRLPALMFYSIIGCFIMGSCV 771

Query: 792 ILRYHLFIWSVFSPKLCYYATWNIFMNLIVGWVLEIAVLSM 832
           ILRYHLFIWSVFSPKLCYY TWN+FMN +V W  E  ++++
Sbjct: 772 ILRYHLFIWSVFSPKLCYYVTWNVFMNFMVSWCAEGLLVAL 812

>KLTH0H10736g Chr8 complement(924558..926990) [2433 bp, 810 aa] {ON}
           similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062W LAS21 Integral plasma membrane protein involved
           in the synthesis of the glycosylphosphatidylinositol
           (GPI) core structure mutations affect cell wall
           integrity
          Length = 810

 Score =  767 bits (1980), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/831 (47%), Positives = 534/831 (64%), Gaps = 48/831 (5%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQF 75
           ++L F  GFFP K+VL+GDA F    +A     P F K+VLV++DALRSDF+F +D+S+F
Sbjct: 15  AILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALRSDFVFQKDMSEF 74

Query: 76  NYIHELSNNGYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKNQD 135
            ++H+L N G+AWG+TA+SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD SSNLK QD
Sbjct: 75  GFLHKLLNKGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSNLKEQD 134

Query: 136 SWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQVDHNVTRHLEKQIK 195
           SW  QF  H KKI+FFGDDTWLKLFP E F E +GTNSFFVSDFE+VD NVTRHL +Q++
Sbjct: 135 SWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEEVDLNVTRHLPQQLQ 194

Query: 196 EKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQDENTLICVMGD 255
            ++ WD LILHYLGLDHIGHKGG  S FM PKHREMD++I+ ++  VG+D  TLICVMGD
Sbjct: 195 SQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNAVGED--TLICVMGD 252

Query: 256 HGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQYKFL 315
           HGMN++GNHGGSS GETSA LV ISK L+ +E P  Q+G  +P+ S   +PE    Y +L
Sbjct: 253 HGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVAS--SSPE----YNYL 306

Query: 316 TQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIKLQENFRQLMIVSNNKD 375
           T++ Q+D VPT++ LFN+P PKN++GV++P  L+LL P   + K+ +N++QL+ +S    
Sbjct: 307 TKVNQIDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTKVIDNYQQLLSISGGST 366

Query: 376 IRQLYESYDFENTEIKDIISEMKDIQGELTSSATNYNVPXXXXXXXXXXXXXXXXSFWFY 435
            +           +   II EM+++Q +L  +ATNYN                  + +F 
Sbjct: 367 KKL---------GDPDAIIEEMREVQSDLAKTATNYNY-LLLGIGFLTLLVVSSVALFFS 416

Query: 436 FSVLEVDFKNVXXXXXXXXXXXXXXXXXFVEEEHQIWWWIITGLITVSAINLPDQKIAHL 495
           ++     F                    F+EEEHQIWWW    L+ +S I+ P +   HL
Sbjct: 417 WTSFPSTFGLFLLLGTSLLLSLSTFGSSFIEEEHQIWWWTSIALVGLSYISAPRELGDHL 476

Query: 496 VMFVCVRIIRGWNNSGQKYSYDRTISILLNTEYEDFQWYLNIATILYIMLKDSTDNLISF 555
            +   +R+IRGWNNSGQK+ Y+ T+  LL   Y+  +W L   TI  +  +       +F
Sbjct: 477 TVLAVLRLIRGWNNSGQKFVYEYTLYELLKQHYQ-VEWLLITTTIFVVQFQGRAKGFSAF 535

Query: 556 MFSYNLGSVCILYKVCWTIINQDHVPEPIYKAAIYICRRLSRDYSL-----QDISVVEEN 610
            +S+ +  +C++YK  W+I+N + VP  +     +IC    R YS+     +D     + 
Sbjct: 536 QYSFLMSVLCLVYKATWSIVNNEQVPAWLQ----HICL---RSYSIMKGVSKDQIDFSDA 588

Query: 611 LIPIARFFFYSVLAIVIAIYGSAKLKLIKNPIK--------DIQKTLTFLLIFQSPSSYI 662
           L+P+AR FF  V A VIA+      ++I++  K        +I   ++ LLI Q+ S+ I
Sbjct: 589 LVPMARLFF-QVTAAVIAV------EVIRHQFKPNGPRLLEEIHAHISTLLILQTSSANI 641

Query: 663 GLFMVYDIXXXXXXXXXXXXXXXXXMITSTISLVLQYFTFFQFGGTNSIATADLTNAYNG 722
             F+ + I                 ++  T++LVLQ+ +FFQFG TNSIAT  LTNAYNG
Sbjct: 642 PQFLAFHILSRKLNSLWSRRQWSFPVLM-TVNLVLQHLSFFQFGNTNSIATVSLTNAYNG 700

Query: 723 VSEDYNIYFVGFLMCVSNFAPAIYWAMFPWKVIYNQIKPNNKWNVFAENKLPIVYFNCIA 782
           VSE+YNIY VG LMCVSNFAP+IYW++   K++Y++    +KW  F  ++LP   + C+ 
Sbjct: 701 VSENYNIYVVGALMCVSNFAPSIYWSLSCLKILYSK-STQSKWETFFTSRLPSFLYYCLF 759

Query: 783 GCFLLLSCFILRYHLFIWSVFSPKLCYYATWNIFMNLIVGWVLEIAVLSMV 833
           GCFLL SC ILRYHLFIWSVFSPKLCYY +WN+FMN I+ W  E  +++++
Sbjct: 760 GCFLLGSCVILRYHLFIWSVFSPKLCYYVSWNLFMNAIIAWFFEGTLVALL 810

>Kwal_14.2587 s14 complement(824261..826687) [2427 bp, 808 aa] {ON}
           YJL062W (LAS21) - putative membrane protein, a member of
           the major facilitator super family [contig 224] FULL
          Length = 808

 Score =  756 bits (1952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/824 (48%), Positives = 530/824 (64%), Gaps = 41/824 (4%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQF 75
           ++L F  GFFP K+VL+GDA F    D Q    P FNKLVL+VIDALRSDF+F +D+S F
Sbjct: 15  AILTFSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDALRSDFVFQKDMSNF 74

Query: 76  NYIHELSNNGYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKNQD 135
            ++H L N G AWG+TA+SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLK QD
Sbjct: 75  EFVHGLLNRGQAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKEQD 134

Query: 136 SWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQVDHNVTRHLEKQIK 195
           SW  QF  + K+I+FFGDDTWLKLFP E F E +GTNSFFVSDFE+VD NVTRHL KQ+ 
Sbjct: 135 SWLRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEEVDFNVTRHLPKQLA 194

Query: 196 EKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQDENTLICVMGD 255
            ++ WD LILH+LGLDHIGHKGG  S FM PK REMD +I+ ++ +VG+D  TLICVMGD
Sbjct: 195 TQDSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNSVGED--TLICVMGD 252

Query: 256 HGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQYKFL 315
           HGMN++GNHGGSS GETSAGL+ IS+ L+ +E P  Q     PIK+ N        Y ++
Sbjct: 253 HGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKN------DDYSYV 306

Query: 316 TQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIKLQENFRQLMIVSNNKD 375
           +++ Q+D+VP++S+LFN P PKN++GV+MP +L LL PK  ++KL +N+ QL  +S +  
Sbjct: 307 SKVNQIDLVPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLMDNYLQLTTISGDL- 365

Query: 376 IRQLYESYDFENTEIKDII-SEMKDIQGELTSSATNYNVPXXXXXXXXXXXXXXXXSFWF 434
                      N+  +D+I   M+DIQG+L  +AT YN                      
Sbjct: 366 ---------MANSSDQDVIYQHMRDIQGDLAKNATKYNYFMLGFGFSLLFITAIAT---- 412

Query: 435 YFSVLEVDFKN---VXXXXXXXXXXXXXXXXXFVEEEHQIWWWIITGLITVSAINLPDQK 491
            F +L+        V                 FVEEEHQ+WWW+   L   S    P + 
Sbjct: 413 -FLLLKPTISKPALVLLIGVSLLLSLSTFGSSFVEEEHQLWWWLAIALTGASYTQAPSEI 471

Query: 492 IAHLVMFVCVRIIRGWNNSGQKYSYDRTISILLNTEYEDFQWYLNIATILYIMLKDSTDN 551
             HL++ +C+R+IRGWNNSGQKY+Y+ T+  +L  +Y+  QW L   TI     +     
Sbjct: 472 KEHLIILLCLRLIRGWNNSGQKYTYEHTLLEILKQKYQ-LQWLLITLTIFVTQFRAKNKG 530

Query: 552 LISFMFSYNLGSVCILYKVCWTIINQDHVPEPIYKAAIYICRRLSRDYSLQDISVVEENL 611
           L+SF  S+ + ++C++YK  W+I+N + VP  + +  +     ++ + + Q  + ++E+L
Sbjct: 531 LVSFQCSFLVSTLCLIYKATWSIVNGEKVPSWLQRVVMKSFSIMNGENNSQ--ADLKESL 588

Query: 612 IPIARFFFYSVLA-----IVIAIYGSAKLKLIKNPIKDIQKTLTFLLIFQSPSSYIGLFM 666
           +P+AR FF ++LA     IV+  +   + + + N    IQ   T  LI Q+  + I  F+
Sbjct: 589 VPMARLFFKTILAVTLLEIVLHKWNPDRKRFLHN----IQAYCTAFLILQTSPANIPQFL 644

Query: 667 VYDIXXXXXXXXXXXXXXXXXMITSTISLVLQYFTFFQFGGTNSIATADLTNAYNGVSED 726
           VY I                 ++     +VLQ   FFQFG TNSIAT +LTNAYNG+SE+
Sbjct: 645 VYLILSEKLESVWRRREWSPSILM-LAGIVLQNLAFFQFGNTNSIATVNLTNAYNGISEN 703

Query: 727 YNIYFVGFLMCVSNFAPAIYWAMFPWKVIYNQIKPNNKWNVFAENKLPIVYFNCIAGCFL 786
           YNIY VGFLMCVSNFAP+IYW++   K++Y+     +KW +F  +++P   F CI GCFL
Sbjct: 704 YNIYVVGFLMCVSNFAPSIYWSLNCLKILYS-FPVKDKWKIFLASRMPSFLFYCIFGCFL 762

Query: 787 LLSCFILRYHLFIWSVFSPKLCYYATWNIFMNLIVGWVLEIAVL 830
           L SC ILRYHLFIWSVFSPKLCYY +WNIFMN ++GW++E  +L
Sbjct: 763 LGSCVILRYHLFIWSVFSPKLCYYVSWNIFMNAVIGWLVEATLL 806

>CAGL0J05236g Chr10 complement(504544..507072) [2529 bp, 842 aa]
           {ON} similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062w LAS21
          Length = 842

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/841 (47%), Positives = 539/841 (64%), Gaps = 38/841 (4%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQF 75
           +VLIF  GFFP K VL+G A      D      P F+KLV+VV+DA+RSDFLFD  IS+F
Sbjct: 12  AVLIFGCGFFPQKKVLDGHAAL----DGTHARDPVFDKLVVVVVDAMRSDFLFDASISKF 67

Query: 76  NYIHELSNNGYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKNQD 135
           ++IHE   +G AWGFTA SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD+SS+L  QD
Sbjct: 68  HFIHEKLADGSAWGFTAHSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDTSSSLLAQD 127

Query: 136 SWPMQFAKH-GKKIRFFGDDTWLKLFP--------HEIFTEYEGTNSFFVSDFEQVDHNV 186
           SW  QF  + GK+IRFFGDDTWLKLFP          +F EYEGTNSFFVSDF QVD NV
Sbjct: 128 SWLWQFRNNAGKRIRFFGDDTWLKLFPPVEANEDSQTMFDEYEGTNSFFVSDFTQVDLNV 187

Query: 187 TRHLEKQIKEKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQDE 246
           TRH+++Q++E ++WD LILHYLGLDHIGHK GP S+FMGPKH EMDSII+ L++ +   +
Sbjct: 188 TRHIDRQLRETSEWDVLILHYLGLDHIGHKDGPYSRFMGPKHEEMDSIIRKLYDELDM-Q 246

Query: 247 NTLICVMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVK-LPIKSVNVA 305
           +TL+ +MGDHGMN++GNHGGSS GETSAG+V +S KL  ++   +Q   K  P+K  ++ 
Sbjct: 247 STLLVLMGDHGMNDLGNHGGSSAGETSAGMVFLSDKLAAYKPSKEQSSAKEFPMKIPSLN 306

Query: 306 PEEDKQYKFLTQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELL-DPKLFRIKLQENF 364
             E+K + +L +IQQ+D+VPT+S+LFN+  PKNNVGV++P  L+L  D  L +  ++EN+
Sbjct: 307 AGEEKTFHYLKKIQQIDVVPTISSLFNVAIPKNNVGVIIPEFLQLFKDVSLQKAIVKENW 366

Query: 365 RQLMIVSNNKDIRQLYESYDFENTEIKDIISEMKDIQGELTSSATNYNVPXXXXXXXXXX 424
            QL  ++  K   Q+ E  + +N  I+D+I  MKD+Q  L  +AT+YN P          
Sbjct: 367 NQLSGLTKGK--TQIME--ETKNFVIEDVIKNMKDVQENLAKTATDYNYPLLFIGCFLSI 422

Query: 425 XXXXXXSFWFYFSVLEVDFKNVXXXXXXXXXXXXXXXXXFVEEEHQIWWWIITGLITVSA 484
                  ++ Y   + ++                     F+EEEHQ WWWIITGL+ +S 
Sbjct: 423 VITGTI-YYRYARHVAININTSILIAIAALMGISVFGSSFIEEEHQFWWWIITGLVLLSM 481

Query: 485 INLP-DQKIAHLVMFVCVRIIRGWNNSGQKYSYDRTISILLNTEYEDFQWYLNIATILYI 543
           +NL      +H+++  C+R+IRGWNNSGQKY+YD  I+ LL     D  W+LN+ T+  +
Sbjct: 482 VNLNFSSWKSHIIVLFCLRLIRGWNNSGQKYTYDNVIANLLKGNI-DALWWLNLITVTVV 540

Query: 544 MLK-------DSTDNLISF--MFSYNLGS-VCILYKVCWTIINQDHVPEPIYKAAIYICR 593
            L        + T +L+ F  + S  L S +  LYKV W+I+N + VP+  YK  +    
Sbjct: 541 GLNLKSLRFGNHTVSLLGFSDLLSMGLLSMITFLYKVNWSIVNGERVPDLFYKWVLETAS 600

Query: 594 RLSRDYSL-QDISVVEENLIPIARFF---FYSVLAIVIAIYGSAKLKLIKNPIKDIQKTL 649
            +  D +L ++  ++   LIP+AR F   F++VL   + I    ++  I   +  + + +
Sbjct: 601 LIVEDATLYREEDLIHTALIPLARIFFKLFFAVLVSRLMIQKFFQVSDISKSLAVVSRYV 660

Query: 650 TFLLIFQSPSSYIGLFMVYDIXXXXXXXXXXXXXXXXXMITSTISLVLQYFTFFQFGGTN 709
           T  L+FQ+PS  IGLF+ ++I                 ++     ++LQ+FTFFQ GGTN
Sbjct: 661 TIFLVFQTPSHNIGLFLFFEIINEITVHIIRERYQSDYLLAVIFGIILQFFTFFQSGGTN 720

Query: 710 SIATADLTNAYNGVSEDYNIYFVGFLMCVSNFAPAIYWAMFPWKVIYNQIKPNNKWNVFA 769
           SIAT DL+NAYNGVSE+YNIY VG +MC+SNFAP IYW+ + W++ Y     +++W    
Sbjct: 721 SIATVDLSNAYNGVSENYNIYVVGLMMCISNFAPTIYWSFYNWRITYANAN-SSRWQTLV 779

Query: 770 ENKLPIVYFNCIAGCFLLLSCFILRYHLFIWSVFSPKLCYYATWNIFMNLIVGWVLEIAV 829
             K P +      GC LLL+C ILRYHLFIWSVFSPKLCYY  W IF+ +IV W+ EI +
Sbjct: 780 AAKYPFIIIQSTIGCCLLLACIILRYHLFIWSVFSPKLCYYMVWTIFVGIIVHWIPEILL 839

Query: 830 L 830
           L
Sbjct: 840 L 840

>AEL166C Chr5 complement(322853..325273) [2421 bp, 806 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL062W
           (LAS21)
          Length = 806

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/812 (48%), Positives = 511/812 (62%), Gaps = 29/812 (3%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQF 75
           +VLIF  GFFP K VL+GDA F+  ++ Q   +PAF+KLVLVVIDALR+DFLF Q++S F
Sbjct: 15  AVLIFAAGFFPQKKVLKGDAQFQYMAETQRALEPAFDKLVLVVIDALRADFLFQQNVSHF 74

Query: 76  NYIHELSNNGYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKNQD 135
           +++HEL N G AWGFTA+SNPPTVTLPRLKGITTGS PNFLDAILNVAEDDSSSNLK+QD
Sbjct: 75  DFVHELLNRGEAWGFTAYSNPPTVTLPRLKGITTGSAPNFLDAILNVAEDDSSSNLKDQD 134

Query: 136 SWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQVDHNVTRHLEKQIK 195
           SW  QFAKHGKKI FFGDDTWLKLFP E F +++GTNSFFVSDFE+VD NVTRHL  +++
Sbjct: 135 SWISQFAKHGKKIHFFGDDTWLKLFPEEFFQKHDGTNSFFVSDFEEVDTNVTRHLPHELQ 194

Query: 196 EKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQDENTLICVMGD 255
            K DWD LILHYLGLDHIGHKGG  S+FM PKHREMD++I+ +++ V  D  TL+CVMGD
Sbjct: 195 HK-DWDVLILHYLGLDHIGHKGGAASQFMPPKHREMDAVIRQIYDQV--DNRTLLCVMGD 251

Query: 256 HGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQYKFL 315
           HGMN++GNHGGSS GETSAG+V ISK L ++  P+ Q GV  P+ +      ED  Y+F 
Sbjct: 252 HGMNDLGNHGGSSAGETSAGMVFISKMLSSYPRPAAQDGVSSPVTAA-----ED--YQFF 304

Query: 316 TQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIKLQENFRQLMIVSNNKD 375
           T+IQQVD VPT+++LFNIP PKN++GV +     LL       K+ EN+ QLM ++  K 
Sbjct: 305 TRIQQVDFVPTIASLFNIPIPKNSLGVFVREFSSLLGQHA-TTKIIENYHQLMQLAAKKT 363

Query: 376 IRQLYESYDFENTEIKDIISEMKDIQGELTSSATNYNVPXXXXXXXXXXXXXXXXSFWFY 435
             +        N +I  +++EMKD+Q  L  +ATNYN                  ++  Y
Sbjct: 364 AAR-------GNDDIDSMLAEMKDVQATLARTATNYNYAMLFLGVGMLSIVTAATAYC-Y 415

Query: 436 FSVLEVDFKNVXXXXXXXXXXXXXXXXXFVEEEHQIWWWIITGLITVSAINLPDQKIAHL 495
            S   ++  +V                 FVEEEHQIWWWII  ++  S    P    +HL
Sbjct: 416 ISSARLNEASVLMIAVTALLGSSVFGSSFVEEEHQIWWWIIIAVVGYSWATRPSCTPSHL 475

Query: 496 VMFVCVRIIRGWNNSGQKYSYDRTISILLNTEYEDFQWYLNIATILYIMLKDSTDNLISF 555
           V  VC R++RGWNNSGQK+ YD T++ LL + +   +W L  AT+  + L   T+  +  
Sbjct: 476 VFLVCARLLRGWNNSGQKFMYDFTVAELLKS-HPSIKWLLVCATLAVVALDGFTERPLLS 534

Query: 556 MFSYNLGSVCILYKVCWTIINQDHVPEPIYKAAIYICRRLSRDYSLQDISVVEENLIPIA 615
           +F+   G +  +YK CW  +N +  P          C  L    +  D    ++ L+P+A
Sbjct: 535 IFNLLAGLLWFVYKTCWANVNGEVSPTYAQTLVTKACSLLFAGGTPWDD---KQLLVPLA 591

Query: 616 RFFFYSVLAIVIAIYGSAKLKLIKNPIKDIQKTLTFLLIFQSPSSYIGLFMVYDIXXXXX 675
           R FF    AIV        +   +  + ++    T +LI Q+ S  I LF+V+ I     
Sbjct: 592 RLFFKVTAAIVCMRIAYNVVFAKRKFLSELFPLFTIVLIMQTASQNIPLFLVFTIMRSSL 651

Query: 676 XXXXXXXXXXXXM-ITSTISLVLQYFTFFQFGGTNSIATADLTNAYNGVSEDYNIYFVGF 734
                         +   +SL+LQ  +FFQFGGTNSIAT DLTN+YNG+SE+YNIY VG 
Sbjct: 652 RNILRVGYPQQRCEMFFVLSLILQNLSFFQFGGTNSIATIDLTNSYNGISENYNIYVVGL 711

Query: 735 LMCVSNFAPAIYWAMFPWKVIYNQIKPNNKWNVFAENKLPIVYFNCIAGCFLLLSCFILR 794
           LMC+ N APAIYW++    V+ +Q+        +A+ KL  ++F  +    LL++C  +R
Sbjct: 712 LMCIGNMAPAIYWSLA--AVVDHQLYSKKS---YAQQKLSSMFFYSVNSLLLLVACICMR 766

Query: 795 YHLFIWSVFSPKLCYYATWNIFMNLIVGWVLE 826
           YHLFIWSVFSPKLCY   WNI ++ +   VLE
Sbjct: 767 YHLFIWSVFSPKLCYLLGWNILIHFLTETVLE 798

>Ecym_6288 Chr6 (540338..542758) [2421 bp, 806 aa] {ON} similar to
           Ashbya gossypii AEL166C
          Length = 806

 Score =  732 bits (1890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/821 (46%), Positives = 525/821 (63%), Gaps = 30/821 (3%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQF 75
           ++L F IGFFP K+VL GD+ F    +     +P F K+V++VIDALRSDFLF  ++S F
Sbjct: 15  AILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDALRSDFLFQANVSGF 74

Query: 76  NYIHELSNNGYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKNQD 135
           +++H+L N G AWG+TA+SNPPTVTLPRLKGITTGS PNFLDAILNVAEDD+SSNLK+QD
Sbjct: 75  HFVHDLINKGEAWGYTAYSNPPTVTLPRLKGITTGSMPNFLDAILNVAEDDTSSNLKDQD 134

Query: 136 SWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQVDHNVTRHLEKQIK 195
           SW  Q  KHGK+I F+GDDTWLKLFP   F   +GTNSFFVSDFE+VD NVTRHL   + 
Sbjct: 135 SWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFFVSDFEEVDRNVTRHLPYDLS 194

Query: 196 EKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQDENTLICVMGD 255
            + +WD LILHYLGLDHIGHKGG  S+FM PKH EMD++IK++++ V  DE TL+CV+GD
Sbjct: 195 YQ-EWDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAV--DERTLVCVLGD 251

Query: 256 HGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQYKFL 315
           HGMN++GNHGGSS GETSA +V ISKKL N++ P  Q+GV++P+ +       D  Y++L
Sbjct: 252 HGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLIN------SDGDYQYL 305

Query: 316 TQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIKLQENFRQLMIVSNNKD 375
           T+IQQVDIVPTL +LFN P P+N+VG+++   L LL      IK+++NFRQLM ++NN  
Sbjct: 306 TRIQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLLG-TFAEIKVKDNFRQLMKLANNTP 364

Query: 376 IRQLYESYDFENTEIKDIISEMKDIQGELTSSATNYNVPXXXXXXXXXXXXXXXXSFWFY 435
                   +F    I  ++ +MK  Q +L ++ATNYN                  S  FY
Sbjct: 365 --------EFAGASIDMLLEQMKITQDDLATAATNYNYIFLIIGLSILCFITIIISCEFY 416

Query: 436 FSVLEVDFKNVXXXXXXXXXXXXXXXXXFVEEEHQIWWWIITGLITVSAINLPDQKIAHL 495
            +  +    ++                 FVEEEHQIWWWI+T  + +S +  P     H 
Sbjct: 417 RTFKQTKILSL-TVAISLSLGLSMFSSSFVEEEHQIWWWILTAAVGISWVMNPSLTWDHF 475

Query: 496 VMFVCVRIIRGWNNSGQKYSYDRTISILLNTEYEDFQWYLNIATILYIMLKDSTDNLISF 555
           ++ VC R+IRGWNNSGQKY Y+ TI  +L   Y + +W +N AT+  +  +    NL++F
Sbjct: 476 LVSVCARLIRGWNNSGQKYIYENTIYQILE-RYPNTKWLINAATMFLVAFETVEFNLMTF 534

Query: 556 MFSYNLGSVCILYKVCWTIINQDHVPEPIYKAAIYICRRLSRDYSLQDISVVEENLIPIA 615
           + S+   ++C+ YK CWT++N+  VP  +       C  L     +   ++++E L+P+A
Sbjct: 535 VSSFVTVTLCLAYKGCWTLVNEGLVPNWLQAFVNMTCSFL-----IGPDNMLKEALVPLA 589

Query: 616 RFFFYSVLAIVIAIYGSAKLKLIKNPIKDIQKTLTFLLIFQSPSSYIGLFMVYDIXXXXX 675
           R  F S+LA ++      + K     ++ I   +  +L+ Q+  S I LF+++ +     
Sbjct: 590 RLCFQSILASIVFRVCYNRFKSSPKTLQSIIPLINTILVLQTSPSNIPLFLLFTVMKIAI 649

Query: 676 XXXXXXXXXX-XXMITSTISLVLQYFTFFQFGGTNSIATADLTNAYNGVSEDYNIYFVGF 734
                         I+  +SL++Q FTFFQFGGTNSIAT +LTN+YNGVS+ YNIY VGF
Sbjct: 650 NRILTNLSSNDLSQISCILSLIMQNFTFFQFGGTNSIATINLTNSYNGVSQSYNIYVVGF 709

Query: 735 LMCVSNFAPAIYWAMFPWKVIYNQIKPNNKWNVFAENKLPIVYFNCIAGCFLLLSCFILR 794
           L  +SNFAP IYW++    +I    +PN K     E +LPI++   + G FLL+SC  LR
Sbjct: 710 LTFISNFAPVIYWSL---NLIEVYQEPNKKHTYLVE-RLPILFHYSVTGVFLLISCLALR 765

Query: 795 YHLFIWSVFSPKLCYYATWNIFMNLIVGWVLEIAVLSMVDK 835
           YHLFIWSVFSPKLCYY  W+I +N ++  +    +L++ +K
Sbjct: 766 YHLFIWSVFSPKLCYYIAWSILINGLLEHLFNPLLLTVTNK 806

>KNAG0C05830 Chr3 (1132645..1135137) [2493 bp, 830 aa] {ON}
           Anc_1.317 YJL062W
          Length = 830

 Score =  731 bits (1886), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/825 (47%), Positives = 530/825 (64%), Gaps = 36/825 (4%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNA---KPAFNKLVLVVIDALRSDFLFDQDI 72
           ++ IFC+GFFP K VL+G A F   +  +L +   +P FNK +LVV+DALRSDF+FD   
Sbjct: 15  AIFIFCLGFFPQKKVLKGQAEFNPENLDRLGSNREEPVFNKFILVVVDALRSDFIFDSHN 74

Query: 73  SQFNYIHELSNNGYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLK 132
           S F+++H   N+G AWGFTAFS+PPTVTLPRLKGITTGSTPNFLDA+LNVAEDD +S +K
Sbjct: 75  SHFDFVHSKLNSGEAWGFTAFSSPPTVTLPRLKGITTGSTPNFLDALLNVAEDDQTSTIK 134

Query: 133 NQDSWPMQFAKHG-KKIRFFGDDTWLKLF--PHEIFTEYEGTNSFFVSDFEQVDHNVTRH 189
            QDSW  QF  +G + IRFFGDDTWLKLF   +E F E+EGTNSFFVSDF QVD NVTRH
Sbjct: 135 EQDSWINQFLTNGNQSIRFFGDDTWLKLFAPANETFQEWEGTNSFFVSDFTQVDLNVTRH 194

Query: 190 LEKQIKEKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQDENTL 249
           +  Q++EK+ WD LILHYLGLDHIGHKGG  S FM  KH+EMD+++K+L+E V  D +TL
Sbjct: 195 IPTQLQEKDQWDTLILHYLGLDHIGHKGGAYSHFMPEKHKEMDNVLKDLYENV--DPDTL 252

Query: 250 ICVMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEED 309
           I VMGDHGMN+VGNHGGSSPGET AGLV +S+KL  F  P  Q    +P+ +  V  + D
Sbjct: 253 IVVMGDHGMNDVGNHGGSSPGETHAGLVFLSEKLSRFPKPHSQYET-IPLNT-PVTADGD 310

Query: 310 KQYKFLTQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIKLQENFRQLMI 369
           K +++LTQ+QQVDIVPTL+ LFN+P PKN+VG+++   + LLD  L   K+ EN++QL  
Sbjct: 311 KTFEYLTQVQQVDIVPTLATLFNVPIPKNSVGILIKDFIPLLDKHLREAKVGENYQQLFT 370

Query: 370 VSNNKDIRQLYESYDFENTEIKDIISEMKDIQGELTSSATNYNVPXXXXXXXXXXXXXXX 429
           +SN+ +   +  + D       ++  +M+ +Q  LT +AT+YN                 
Sbjct: 371 LSNSMETVNVGLTVD-------EMYEKMRAVQENLTRNATDYN---YRALVPGYVILVCV 420

Query: 430 XSFWFYFSVLEVDFKN--VXXXXXXXXXXXXXXXXXFVEEEHQIWWWIITGLITVSAINL 487
            ++    +V  +      V                 FVEEEHQ+WWW+ITG I  +    
Sbjct: 421 TAYCLILAVQRMRLSGAFVALLGISFLTGISMFGSSFVEEEHQLWWWVITGSILFTLAFR 480

Query: 488 PDQ---KIAHLVMFVCVRIIRGWNNSGQKYSYDRTISILLNTEYEDFQWYLNIATILYIM 544
                   + + + + VR+IRGWNN+GQK +Y   I  +L   +   +W LN+   L + 
Sbjct: 481 QSSWHTTSSCITLSLAVRLIRGWNNTGQKTTYTYVIGNIL-AAHPTIKWNLNVLAFLAV- 538

Query: 545 LKDSTDNLISFMFSYNLGSVCILYKVCWTIINQDHVPEPIYKAAIYICRRLSRDYSLQDI 604
            + +T++L+SF     L  V + YK+ W ++N+++VP   ++  + I  RL +    +DI
Sbjct: 539 CQSNTESLMSFCGHIVLIVVALAYKINWALVNKENVPVYAFQ-FLQIIGRLIKVNVGEDI 597

Query: 605 SVVEENLIPIARFFFYSVLAIVIAIYGSAKLKL--IKNPIKDIQKTLTFLLIFQSPSSYI 662
             +EE LIP+AR F+  VL+  +     AK++L    + IKDI K    LL+F S +S I
Sbjct: 598 ENLEEALIPLARVFYRLVLSFTVVKIVLAKIRLQPPHSLIKDISKNFVVLLMFLSSTSNI 657

Query: 663 GLFMVYDIXXXXXXXXXXXXXXXXXMITSTISLVLQYFTFFQFGGTNSIATADLTNAYNG 722
             F++++I                  IT+ +SL+LQ FTFFQFG TNSIAT DL+NAY+G
Sbjct: 658 PQFLIFEIMKVCITQIIKDEYGSDISITAIVSLILQNFTFFQFGRTNSIATIDLSNAYHG 717

Query: 723 VSEDYNIYFVGFLMCVSNFAPAIYWAMFPWKVIYNQIKPNN----KWNVFAENKLPIVYF 778
           +SE+YNIY VG+LM +SNFAPA+YWA++PW + Y  + P      +W  FA+ KLPI  F
Sbjct: 718 ISENYNIYAVGWLMVISNFAPALYWAIYPWNITY--VTPTGICKARWLRFAKGKLPITLF 775

Query: 779 NCIAGCFLLLSCFILRYHLFIWSVFSPKLCYYATWNIFMNLIVGW 823
           N + GC LL +C  LRYHLFIWSVFSPKLCYY  WN+FM  I+GW
Sbjct: 776 NGLVGCCLLAACVALRYHLFIWSVFSPKLCYYVFWNLFMASIIGW 820

>Skud_10.159 Chr10 complement(299147..301642) [2496 bp, 831 aa] {ON}
           YJL062W (REAL)
          Length = 831

 Score =  704 bits (1817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/839 (45%), Positives = 509/839 (60%), Gaps = 43/839 (5%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQF 75
           ++L+F   FFP K VL G +  +   D  L     F KLV V+IDALRSDFLFD  IS F
Sbjct: 16  AILLFIFAFFPRKIVLTGISQQDPDEDRDLQHNRPFQKLVFVIIDALRSDFLFDAQISHF 75

Query: 76  NYIHELSNNGYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKNQD 135
           N +H+  N G AWG+T+F+NPPTVTLPRLK ITTGSTP+F+D +LNVA+D  S++L   D
Sbjct: 76  NNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDIDSNDLSEHD 135

Query: 136 SWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQVDHNVTRHLEKQI- 194
           SW  QF +H   IRF GDDTWLKLFPHE F   + T+SFFVSDF QVD+NVTR+L+K++ 
Sbjct: 136 SWLQQFIQHNNTIRFMGDDTWLKLFPHEWFDFADPTHSFFVSDFTQVDNNVTRNLQKKLF 195

Query: 195 KEKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQDEN---TLIC 251
           +E   WD  ILHYLGLDHIGH+ GP SKFMG KH+EMDSI+K++++ V + EN   TLIC
Sbjct: 196 QEWAQWDVAILHYLGLDHIGHRDGPHSKFMGTKHQEMDSILKSIYDQVLEHENDDDTLIC 255

Query: 252 VMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQ 311
           V+GDHGMNE+GNHGGSS GETSAGL+ +S KL  F  P  Q+   LPI   N  P+ D Q
Sbjct: 256 VLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSRFAKPEPQETHILPI---NGTPDHDFQ 312

Query: 312 YKFLTQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIKLQENFRQLMIVS 371
           Y  L  +QQ+DIVPT++ALF +P P N+VG+++P  L+LL  KL  +K  ENF  L  +S
Sbjct: 313 Y--LESVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKLASMK--ENFMHLWRLS 368

Query: 372 NNKDIRQLYESYDFENTEIKDIISEMKDIQGELTSSATNYNVPXXXXXXXXXXXXXXXXS 431
           ++ D   L      ++  I DI ++M DIQ  LT SATNYN P                 
Sbjct: 369 DHHDDVAL------DDFTINDIYTKMHDIQETLTRSATNYNYPLLAVAFVSFLFTTIVAV 422

Query: 432 FWFYF----SVLEVDFKNVXXXXXXXXXXXXXXXXXFVEEEHQIWWWIITGLITVSAINL 487
           +        S   +   ++                 F+EEEHQ+WWWI+T    V     
Sbjct: 423 YQLQRYSGPSFCHLHISSLSVILVSVILGVSTFASSFIEEEHQLWWWIVTASSVVPLFLY 482

Query: 488 PDQKIAH---LVMFVCVRIIRGWNNSGQKYSYDRTISILLNTEYEDFQWYLNIATILYIM 544
           P          +M  CVR+I+ WNNSGQK+ Y   +S LLN +   ++WYLN +T L ++
Sbjct: 483 PSNAFVFARWFIMIACVRLIKFWNNSGQKFIYSNVMSNLLN-QNPFWKWYLNSSTFLALI 541

Query: 545 LKDSTDNLISFMFSYNLGSVCILYKVCWTIINQDHVPEPIYKAAIYICRRLSRDYSLQDI 604
           +  +   L+ F+ +  L  +C  YK+ W I+N +    P +   +          +  D 
Sbjct: 542 IPSARSQLLHFIVTTILVGLCFTYKISWEIVNGNQAEIPPFMQGL---------LTKMDF 592

Query: 605 SVVEENLIPIARFFFYSVLAIVIAIYGSAKLKLI--KNPIKDIQKTLTFLLIFQSPSSYI 662
              E NL+ +AR FF +   +VI+     KLK++  +  I+D++  +T LLIFQ+ S  I
Sbjct: 593 LPTENNLLLLARVFFQAWSIVVISRLALTKLKVLDKRYLIEDMKLYITVLLIFQTSSQNI 652

Query: 663 GLFMVYDIXXXXXXXXXXXXXXXXXM-------ITSTISLVLQYFTFFQFGGTNSIATAD 715
           G F+++ I                 +       ++S +SL+LQ FTFFQFGGTNSI+T D
Sbjct: 653 GQFIIFQILQSQIYYFFQHLPTSLSLTSPSEVYLSSLVSLILQNFTFFQFGGTNSISTID 712

Query: 716 LTNAYNGVSEDYNIYFVGFLMCVSNFAPAIYWAMFPWKVIYNQIKPNNKWNVFAENKLPI 775
           L NAY+GVS DYNIY VG LM V+NFAPAIYW+M PW + Y      NK   F  +K+P 
Sbjct: 713 LGNAYHGVSSDYNIYVVGILMSVANFAPAIYWSMLPWSINYGSASSQNKLQTFIMSKMPA 772

Query: 776 VYFNCIAGCFLLLSCFILRYHLFIWSVFSPKLCYYATWNIFMNLIVGWVLEIAVLSMVD 834
             ++CI G  L+ +C  LR+HLFIWSVFSPKLCY+  WN+ M L+ GW+ E+A+L  +D
Sbjct: 773 FTYHCIFGACLMTACIFLRFHLFIWSVFSPKLCYFLGWNLVMGLLNGWLPELAILFALD 831

>KLLA0F01705g Chr6 complement(159469..161832) [2364 bp, 787 aa] {ON}
           similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062W LAS21 Integral plasma membrane protein involved
           in the synthesis of the glycosylphosphatidylinositol
           (GPI) core structure mutations affect cell wall
           integrity
          Length = 787

 Score =  699 bits (1803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/807 (45%), Positives = 508/807 (62%), Gaps = 55/807 (6%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQF 75
           +V +FC GFFP K VL+ D+ F ++ + QL +KP F KLVLVVIDALRSDFLF +D S F
Sbjct: 16  AVFLFCGGFFPQKVVLKNDSKFIVNPEVQLASKPVFKKLVLVVIDALRSDFLFQKDSSDF 75

Query: 76  NYIHELSNNGYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKNQD 135
            ++H L N+G AWG+TA+SNPPTVTLPRLKGITTGS PNFLDAILNVAEDD+SSNLK QD
Sbjct: 76  EFLHGLLNSGEAWGYTAYSNPPTVTLPRLKGITTGSAPNFLDAILNVAEDDTSSNLKEQD 135

Query: 136 SWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQVDHNVTRHLEKQIK 195
           S   QF  H  K+ FFGDDTWLKLFP E F+EY+GTNSFFVSDFE+VD NVTRH+  Q++
Sbjct: 136 SLLKQFHTHHYKMNFFGDDTWLKLFPLEFFSEYDGTNSFFVSDFEEVDFNVTRHVPYQME 195

Query: 196 EKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQDENTLICVMGD 255
            + +WD LILHYLGLDHIGHKGG  S FM  KHREMDS+IK ++E +  D +TL+ V+GD
Sbjct: 196 HQKNWDVLILHYLGLDHIGHKGGSKSHFMPSKHREMDSVIKQIYEKI--DGDTLMVVLGD 253

Query: 256 HGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQYKFL 315
           HGMN++GNHGGSS GETSA L  +SK+LK ++    Q+   +P++      +    YK+L
Sbjct: 254 HGMNDLGNHGGSSSGETSAALAFLSKRLKKYQSSDIQQSSNVPVE------DAHPDYKYL 307

Query: 316 TQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIKLQENFRQLMIVSNNKD 375
            +++Q+DIVPTLS LFN+P PKN++GV++  +L+LL  KL  IK+Q+N+ QL        
Sbjct: 308 KEVEQIDIVPTLSMLFNLPIPKNSMGVIIDELLQLLPSKLAAIKVQDNYLQL------TK 361

Query: 376 IRQLYESYDFENTEIKDIISEMKDIQGELTSSATNYNVPXXXXXXXXXXXXXXXXSFWFY 435
           ++  YE+   E      ++ EM++IQ  L  +ATNYN                  + W +
Sbjct: 362 LKPGYEA-QLEKKSAGTLLEEMREIQSSLAMAATNYNYTFLTYGTTLMIIGTLIVTVWNF 420

Query: 436 FSVLEVDFKNVXXXXXXXXXXXXXXXXXFVEEEHQIWWWIITGLITVSAINLPDQKIAHL 495
               ++  + +                 F+EEEHQIWWWI   ++ +  I+   +    L
Sbjct: 421 ----QLSQEYIEHVGTSVLLGISMFASSFIEEEHQIWWWITISVLLLMQISNGKK----L 472

Query: 496 VMFVCVRIIRGWNNSGQKYSYDRTISILLNTEYEDFQWYLNIATIL-----YIMLKDSTD 550
           V+   +R+IRGWNNSGQKY YD  +  LL + +    W+LN+ T L     ++  KD ++
Sbjct: 473 VVLSGLRLIRGWNNSGQKYIYDNVLHTLLKS-HTSVLWWLNVVTFLSVGFPFLRNKDESE 531

Query: 551 NLISFMFSYNLGSVCILYKVCWTIINQDHVPEPIYKAAIYICRRLSRDYSLQDISVVEEN 610
            ++S +    L    I YK+C+ I+N D VP  +Y  A+  C     + +  + S + + 
Sbjct: 532 KMVSLLSVSFLALSSITYKICFAIVNGDKVPSGLYTFALRSCAMYLANENATE-SDISQC 590

Query: 611 LIPIARFFFYSV-LAIVIAIYGSAKLKLIKNPIKDIQKTLTFLLIFQSPSSYIGLFMVYD 669
           L+PIAR FF    ++I+I ++    L    N +  +   + F+L+ Q+ S+ I LF++++
Sbjct: 591 LVPIARIFFQICGVSIIILLFMKYALNKSTNMLNKLLSVIKFVLLLQTSSANIPLFLIFE 650

Query: 670 IXXXXXXXXXXXXXXXXXMITSTISLVLQYFTFFQFGGTNSIATADLTNAYNGVSEDYNI 729
           I                  IT   SL LQ  TFFQFGGTNSIAT +LTNAYNGVS +YNI
Sbjct: 651 ILTSVTPD-----------ITPIFSLCLQNLTFFQFGGTNSIATVNLTNAYNGVSSNYNI 699

Query: 730 YFVGFLMCVSNFAPAIYWAMFPWKVIYNQIKPNNKWNVFAENKLPIVYFNCIAGCFLLLS 789
           Y VG LM +SN+AP+IYWA+         + P +    + +  L + ++  I G  L+++
Sbjct: 700 YVVGVLMFLSNYAPSIYWAL--------SLIPQS----YKQKTLRLQHY-YITGTCLMIA 746

Query: 790 CFILRYHLFIWSVFSPKLCYYATWNIF 816
           C  LRYHLFIWSVFSPKLCYYA W+++
Sbjct: 747 CIALRYHLFIWSVFSPKLCYYAAWSLY 773

>Suva_6.138 Chr6 complement(231325..233817) [2493 bp, 830 aa] {ON}
           YJL062W (REAL)
          Length = 830

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/838 (44%), Positives = 505/838 (60%), Gaps = 42/838 (5%)

Query: 16  SVLIFCIGFFPSKNVLEG--DAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDIS 73
           ++L+F   FFP K VL G      +   D  L  +  F KLV VVIDALRSDFLFD  IS
Sbjct: 16  AILLFIFAFFPRKIVLPGISQQAPDQDQDRDLQHERPFQKLVFVVIDALRSDFLFDSRIS 75

Query: 74  QFNYIHELSNNGYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKN 133
            FN +H+  N G AWG+T+F+NPPTVTLPRLK ITTGSTP+F+D +LNVA+D  S++L  
Sbjct: 76  HFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSE 135

Query: 134 QDSWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQVDHNVTRHLE-K 192
            DSW  QF +H   IRF GDDTWLKLFPHE F   + T+SFFVSDF QVD+NVTR+L+ K
Sbjct: 136 HDSWLQQFIQHNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGK 195

Query: 193 QIKEKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQ---DENTL 249
             +E   WD  ILHYLGLDHIGHK GP SKFM  KH+EMDSI+K +++ V +   D++TL
Sbjct: 196 LFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTL 255

Query: 250 ICVMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEED 309
           ICV+GDHGMNE+GNHGGSS GETSAGL+ +S KL  F  P+ Q    LPI         D
Sbjct: 256 ICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGT-----LD 310

Query: 310 KQYKFLTQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIKLQENFRQLMI 369
           + +++L  +QQ+DIVPT++ALF +P P N+VG+++P  L+LL  K+  +K  ENF  L  
Sbjct: 311 RDFQYLDSVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKVASMK--ENFMHLWR 368

Query: 370 VSNNKDIRQLYESYDFENTEIKDIISEMKDIQGELTSSATNYNVPXXXXXXXXXXXXXXX 429
           +S+++      E    ++ +I DI S+M DIQ  LT SATNYN P               
Sbjct: 369 LSDHQ------EEVVLDDLDIGDIYSKMHDIQETLTKSATNYNYPLLSLAFASFLIITII 422

Query: 430 XSFWFYF----SVLEVDFKNVXXXXXXXXXXXXXXXXXFVEEEHQIWWWIITGLITVS-- 483
            ++        +  ++   ++                 F+EEEHQ+WWWI+T    V   
Sbjct: 423 ATYQLQRHSGPTFCKLRTSSLSVLLVSVILGVSTFASSFIEEEHQLWWWIVTAFAAVPLF 482

Query: 484 AINLPDQKIAH-LVMFVCVRIIRGWNNSGQKYSYDRTISILLNTEYEDFQWYLNIATILY 542
           A  L    IA   +M  CVR+I+ WNNSGQK+ Y   +S +LN     ++W LN  T L 
Sbjct: 483 AYQLNASVIARWFIMLACVRLIKFWNNSGQKFIYTNVMSSILNRN-PFWKWSLNSLTFLI 541

Query: 543 IMLKDSTDNLISFMFSYNLGSVCILYKVCWTIINQDHVPEPIYKAAIYICRRLSRDYSLQ 602
           +++      L+  + S  L  +C  YK+ W I+N D    P++         L    +  
Sbjct: 542 LLMASVRSQLLHCIMSTILVGLCFTYKISWEIVNGDQAEIPLF---------LQDLLTKI 592

Query: 603 DISVVEENLIPIARFFFYSVLAIVIAIYGSAKLKLI--KNPIKDIQKTLTFLLIFQSPSS 660
           D    E NLI +AR FF +   +VI+     KLK++  K  I+D++  +T LLI Q+ S 
Sbjct: 593 DFIPNESNLITLARVFFQAWAIVVISRLVLTKLKVLDQKYLIRDMKLYITILLILQTSSQ 652

Query: 661 YIGLFMVYDIXXXXX----XXXXXXXXXXXXMITSTISLVLQYFTFFQFGGTNSIATADL 716
            IGLF+V+ I                      +++ +SLVLQ F+FFQFGGTNSI+T DL
Sbjct: 653 NIGLFIVFQILQSQICYFFQNFPSSSSTTKVYLSNLVSLVLQNFSFFQFGGTNSISTIDL 712

Query: 717 TNAYNGVSEDYNIYFVGFLMCVSNFAPAIYWAMFPWKVIYNQIKPNNKWNVFAENKLPIV 776
            NAY+G+S DYNI  VG LM ++NFAPAIYW+M PW + Y      NK   F ++KLP  
Sbjct: 713 GNAYHGISSDYNISVVGLLMSIANFAPAIYWSMLPWSINYEPASSQNKLQTFVKSKLPAF 772

Query: 777 YFNCIAGCFLLLSCFILRYHLFIWSVFSPKLCYYATWNIFMNLIVGWVLEIAVLSMVD 834
            ++CI G  L+ +C  LR+HLFIWSVFSPKLCY+  WN+ M  + GW+ E+AV+  +D
Sbjct: 773 TYHCIFGTCLMTACIFLRFHLFIWSVFSPKLCYFLGWNLVMGFLNGWLPELAVILALD 830

>Smik_10.178 Chr10 (309109..311604) [2496 bp, 831 aa] {ON} YJL062W
           (REAL)
          Length = 831

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/839 (44%), Positives = 502/839 (59%), Gaps = 43/839 (5%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQF 75
           ++++F   FFP K VL G +  +   D  L     F KLV V+IDALRSDFLFD  IS F
Sbjct: 16  AIVLFIFAFFPRKIVLTGISQQDADQDRDLQHNRPFQKLVFVIIDALRSDFLFDSHISHF 75

Query: 76  NYIHELSNNGYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKNQD 135
           N +HE  N G AWG+T+F+NPPTVTLPRLK ITTGSTP+F+D +LNVA+D  S++L   D
Sbjct: 76  NNVHEWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHD 135

Query: 136 SWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQVDHNVTRHLEKQI- 194
           SW  QF +H   IRF GDDTWLKLFP E F   + T+SFFVSDF QVD+NVTR+L  +I 
Sbjct: 136 SWLQQFIQHNNTIRFMGDDTWLKLFPQEWFDFTDPTHSFFVSDFTQVDNNVTRNLPGKIF 195

Query: 195 KEKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETV---GQDENTLIC 251
           +E   WD  ILHYLGLDHIGHK GP SKFMG KH+EMDSI+K++++ V     +E+TLIC
Sbjct: 196 QEWAQWDVAILHYLGLDHIGHKDGPHSKFMGTKHQEMDSILKSIYDQVLVHEHEEDTLIC 255

Query: 252 VMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQ 311
           V+GDHGMNE+GNHGGSS GETSAGL+ +S KL  F  P  Q    LPI   N AP+ D Q
Sbjct: 256 VLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSKFVKPESQINRTLPI---NAAPDRDFQ 312

Query: 312 YKFLTQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIKLQENFRQLMIVS 371
           Y  L  +QQ+DIVPT++ALF +P P N+VG+++P  L+LL  KL  IK  ENF  L  +S
Sbjct: 313 Y--LETVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKLASIK--ENFMHLWKLS 368

Query: 372 NNKDIRQLYESYDFENTEIKDIISEMKDIQGELTSSATNYNVPXXXXXXXXXXXXXXXXS 431
           ++         +  ++  I  I ++M  IQ  LT SATNYN P                 
Sbjct: 369 DHNG------DFTLDDLTIDGIYTKMYSIQETLTKSATNYNYPLLALAFISFLIITIIAI 422

Query: 432 FWFYF----SVLEVDFKNVXXXXXXXXXXXXXXXXXFVEEEHQIWWWIITGLITVS--AI 485
           +        S+ +     +                 F+EEEHQ+WWWI+T    V     
Sbjct: 423 YQLQRNSGSSLWQPRTSPLSVLLISVILGISTFASSFIEEEHQLWWWIVTAFSVVPLFVY 482

Query: 486 NLPDQKIAH-LVMFVCVRIIRGWNNSGQKYSYDRTISILLNTEYEDFQWYLNIATILYIM 544
           NL    +A   +M VCVR+I+ WNNSGQK+ Y   +S LLN +   ++W+LN+ T+L ++
Sbjct: 483 NLNVFVVARWFIMMVCVRLIKFWNNSGQKFIYSNVMSNLLN-QNPIWKWWLNLFTLLALI 541

Query: 545 LKDSTDNLISFMFSYNLGSVCILYKVCWTIINQDHVPEPIYKAAIYICRRLSRDYSLQDI 604
           +  S   ++ F+ +  L  +C  YK+ W I+N +    PI+   +          +  D 
Sbjct: 542 IASSRFQVLHFIVTTILVGLCFTYKISWEIVNGNQAEIPIFMHDL---------LAKIDF 592

Query: 605 SVVEENLIPIARFFFYSVLAIVIAIYGSAKLKLIKNP--IKDIQKTLTFLLIFQSPSSYI 662
              E NLI +AR FF +   +V++     KLK++     I+DI+  +T LLI Q+ S  I
Sbjct: 593 VPTESNLILLARVFFQAWAIVVVSRLVLTKLKVLNKNYLIEDIKVYITILLILQTSSQNI 652

Query: 663 GLFMVYDIXXXXXXXXXXXXXXXXXMITST-------ISLVLQYFTFFQFGGTNSIATAD 715
           G F+++ I                 +  S+       +SL+LQ FTFFQFGGTNSI+T D
Sbjct: 653 GQFIIFQILQSQIYYFFKSLPAPFLLTPSSKVYLSNLVSLILQNFTFFQFGGTNSISTID 712

Query: 716 LTNAYNGVSEDYNIYFVGFLMCVSNFAPAIYWAMFPWKVIYNQIKPNNKWNVFAENKLPI 775
           L NAY+GVS DYN+  VG LM ++NFAP+IYW+M PW + Y+      K   F  +KLP 
Sbjct: 713 LGNAYHGVSSDYNMCTVGMLMSIANFAPSIYWSMLPWSMNYDSTSSQVKIQTFIRSKLPA 772

Query: 776 VYFNCIAGCFLLLSCFILRYHLFIWSVFSPKLCYYATWNIFMNLIVGWVLEIAVLSMVD 834
             ++CI G  L+ +C  LR+HLFIWSVFSPKLCY+  WN  M  + GW+ E+ VL  +D
Sbjct: 773 FTYHCIFGTCLMTACIFLRFHLFIWSVFSPKLCYFLGWNFVMGFLNGWITELTVLFALD 831

>YJL062W Chr10 (317284..319776) [2493 bp, 830 aa] {ON}
           LAS21Integral plasma membrane protein involved in the
           synthesis of the glycosylphosphatidylinositol (GPI) core
           structure; mutations affect cell wall integrity
          Length = 830

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/847 (44%), Positives = 506/847 (59%), Gaps = 60/847 (7%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQF 75
           ++L+F   FFP K VL G +  +   D  L     F KLV V+IDALRSDFLFD  IS F
Sbjct: 16  AILLFIFAFFPRKIVLTGISKQDPDQDRDLQRDRPFQKLVFVIIDALRSDFLFDSQISHF 75

Query: 76  NYIHELSNNGYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKNQD 135
           N +H+  N G AWG+T+F+NPPTVTLPRLK ITTGSTP+F+D +LNVA+D  S++L   D
Sbjct: 76  NNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDIDSNDLSEHD 135

Query: 136 SWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQVDHNVTRHLE-KQI 194
           SW  QF +H   IRF GDDTWLKLFP + F   + T+SFFVSDF QVD+NVTR+L  K  
Sbjct: 136 SWLQQFIQHNNTIRFMGDDTWLKLFPQQWFDFADPTHSFFVSDFTQVDNNVTRNLPGKLF 195

Query: 195 KEKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQ---DENTLIC 251
           +E   WD  ILHYLGLDHIGHK GP SKFM  KH+EMDSI+K++++ V +   D++TLIC
Sbjct: 196 QEWAQWDVAILHYLGLDHIGHKDGPHSKFMAAKHQEMDSILKSIYDEVLEHEDDDDTLIC 255

Query: 252 VMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQ 311
           V+GDHGMNE+GNHGGSS GETSAGL+ +S KL  F  P  Q    LPI   N +P  D  
Sbjct: 256 VLGDHGMNELGNHGGSSAGETSAGLLFLSPKLAQFARPESQVNYTLPI---NASP--DWN 310

Query: 312 YKFLTQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIKLQENFRQLMIVS 371
           +++L  +QQ+DIVPT++ALF +P P N+VG+++P  L+LL  KL  +K  ENF  L  +S
Sbjct: 311 FQYLETVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKLASMK--ENFMHLWKLS 368

Query: 372 NNKDIRQLYESYDFENTEIKDIISEMKDIQGELTSSATNYNVPXXXXXXXXXXXXXXXX- 430
           ++      +     ++   +DI ++M  IQ  LT SATNYN P                 
Sbjct: 369 DH------HGEVALDDFTAEDIYTKMYTIQETLTKSATNYNYPLLTLAFVGFLIITIIAI 422

Query: 431 ---------SFWFYFSVLEVDFKNVXXXXXXXXXXXXXXXXXFVEEEHQIWWWIITGLIT 481
                     FW      ++   ++                 F+EEEHQ+WWWI+T    
Sbjct: 423 YVLLRYSGPDFW------QLRVSSLSVLLVSIILGVSTFASSFIEEEHQLWWWIVTAF-- 474

Query: 482 VSAINLPDQKIAHL------VMFVCVRIIRGWNNSGQKYSYDRTISILLNTEYEDFQWYL 535
            SA+ L   ++  L      +M  CVR I+ WNNSGQK+ Y   +S LLN +   ++W L
Sbjct: 475 -SAVPLFVYRLNVLIIVRWFIMMACVRSIKFWNNSGQKFIYSNVMSNLLN-QNPSWKWCL 532

Query: 536 NIATILYIMLKDSTDNLISFMFSYNLGSVCILYKVCWTIINQDHVPEPIYKAAIYICRRL 595
           N+ T L +++  +   ++ F+ +  L  +C  YK+ W I+N +    P++   +      
Sbjct: 533 NMLTFLVLIMASAGFQVLHFIVTTILVGLCFTYKISWEIVNGNQAEIPLFMHDL------ 586

Query: 596 SRDYSLQDISVVEENLIPIARFFFYSVLAIVIAIYGSAKLKLIKNP--IKDIQKTLTFLL 653
               +  D +  E NLI +AR FF +   +VI+     KLK++     IKD++  +T LL
Sbjct: 587 ---LAKIDFAPTESNLIVLARVFFQAWAIVVISRLVLTKLKVLNKNYLIKDMKVYITILL 643

Query: 654 IFQSPSSYIGLFMVYDIXXXXXXXXXXXXXXXXXMITSTI------SLVLQYFTFFQFGG 707
           +FQ+ S  IG F+V+ I                   TS I      SL+LQ FTFFQFGG
Sbjct: 644 MFQTSSQNIGQFLVFQILESQIFYFFQNIPTASLTSTSKIYFSNLVSLILQNFTFFQFGG 703

Query: 708 TNSIATADLTNAYNGVSEDYNIYFVGFLMCVSNFAPAIYWAMFPWKVIYNQIKPNNKWNV 767
           TNSI+T DL NAY+GVS DYNIY VG LM V+NFAPAIYW+M PW + Y  I    K   
Sbjct: 704 TNSISTIDLGNAYHGVSSDYNIYVVGILMSVANFAPAIYWSMLPWSINYASIPAQVKLQT 763

Query: 768 FAENKLPIVYFNCIAGCFLLLSCFILRYHLFIWSVFSPKLCYYATWNIFMNLIVGWVLEI 827
           F  +KLP   ++CI G  L+ +C +LR+HLFIWSVFSPKLCY+  WN  M L+ GW+ E+
Sbjct: 764 FIRSKLPAFTYHCIFGTCLMTACVVLRFHLFIWSVFSPKLCYFLGWNFVMGLLNGWLPEL 823

Query: 828 AVLSMVD 834
           A+L  +D
Sbjct: 824 ALLCALD 830

>NDAI0H00320 Chr8 complement(57504..60608) [3105 bp, 1034 aa] {ON}
           Anc_4.28
          Length = 1034

 Score =  190 bits (482), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 125/374 (33%), Positives = 190/374 (50%), Gaps = 47/374 (12%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFN---------KLVLVVIDALRSDF 66
           ++  F  GF  ++NVLE  +       + L + P FN         K V+VVIDALR DF
Sbjct: 49  AIAFFIKGFLLTRNVLENVSTLN-DYTSILESNPIFNNPSDIAKFDKTVIVVIDALRFDF 107

Query: 67  LFDQDIS--------------QFNYIHELSNNGYAWGFTAFSNPPTVTLPRLKGITTGST 112
           +   D S               +++ +E S+   +      ++PPT TL RLKG+TTGS 
Sbjct: 108 VIPVDESNPNYNPNYHNNFKVMYDHFNETSSADSSLLLKFIADPPTTTLQRLKGLTTGSL 167

Query: 113 PNFLDAILNVAEDDSSSNLKNQDSWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTN 172
           P F+DA  N        ++  +D+   Q   + K + F GDDTW  LF   + ++ +   
Sbjct: 168 PTFIDAGSNF-----DGSVIEEDNLIKQMYLNNKTVYFVGDDTWDSLFHPFLSSKSQPFE 222

Query: 173 SFFVSDFEQVDHNVTRHLEKQI-------KEKNDWDALILHYLGLDHIGHKGGPTSKFMG 225
           S  V D + VD+ V  + EK++       KE+ +WD LI H LG+DH+GHK GP+   M 
Sbjct: 223 SLNVWDLDTVDNGVISYFEKELISKKNNQKEEKEWDVLIGHMLGMDHVGHKYGPSHFSMK 282

Query: 226 PKHREMDSIIKNLFETVGQDENTLICVMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKN 285
            K  +++  +  + +++  DE+TL+ VMGDHGM+  GNHGG S  E  + L L SKK + 
Sbjct: 283 DKQLQLNEFVTKVIDSL--DEDTLLVVMGDHGMDHTGNHGGDSQDELESTLFLFSKKQQM 340

Query: 286 FEVPSDQKGVKLPIKSVNVAPEEDKQYKFLTQIQQVDIVPTLSALFNIPFPKNNVGVMMP 345
           + +  D +     +  +       K Y+   Q+ Q+D+VPTLS L  +P P NN+G  + 
Sbjct: 341 WNLDPDNQETLYNVNKLG------KHYR---QVNQIDLVPTLSLLTGLPIPFNNLGWPIK 391

Query: 346 SILELLDPKLFRIK 359
            I +  D   F  K
Sbjct: 392 EIAKNFDEDRFYTK 405

 Score = 33.1 bits (74), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 42/202 (20%), Positives = 75/202 (37%), Gaps = 22/202 (10%)

Query: 629  IYGSAKLKLIKNPIKDIQKTLTFLLIFQSPSSYIGLFMVYDIXXXXXXXXXXXXXXXXXM 688
            IYGS    LI N +  I       ++F  P + + LF++ +                  +
Sbjct: 824  IYGSQFFLLIINSLMSI-------ILFMKPLAQLSLFLMCN-QTLSILEIIDLLKLRENI 875

Query: 689  ITSTISLVLQYFTFFQFGGTNSIATADLTNAYNGVSEDYNIYFVGFLMCVSNFAPAIYWA 748
            I   +  ++ Y  FF  G   +I +      +  +S+          + ++ F P I  A
Sbjct: 876  IGPVVLALVSYQQFFTTGHQATIPSIQWDVGFI-LSDSITFPLTHLSLALNTFGPQIIIA 934

Query: 749  MFP-----WKVIYNQIKPNNKWNVFAENKLPIVYFNCIAGCFLLLSCFI----LRYHLFI 799
            +       WK   + +KP         N   ++ +N I    L LS FI     R HL +
Sbjct: 935  LSVALLTLWKQPPDVLKPQTLLGRIVSNCGTLIIYNTI----LCLSSFIWVTYFRRHLMV 990

Query: 800  WSVFSPKLCYYATWNIFMNLIV 821
            W +F P+  +     I   +++
Sbjct: 991  WKIFCPRFLFACASLIVTQIVI 1012

>Ecym_5559 Chr5 (1131115..1134159) [3045 bp, 1014 aa] {ON} similar
           to Ashbya gossypii AGR126C
          Length = 1014

 Score =  187 bits (476), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 125/344 (36%), Positives = 181/344 (52%), Gaps = 47/344 (13%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQF 75
           ++  F  GF  S+ VL+  A F+ + D+       F+K V++++DALR DF+   D +  
Sbjct: 57  AIAFFTRGFLLSRTVLDNVASFDETKDSY----GKFDKAVILIVDALRFDFVIPVDTAAE 112

Query: 76  NY----------IHELSNNGYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAED 125
            Y          ++E  +N     F A  +PPT TL RLKG+TTGS P F+DA  N   D
Sbjct: 113 GYNDNYHNNLKVLYEYWDNSVLLKFIA--DPPTTTLQRLKGLTTGSLPTFIDAGSNFNGD 170

Query: 126 DSSSNLKNQDSWPMQFAKHGKKIRFFGDDTWLKLF-PH--EIFTEYEGTNSFFVSDFEQV 182
                +  +D+   Q   H K I F GDDTW  LF P+   +   YE  N   V D + V
Sbjct: 171 -----VIVEDNLIKQLYLHNKSIYFVGDDTWDALFHPYLSNMSVPYESLN---VWDLDTV 222

Query: 183 DHNVTRHLEKQIKEKN----DWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNL 238
           D+ V  + E+ + +K+    +WD LI H LG+DH+GHK GP    M  K +++D  I+ +
Sbjct: 223 DNGVISYFEEHLLDKDPLDREWDVLIGHMLGIDHVGHKYGPNHFTMSEKQQQVDKFIRKV 282

Query: 239 FETVGQDENTLICVMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPS-DQKGVKL 297
             ++  DE+TL+ VMGDHGM+  GNHGG S  E  + L L SK+   +++ S DQ     
Sbjct: 283 IASI--DEDTLLVVMGDHGMDHTGNHGGDSNDELESTLWLHSKRKNAWKLKSPDQYNTS- 339

Query: 298 PIKSVNVAPEEDKQYKFLTQIQQVDIVPTLSALFNIPFPKNNVG 341
                       + Y+   Q+ Q+D+VPTLS L   P P NN+G
Sbjct: 340 ---------RLGENYR---QVNQIDLVPTLSLLLGTPIPFNNLG 371

>KLLA0C17534g Chr3 (1540967..1543984) [3018 bp, 1005 aa] {ON}
           similar to uniprot|Q07830 Saccharomyces cerevisiae
           YLL031C,
          Length = 1005

 Score =  184 bits (467), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 125/340 (36%), Positives = 183/340 (53%), Gaps = 39/340 (11%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLF--DQDIS 73
           S+  F  GF  ++ VL  D V E+  D QL  +  ++K+VL+++DALR DF+   D++ +
Sbjct: 57  SIAFFAKGFLLTRTVL--DNVAEL--DPQLPFEAKYDKMVLLIVDALRFDFVIPVDENHA 112

Query: 74  QFN--------YIHELSNNGYAWGFTAF-SNPPTVTLPRLKGITTGSTPNFLDAILNVAE 124
           ++N         ++E ++N        F ++PPT TL RLKG+TTGS P F+DA  N   
Sbjct: 113 KYNPNYHNNLKVLYETAHNSTDSVLLKFLADPPTTTLQRLKGLTTGSLPTFIDAGSNFNG 172

Query: 125 DDSSSNLKNQDSWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQVDH 184
           D     + ++D+   Q   H KKI F GDDTW  LF   +  E     S  V D + VD+
Sbjct: 173 D-----VIDEDNLIKQLYLHNKKIFFAGDDTWDALFNPYLAPESVPYESLNVWDLDTVDN 227

Query: 185 NVTRHLEKQI---KEKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFET 241
            V  +LE+     ++++++D LI H LG+DH+GHK GP    M  K  ++D +++ +  T
Sbjct: 228 GVISYLEEYYFNEEKRSEYDILIGHMLGVDHVGHKYGPNHFTMKEKQLQVDELLRKIIST 287

Query: 242 VGQDENTLICVMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKS 301
              D+NTL  VMGDHGM+  GNHGG S  E  + L L +K   N+    D          
Sbjct: 288 A--DDNTLYVVMGDHGMDHTGNHGGDSQDELESVLWLYAKN-ANWSKDYDSYNTT----- 339

Query: 302 VNVAPEEDKQYKFLTQIQQVDIVPTLSALFNIPFPKNNVG 341
                +    YK   Q+ Q+D+VPTLS L  IP P NN+G
Sbjct: 340 -----DLGTSYK---QMNQIDLVPTLSLLLGIPIPFNNLG 371

>ZYRO0B01034g Chr2 (87543..90572) [3030 bp, 1009 aa] {ON} similar to
           uniprot|Q07830 Saccharomyces cerevisiae YLL031C
          Length = 1009

 Score =  181 bits (458), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 133/379 (35%), Positives = 190/379 (50%), Gaps = 49/379 (12%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQ- 74
           ++  F  GF  ++ VL+      +SS    N    F+K V++VIDALR DF+   D S  
Sbjct: 49  AIAFFTRGFLLTRQVLD-----NVSSPFP-NQYGKFDKAVVLVIDALRFDFVIPVDESHP 102

Query: 75  ------FNYIHELSNN----GYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAE 124
                  N I  L N+    G +  F   ++PPT TL RLKG+TTGS P F+DA  N   
Sbjct: 103 QHNPNYHNNIKALWNDESLKGSSLLFKFIADPPTTTLQRLKGLTTGSLPTFIDAGSNF-- 160

Query: 125 DDSSSNLKNQDSWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQVDH 184
                ++  +D+   Q     K + F GDDTW  LF   +  + E   S  V D + VD+
Sbjct: 161 ---DGSVIEEDNLIKQLYLAQKNVYFAGDDTWSALFHPFLSAQSEPYPSLNVWDLDTVDN 217

Query: 185 NVTRHLEKQIKE-----KNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLF 239
            V  + E+ + E       DWD L+ H LG+DH+GHK GP    M  K  ++D  I+ + 
Sbjct: 218 GVMSYFERHLLEGGQTRHRDWDVLVGHMLGVDHVGHKYGPNHFTMREKQLQVDEFIRKII 277

Query: 240 ETVGQDENTLICVMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPI 299
             +  D++TL+ VMGDHGM+  GNHGG S  E  + L L SK+   ++          P 
Sbjct: 278 AAI--DKDTLLIVMGDHGMDHTGNHGGDSIDELESTLFLYSKRPDMWQ----------PN 325

Query: 300 KSVNVAPEED--KQYKFLTQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFR 357
           +  NV    D  K YK   Q+ Q+D+VPTLS L N+P P N++G  +  I      K F 
Sbjct: 326 EDPNVYDVSDLGKNYK---QVNQIDLVPTLSLLLNLPIPFNSLGWPLEEIAT--SKKEFD 380

Query: 358 IKLQENFRQLMIVSNNKDI 376
             ++   +QL   SN K++
Sbjct: 381 FNVRLTLQQL---SNYKNV 396

>KAFR0I01410 Chr9 (294241..297291) [3051 bp, 1016 aa] {ON} Anc_4.28
           YLL031C
          Length = 1016

 Score =  179 bits (453), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 135/398 (33%), Positives = 212/398 (53%), Gaps = 60/398 (15%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQF 75
           ++  F  GF  S+ VL  D +  + S+  ++AK  F+K V++++DALR DF+   D ++ 
Sbjct: 49  AIAFFTKGFLLSRQVL--DNITPLDSNV-IDAK--FDKAVILIVDALRFDFVIPVDSTEH 103

Query: 76  ---NY------IHELSNNGYAWGFTAF----SNPPTVTLPRLKGITTGSTPNFLDAILNV 122
              NY      +++   NG + G +      ++PPT TL RLKG+TTGS P F+DA  N 
Sbjct: 104 LNNNYHNNIDILYDTFKNGNSHGSSILLKFLADPPTTTLQRLKGLTTGSLPTFIDAGSNF 163

Query: 123 AEDDSSSNLKNQDSWPMQFAKH-GKKIRFFGDDTWLKLFPHEIFTE----YEGTNSFFVS 177
                + N+  +D+   Q +++  ++I F GDDTW  LF H   +     YE  N   V 
Sbjct: 164 -----NGNVIFEDNLIRQLSENLNREILFVGDDTWDALF-HPFLSNNSLPYESLN---VW 214

Query: 178 DFEQVDHNVTRHLEKQIKEKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKN 237
           D + VD+ V    ++ +K+ +DWD LI H LG+DH+GHK GP    M  K  ++++ IK 
Sbjct: 215 DLDTVDNGVIDFFDENLKKNDDWDVLIGHMLGVDHVGHKYGPNHFTMREKQLQVNTFIKK 274

Query: 238 LFETVGQDENTLICVMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKL 297
           + +++  D NTL+ VMGDHGM+  GNHGG S  E  + L L +KK   F    D      
Sbjct: 275 IIDSI--DNNTLLVVMGDHGMDHTGNHGGDSIDELESTLFLYTKKKNIFRKHDD------ 326

Query: 298 PIKSVNVAPEEDKQYKFLTQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFR 357
                N+  +  K Y+    + Q+D+V TLS L  IP P NN+G     I E+   K  +
Sbjct: 327 -FTPYNIT-DLGKNYR---AVNQIDLVSTLSYLLGIPIPFNNLGW---PIEEIFHSKNDK 378

Query: 358 IKLQE-------NFRQLMIVS-----NNKDIRQLYESY 383
           IK+ +        ++++M +S     +N++ R + ES+
Sbjct: 379 IKMTKRVLDQLRTYQEIMGISFQDPESNENGRSMNESF 416

 Score = 32.0 bits (71), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 46/202 (22%), Positives = 77/202 (38%), Gaps = 22/202 (10%)

Query: 629 IYGSAKLKLIKNPIKDIQKTLTFLLIFQSPSSYIGLFMVYDIXXXXXXXXXXXXXXXXXM 688
           IYGS    L+ N +  I       ++F  P + I LF++ +                  +
Sbjct: 806 IYGSEFFLLVINTVMSI-------VLFNKPLAQISLFLMCN-QLLSILEIIDLLKLKENI 857

Query: 689 ITSTISLVLQYFTFFQFGGTNSIATADLTNAYNGVSEDYNIYFVGFLMCVSNFAPAIYWA 748
           I   I  +L Y  FF  G   +I +      +  +SE          + ++ F P I  A
Sbjct: 858 IGPIILGLLSYQQFFSTGHQATIPSVQWDMGFI-LSEKIVFPTTHISIILNTFGPHILVA 916

Query: 749 MFP-----WKVIYNQIKPNNKWNVFAENKLPIVYFNCIAGCFLLLSCFI----LRYHLFI 799
           +       WK   + +KP         N   ++ +N I    L LS FI     R HL +
Sbjct: 917 LSVALITLWKQPPDVLKPQTLLGRIVSNCGILLIYNTI----LCLSSFIWVTHFRRHLMV 972

Query: 800 WSVFSPKLCYYATWNIFMNLIV 821
           W +F P+  + +   I + ++V
Sbjct: 973 WKIFCPRFIFASLCLIVVQVVV 994

>CAGL0G04015g Chr7 (379330..382389) [3060 bp, 1019 aa] {ON} highly
           similar to uniprot|Q07830 Saccharomyces cerevisiae
           YLL031c GPI13
          Length = 1019

 Score =  177 bits (448), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 119/351 (33%), Positives = 174/351 (49%), Gaps = 48/351 (13%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQF 75
           ++  F  GF  S+ VL+       +SD  L     F+K+VL+V+DALR DF+     S  
Sbjct: 49  AIAFFAKGFLLSRTVLDN---VSTTSDNPLAVDKKFDKMVLLVVDALRFDFVVPVSTSHP 105

Query: 76  NYIHELSNN-----------------GYAWGFTAF-----SNPPTVTLPRLKGITTGSTP 113
           NY     NN                 GY+   ++      ++PPT TL RLKG+TTGS P
Sbjct: 106 NYNENFHNNLDVLYNTWLSTRHGGRGGYSNSGSSILLKFIADPPTTTLQRLKGLTTGSLP 165

Query: 114 NFLDAILNVAEDDSSSNLKNQDSWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNS 173
            F+DA  N        ++  +D+   Q     K + F GDDTW  LF   +    E   S
Sbjct: 166 TFIDAGSNF-----DGSVIEEDNLIKQLFLANKSVSFVGDDTWDALFHPFLANNSEPYPS 220

Query: 174 FFVSDFEQVDHNVTRHLEKQIKEKN---DWDALILHYLGLDHIGHKGGPTSKFMGPKHRE 230
             V D + VD+ V  + +  + +K+   +WD L+ H LG+DH+GHK GP    M  K  +
Sbjct: 221 LNVWDLDTVDNGVISYFKSHLLDKSADRNWDILVGHMLGVDHVGHKYGPNHFTMREKQNQ 280

Query: 231 MDSIIKNLFETVGQDENTLICVMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPS 290
           ++  I+ + E++  D +TL+ VMGDHGM+  GNHGG S  E  + L   +K+   ++   
Sbjct: 281 VNRFIQEIIESI--DNDTLLVVMGDHGMDHTGNHGGDSQDELESTLFFYTKRQNTWK--- 335

Query: 291 DQKGVKLPIKSVNVAPEEDKQYKFLTQIQQVDIVPTLSALFNIPFPKNNVG 341
           +Q G        N   E   Q      + Q+D+VPTLS L +IP P NN+G
Sbjct: 336 NQNG--------NYDIENLAQNYH--SVNQIDLVPTLSLLLDIPVPFNNLG 376

>SAKL0H25542g Chr8 (2236849..2239890) [3042 bp, 1013 aa] {ON}
           similar to uniprot|Q07830 Saccharomyces cerevisiae
           YLL031C
          Length = 1013

 Score =  176 bits (445), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 117/344 (34%), Positives = 177/344 (51%), Gaps = 45/344 (13%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQF 75
           ++  F  GF  +++VL+  A        + +    F+K V++V+DALR DF+     +Q 
Sbjct: 54  AIAFFTRGFLLTRHVLDNVA-------TKKSEYGTFDKAVVLVVDALRFDFVIPVSETQ- 105

Query: 76  NYIHELSNNGYAWGFTAF--------------SNPPTVTLPRLKGITTGSTPNFLDAILN 121
           +Y +E  +N     +  F              ++PPT TL RLKG+TTGS P F+DA  N
Sbjct: 106 DYYNENYHNNLEVLYEKFKDVSESSSLLLKFIADPPTTTLQRLKGLTTGSLPTFIDAGSN 165

Query: 122 VAEDDSSSNLKNQDSWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQ 181
                 +  +  +D+   Q   + K + F GDDTW  LF   +  +     S  V D + 
Sbjct: 166 F-----NGEVIEEDNLIKQMFLNDKTVFFAGDDTWNALFSPFLAEQSRPYESLNVWDLDT 220

Query: 182 VDHNV----TRHLEKQIKEKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKN 237
           VD+ V      HL ++   + +WD LI H LG+DH+GHK GP    M  K  ++D+ I+ 
Sbjct: 221 VDNGVISFFKEHLFEKTPAQREWDVLIGHMLGIDHVGHKYGPNHFTMREKQLQVDNFIRQ 280

Query: 238 LFETVGQDENTLICVMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKL 297
           + E++  DE+TL+ ++GDHGM+  GNHGG S  E  + L L SKK   ++  SD+     
Sbjct: 281 IMESI--DEDTLLVILGDHGMDHTGNHGGDSRDELESTLWLHSKKHGMWDHYSDE----- 333

Query: 298 PIKSVNVAPEEDKQYKFLTQIQQVDIVPTLSALFNIPFPKNNVG 341
                    E  K Y+   Q+ Q+D+VPTLS L  +P P NN+G
Sbjct: 334 ----TYDTSELGKNYR---QVNQIDLVPTLSLLLGLPIPFNNLG 370

>TDEL0F01690 Chr6 (313714..316731) [3018 bp, 1005 aa] {ON} Anc_4.28
           YLL031C
          Length = 1005

 Score =  175 bits (444), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 114/342 (33%), Positives = 168/342 (49%), Gaps = 44/342 (12%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQF 75
           ++  F  GF  ++ VL+  A+       +      F+K V++++DALR DF+   D    
Sbjct: 49  AIAFFTRGFLLTRQVLDDVAI-------KTAEYGKFDKAVVLIVDALRFDFVIPVDQDHQ 101

Query: 76  NYIHELSNN------------GYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVA 123
            Y     NN            G +      ++ PTVTL RLKG+TTGS P F+DA  N  
Sbjct: 102 GYSGNFHNNIDVLYESMFADQGSSLLLKFIADAPTVTLQRLKGLTTGSLPTFIDAGSNF- 160

Query: 124 EDDSSSNLKNQDSWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQVD 183
                 ++  +D+   Q  + GK+I F GDDTW  LF   +    +   SF V D + VD
Sbjct: 161 ----DGSVIEEDNLIKQMYEQGKQIYFAGDDTWESLFSPFLSPRSKYYESFNVWDLDTVD 216

Query: 184 HNVTRHLEKQIKEK--NDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFET 241
           + V  +  + + E    DWD LI H LG+DH+GHK GP    M  K  +++  +  + ET
Sbjct: 217 NGVISYFNEHLLETANRDWDVLIGHMLGVDHVGHKYGPNHFTMREKQLQVNDFLIKIKET 276

Query: 242 VGQDENTLICVMGDHGMNEVGNHGGSSPGETSAGLVLISKK--LKNFEVPSDQKGVKLPI 299
           +  D++TL+ +MGDHGM+  GNHGG S  E  + L L SK+  +     PS      L  
Sbjct: 277 I--DDDTLLVIMGDHGMDHTGNHGGDSKDELESTLFLYSKRPNMWGLNDPSQYNTTDLG- 333

Query: 300 KSVNVAPEEDKQYKFLTQIQQVDIVPTLSALFNIPFPKNNVG 341
                         +  ++ Q+D+VPTLS L  +P P NN+G
Sbjct: 334 -------------AYYREVNQIDLVPTLSILMGLPIPFNNLG 362

 Score = 32.0 bits (71), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 54/135 (40%), Gaps = 14/135 (10%)

Query: 696 VLQYFTFFQFGGTNSIATADLTNAYNGVSEDYNIYFVGFLMCVSNFAPAIYWAMFP---- 751
           +L Y  FF  G   +I +      +  +SE     F    + ++ F P I   +      
Sbjct: 854 LLAYSQFFSTGHQATIPSVQWDVGFI-LSETVKFPFTHLPIVLNTFGPHIIVGLSVALLT 912

Query: 752 -WKVIYNQIKPNNKWNVFAENKLPIVYFNCIAGCFLLLSCFI----LRYHLFIWSVFSPK 806
            WK   + +KP         N   ++ +N +    L LS F+     R HL +W +F P+
Sbjct: 913 LWKQQPDVLKPQTLLGRIVSNCGSLLVYNTV----LCLSSFVWVTHFRRHLMVWKIFCPR 968

Query: 807 LCYYATWNIFMNLIV 821
             + +   I + L+V
Sbjct: 969 YLFASMSLIAVQLVV 983

>KLTH0E06094g Chr5 complement(550258..553308) [3051 bp, 1016 aa]
           {ON} similar to uniprot|Q07830 Saccharomyces cerevisiae
           YLL031C
          Length = 1016

 Score =  174 bits (441), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 118/345 (34%), Positives = 177/345 (51%), Gaps = 45/345 (13%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDIS-- 73
           ++  F  GF  ++ VLE      +++ A   A+  F+K V++VIDALR DF    D +  
Sbjct: 55  AIAFFARGFLLTRTVLE-----NVATGADHEAR--FSKCVILVIDALRFDFSIPVDPADN 107

Query: 74  --------QFNYIHELSNNGYAWGFTAF-----SNPPTVTLPRLKGITTGSTPNFLDAIL 120
                     + +H   NN  +   ++      ++PPT TL RLKG+TTGS P F+DA  
Sbjct: 108 AFNSYFHNNLDVLHTSFNNATSETHSSLLLKFIADPPTTTLQRLKGLTTGSLPTFIDAGS 167

Query: 121 NVAEDDSSSNLKNQDSWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFE 180
           N      +  +  +D+   Q   + + + F GDDTW  LF   +    +   S  V D +
Sbjct: 168 NF-----NGAVIEEDNLIKQMFLNNQSVLFAGDDTWDNLFNPFLSPASQPFESLNVWDLD 222

Query: 181 QVDHNVTRHLEKQIKEKND----WDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIK 236
            VD+ V R  E  +  K++    WD LI H LG+DH+GHK GP    M  K  + +  IK
Sbjct: 223 TVDNGVIRFFEDNLFAKSEKSEEWDVLIGHMLGIDHVGHKYGPNHFTMKEKQLQANEFIK 282

Query: 237 NLFETVGQDENTLICVMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVK 296
            + E++  D++TL+ VMGDHGM+  GNHGG S  E  A L L SK+   +          
Sbjct: 283 RICESI--DDDTLLVVMGDHGMDHTGNHGGDSKSELEAALWLHSKRPNMWS--------H 332

Query: 297 LPIKSVNVAPEEDKQYKFLTQIQQVDIVPTLSALFNIPFPKNNVG 341
           LP +  +++    + Y+   Q+ Q+D+VPTLS L  +P P NN+G
Sbjct: 333 LPEQFYDIS-ALGENYR---QVNQIDLVPTLSLLLGLPIPFNNLG 373

>Kwal_55.20667 s55 complement(511335..513140) [1806 bp, 602 aa]
           {OFF} YLL031C (GPI13) - phosphoryltransferase that adds
           phosphoethanolamine to the third mannose residue of the
           GPI anchor precursor [contig 141] PARTIAL
          Length = 602

 Score =  169 bits (429), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 128/402 (31%), Positives = 190/402 (47%), Gaps = 47/402 (11%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQF 75
           ++  F  GF  ++ VLE  A          + +P F+K V++VIDALR DF    D  + 
Sbjct: 59  AIAFFARGFLLTRTVLENVA-------THADYEPKFDKCVILVIDALRFDFSIPIDPQEN 111

Query: 76  NYIHELSNN--GYAWGFTA----------FSNPPTVTLPRLKGITTGSTPNFLDAILNVA 123
            Y     NN   +  GF             S+PPT TL RLKG+TTGS P F+DA  N  
Sbjct: 112 GYNPYYHNNLDVFHSGFRDQNHSSLLLKFISDPPTTTLQRLKGLTTGSLPTFIDAGSNF- 170

Query: 124 EDDSSSNLKNQDSWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQVD 183
               +  +  +D+   Q   + K I F GDDTW  LF   +    +   S  V D + VD
Sbjct: 171 ----NGAIIEEDNLIKQMYLNNKTILFAGDDTWDNLFGTFLSPSSKPYESLNVWDLDTVD 226

Query: 184 HNVTRHLEKQI----KEKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLF 239
           + V  + E+ +    K++  WD LI H LG+DH+GHK GP    M  K  + +  IK + 
Sbjct: 227 NGVIDYFEEHLLSPAKDEAHWDVLIGHMLGIDHVGHKYGPNHFTMKEKQLQANEFIKRIC 286

Query: 240 ETVGQDENTLICVMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPI 299
           E +  D++TL+ VMGDHGM+  GNHGG S  E  A L + S K   +          LP 
Sbjct: 287 EKL--DDDTLLVVMGDHGMDHTGNHGGDSRSELEATLWMYSTKPDMWN--------HLPQ 336

Query: 300 KSVNVAPEEDKQYKFLTQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIK 359
            + N +   +       ++ Q+D+V TLS L  +P P NN+G  +  +     P+  ++ 
Sbjct: 337 DAYNTSVLGENH----REVNQIDLVSTLSLLLGLPIPFNNLGWPIQEVAT--SPEEVKLF 390

Query: 360 LQENFRQLMIVSNNKDIRQLYESYDFENTEIKDIISEMKDIQ 401
            +    Q+    +  ++    +  +  NT + D    MKDI 
Sbjct: 391 SETALNQIRAYKDASNVITSSDKNELLNTLLAD---AMKDIS 429

>Kwal_YGOB_55.20664 s55 complement(510269..511291,511293..513140)
           [2871 bp, 956 aa] {ON} ANNOTATED BY YGOB -
          Length = 956

 Score =  172 bits (437), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 128/402 (31%), Positives = 190/402 (47%), Gaps = 47/402 (11%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQF 75
           ++  F  GF  ++ VLE  A          + +P F+K V++VIDALR DF    D  + 
Sbjct: 59  AIAFFARGFLLTRTVLENVA-------THADYEPKFDKCVILVIDALRFDFSIPIDPQEN 111

Query: 76  NYIHELSNN--GYAWGFTA----------FSNPPTVTLPRLKGITTGSTPNFLDAILNVA 123
            Y     NN   +  GF             S+PPT TL RLKG+TTGS P F+DA  N  
Sbjct: 112 GYNPYYHNNLDVFHSGFRDQNHSSLLLKFISDPPTTTLQRLKGLTTGSLPTFIDAGSNF- 170

Query: 124 EDDSSSNLKNQDSWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQVD 183
               +  +  +D+   Q   + K I F GDDTW  LF   +    +   S  V D + VD
Sbjct: 171 ----NGAIIEEDNLIKQMYLNNKTILFAGDDTWDNLFGTFLSPSSKPYESLNVWDLDTVD 226

Query: 184 HNVTRHLEKQI----KEKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLF 239
           + V  + E+ +    K++  WD LI H LG+DH+GHK GP    M  K  + +  IK + 
Sbjct: 227 NGVIDYFEEHLLSPAKDEAHWDVLIGHMLGIDHVGHKYGPNHFTMKEKQLQANEFIKRIC 286

Query: 240 ETVGQDENTLICVMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPI 299
           E +  D++TL+ VMGDHGM+  GNHGG S  E  A L + S K   +          LP 
Sbjct: 287 EKL--DDDTLLVVMGDHGMDHTGNHGGDSRSELEATLWMYSTKPDMWN--------HLPQ 336

Query: 300 KSVNVAPEEDKQYKFLTQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIK 359
            + N +   +       ++ Q+D+V TLS L  +P P NN+G  +  +     P+  ++ 
Sbjct: 337 DAYNTSVLGENH----REVNQIDLVSTLSLLLGLPIPFNNLGWPIQEVAT--SPEEVKLF 390

Query: 360 LQENFRQLMIVSNNKDIRQLYESYDFENTEIKDIISEMKDIQ 401
            +    Q+    +  ++    +  +  NT + D    MKDI 
Sbjct: 391 SETALNQIRAYKDASNVITSSDKNELLNTLLAD---AMKDIS 429

>KNAG0J02820 Chr10 (539098..542151) [3054 bp, 1017 aa] {ON} Anc_4.28
           YLL031C
          Length = 1017

 Score =  172 bits (437), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 112/338 (33%), Positives = 170/338 (50%), Gaps = 31/338 (9%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLF--DQDIS 73
           ++  F  GF  S++VL  D + +  S   L + P F++ V++++DALR DF+   +++ +
Sbjct: 49  AIAFFSRGFLLSRHVL--DNISKADSQLTLQSSPKFDRAVVLIVDALRFDFVIPIEKEKA 106

Query: 74  QFNYIHEL----------SNNGYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVA 123
             NY + +          S +  +      ++PPT TL RLKG+TTGS P F+DA  N  
Sbjct: 107 NSNYHNNINIMYDKFMDNSESCSSLLLKFMADPPTTTLQRLKGLTTGSLPTFIDAGSNFN 166

Query: 124 EDDSSSNLKNQDSWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQVD 183
            D        +D+   Q   H K + F GDDTW  LF   +        S  V D + VD
Sbjct: 167 GDT-----IEEDNLIKQLYLHDKNVLFVGDDTWDALFNPFLSNNSAPFESLNVWDLDTVD 221

Query: 184 HNVTRHLEKQIKEKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVG 243
           + V       I  K +WD L+ H LG+DH+GHK GP    M  K  +++  I  + +++ 
Sbjct: 222 NGVISFFNDHIHSK-EWDVLVGHMLGVDHVGHKYGPDHFTMKEKQTQVNEFIHYVMQSL- 279

Query: 244 QDENTLICVMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVN 303
            D++TL+ VMGDHGM+  GNHGG S  E  + L L SK    F   +D        +S+ 
Sbjct: 280 -DDDTLLVVMGDHGMDRTGNHGGDSIDELESTLFLYSKTPGKFGAMTDGN------QSIY 332

Query: 304 VAPEEDKQYKFLTQIQQVDIVPTLSALFNIPFPKNNVG 341
              +    Y+    + Q+D+V TLS +   P P NN+G
Sbjct: 333 NISDYGSSYR---SVNQIDLVSTLSLMLGTPIPFNNLG 367

 Score = 33.1 bits (74), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 54/135 (40%), Gaps = 14/135 (10%)

Query: 696 VLQYFTFFQFGGTNSIATADLTNAYNGVSEDYNIYFVGFLMCVSNFAPAIYWAMFP---- 751
           +L Y  FF  G   +I +     A+  +SE          + ++ F P I  A+      
Sbjct: 866 LLSYQQFFSTGHQATIPSVQWDVAFI-LSEKITFPITHLSVILNTFGPHIIVALSVALIT 924

Query: 752 -WKVIYNQIKPNNKWNVFAENKLPIVYFNCIAGCFLLLSCFI----LRYHLFIWSVFSPK 806
            WK   + +KP         N   ++ +N +    L LS F+     R HL +W +F P+
Sbjct: 925 LWKQPPDVLKPQTLLGRIVSNCGVLLTYNTL----LCLSSFVWVTFFRRHLMVWKIFCPR 980

Query: 807 LCYYATWNIFMNLIV 821
             + A   I   L+V
Sbjct: 981 FMFAALCLIVTQLVV 995

>TBLA0A08500 Chr1 complement(2089018..2092215) [3198 bp, 1065 aa]
           {ON} Anc_4.28 YLL031C
          Length = 1065

 Score =  171 bits (434), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 113/345 (32%), Positives = 182/345 (52%), Gaps = 35/345 (10%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQF 75
           S+  F  GF  ++NVL+  +  + + ++ LN KP F+K V++++DALR +F+   D+   
Sbjct: 68  SIAFFSRGFLLTRNVLDNIST-DNNPNSILNDKPQFDKTVILIVDALRFNFVIPVDVDSM 126

Query: 76  NYIHELSNN-------------GYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNV 122
           +Y     NN               +      ++PPT T+ RLKG+TTG+ P F+DA  N 
Sbjct: 127 DYNPNYHNNIDVLYDTFKNSQDSSSVLLKFIADPPTTTMQRLKGLTTGTLPTFIDAGSNF 186

Query: 123 AEDDSSSNLKNQDSWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGT-NSFFVSDFEQ 181
              D S  L++     +   K    I F GDDTW  LF   +  ++    +S  V D + 
Sbjct: 187 ---DGSVILEDNLIKQLYLNKFWNDIYFVGDDTWDALFKPYLNQQFSRPFDSLNVWDLDT 243

Query: 182 VDHNVTRH-----LEKQIKEKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIK 236
           VD+ V  +     +++  K++  +  LI H LG+DH+GHK GP    M  K  +++  +K
Sbjct: 244 VDNGVISYFHEYLIDQSSKDQMTYKTLIGHMLGVDHVGHKYGPNHFTMKEKQLQINQFLK 303

Query: 237 NLFETVGQDENTLICVMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVK 296
            +  ++  D+NTL+ VMGDHGM+  GNHGG S  E  + L + +KK  +F +  D +   
Sbjct: 304 EIINSI--DDNTLLVVMGDHGMDHTGNHGGDSVDELESTLFMYAKKKNSFTLDKDYE--- 358

Query: 297 LPIKSVNVAPEEDKQYKFLTQIQQVDIVPTLSALFNIPFPKNNVG 341
               S N++    + YK   Q+ Q+D+VPTLS L ++  P N++G
Sbjct: 359 ---TSYNIS-NFGESYK---QVNQIDLVPTLSLLLDLQIPFNSLG 396

>Kpol_478.1 s478 complement(442..3471) [3030 bp, 1009 aa] {ON}
           complement(442..3471) [3030 nt, 1010 aa]
          Length = 1009

 Score =  171 bits (432), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 122/352 (34%), Positives = 176/352 (50%), Gaps = 52/352 (14%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDF--------- 66
           S+  FC GF  ++NVL+        SD   +    F+K V+++IDALR DF         
Sbjct: 39  SIAFFCKGFLLTRNVLDNVNN-LNPSDLNQDYTKKFDKAVILIIDALRFDFVIPVNSTDP 97

Query: 67  ------------LFDQDISQFNYIHELSNNGYAWGFTAF-SNPPTVTLPRLKGITTGSTP 113
                       L+DQ ISQ N      N  ++     F ++PPT TL RLKG+TTGS P
Sbjct: 98  LHNQNYHNNIITLYDQFISQNN------NKDHSSILLKFIADPPTTTLQRLKGLTTGSLP 151

Query: 114 NFLDAILNVAEDDSSSNLKNQDSWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNS 173
            F+DA  N        ++  +D+   Q     ++I F GDDTW  LF   +    +   S
Sbjct: 152 TFIDAGTNF-----DGSVIEEDNLIKQLYLKNEEIYFVGDDTWDSLFNPFLSNHSKPFES 206

Query: 174 FFVSDFEQVDHNVTR----HLEKQIKEKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHR 229
             V D + VD+ V      HL  Q      WD LI H LG+DH+GHK GP    M  K  
Sbjct: 207 LNVWDLDTVDNGVISYFNDHLINQKTNDKKWDILIGHMLGVDHVGHKYGPNHFTMREKQL 266

Query: 230 EMDSIIKNLFETVGQDENTLICVMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVP 289
           ++++ I ++ E++  D++TL+ +MGDHGM+  GNHGG S  E  + L + SKK   +E+ 
Sbjct: 267 QVNNFINDIIESI--DDDTLLVIMGDHGMDHTGNHGGDSKDELESTLFMYSKKTDVWELG 324

Query: 290 SDQKGVKLPIKSVNVAPEEDKQYKFLTQIQQVDIVPTLSALFNIPFPKNNVG 341
                      + N+    D  Y+    + Q+D+VPTLS L ++P P NN+G
Sbjct: 325 DP--------NNYNIENSGDN-YR---SVNQIDLVPTLSLLLDVPIPFNNLG 364

>YLL031C Chr12 complement(77152..80205) [3054 bp, 1017 aa] {ON}
           GPI13ER membrane localized phosphoryltransferase that
           adds phosphoethanolamine onto the third mannose residue
           of the glycosylphosphatidylinositol (GPI) anchor
           precursor; similar to human PIG-O protein
          Length = 1017

 Score =  169 bits (428), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 113/339 (33%), Positives = 169/339 (49%), Gaps = 36/339 (10%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQF 75
           S+  F  GF  S++VL+  +    S +      P FNK V++VIDALR DF    + S  
Sbjct: 49  SIAFFTRGFLLSRHVLDNIS----SQNETSKLPPRFNKAVILVIDALRFDFAIPVNESHS 104

Query: 76  NYIHELSNN------GYAWGFTAFS-------NPPTVTLPRLKGITTGSTPNFLDAILNV 122
           NY     NN       +A    A S       +PPT TL RLKG+TTGS P F+DA  N 
Sbjct: 105 NYNLNYHNNILSLYDSFASDKDASSLLLKFIADPPTTTLQRLKGLTTGSLPTFIDAGSNF 164

Query: 123 AEDDSSSNLKNQDSWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQV 182
                   +  +D++  Q     K ++F GDDTW+ LF   +  +     S  V D + V
Sbjct: 165 -----DGTVIEEDNFLKQLHLANKTVKFAGDDTWMALFHPFLSNDSFPLESLNVWDLDTV 219

Query: 183 DHNVTRHLEKQIKEKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETV 242
           D+ V  +    +++  +WD +I H LG+DH+GHK GP    M  K  ++D  I  + +++
Sbjct: 220 DNGVMDYFHDHLQQDKEWDVMIGHMLGIDHVGHKYGPDHFTMREKQIQVDQFIDWILKSI 279

Query: 243 GQDENTLICVMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSV 302
             D++TL+ ++GDHGM+  GNHGG S  E  + L L SKK   + +            + 
Sbjct: 280 --DDDTLLVILGDHGMDHTGNHGGDSIDELESTLFLYSKKPDMWRLKET--------SNY 329

Query: 303 NVAPEEDKQYKFLTQIQQVDIVPTLSALFNIPFPKNNVG 341
           N+    D        ++Q+D+V +L+ L   P P NN+G
Sbjct: 330 NI----DNLGHDYRSVRQIDLVSSLALLMGQPIPFNNLG 364

>AGR126C Chr7 complement(989235..992276) [3042 bp, 1013 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL031C
           (GPI13)
          Length = 1013

 Score =  167 bits (423), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 131/413 (31%), Positives = 199/413 (48%), Gaps = 52/413 (12%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQF 75
           ++  F  GF  S+ VL+     ++++  +  A   F++LVL+V+DALR DF+   D++  
Sbjct: 57  AIAFFTRGFLLSRKVLD-----DVANRDESTAPAKFDRLVLLVVDALRFDFVIPVDVAAE 111

Query: 76  NYIHELSNNGYA----WG----FTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDS 127
            Y     N+  A    W         ++PPT TL RLKG+TTGS P F+DA  N      
Sbjct: 112 GYNSHYHNHLRALYERWDESILLKFLADPPTTTLQRLKGLTTGSLPTFIDAGSNF----- 166

Query: 128 SSNLKNQDSWPMQFAKHGKKIRFFGDDTWLKLF-PH--EIFTEYEGTNSFFVSDFEQVDH 184
           +  + ++     Q     K I F GDDTW  LF P+   +   YE  N   V D + VD+
Sbjct: 167 NGIVIDEGYIIKQMCLINKTIYFAGDDTWDALFHPYLSNVSMPYESLN---VWDLDTVDN 223

Query: 185 NVTR----HLEKQIKEKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFE 240
            V      HL     EK +WD L+ H LG+DH+GHK GP+   M  K  ++D  I+ + +
Sbjct: 224 GVISFFEDHLLNNPTEKKEWDVLVGHMLGIDHVGHKYGPSHFSMAEKQSQVDGFIRQIID 283

Query: 241 TVGQDENTLICVMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIK 300
            V  DE+TL+ VMGDHGM+  GNHGG SP E  + L L +K+      P   +      +
Sbjct: 284 AV--DEDTLLVVMGDHGMDHTGNHGGDSPAELESTLWLYTKR------PGTWR------R 329

Query: 301 SVNVAPEEDKQYKFLTQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIKL 360
               A    +  ++   + Q+D+VP+LS L  +P P NN+G  +  +    D   +R+  
Sbjct: 330 QAPAAYNTTELGRYYRAVNQIDLVPSLSLLLGLPIPFNNLGWPIEELAH--DDDEWRLFT 387

Query: 361 QENFRQLMIVSNNKDIRQLYESYDFENTEIKDIISEMKDIQGELTSSATNYNV 413
           ++   QL    N  +           ++    I+ E+K      +S A NY  
Sbjct: 388 RQTLMQLETYRNTSN--------SITDSSKLKILEELKINANSNSSDAGNYQA 432

>TPHA0F00310 Chr6 complement(59665..62745) [3081 bp, 1026 aa] {ON}
           Anc_4.28 YLL031C
          Length = 1026

 Score =  166 bits (421), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 124/365 (33%), Positives = 180/365 (49%), Gaps = 66/365 (18%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEI--------SSDAQLNAKPAFNKLVLVVIDALRSDFL 67
           ++  F  GF  S+NVL  D + E+        SS+     +  F K V++VIDALR DF+
Sbjct: 40  AIAFFTKGFLLSRNVL--DDINELKPSMYAANSSNNGFVHQQKFEKTVILVIDALRFDFV 97

Query: 68  F--DQDISQFNYIH-----------------ELSNNGYAWGFTAFSNPPTVTLPRLKGIT 108
              + + S +N  H                 +  NN     F A  +PPT TL RLKG+T
Sbjct: 98  IPVNTNNSAYNSNHHNKITTLYDQFCKESVGKKQNNSLLLKFLA--DPPTTTLQRLKGLT 155

Query: 109 TGSTPNFLDAILNVAEDDSSSNLKNQDSWPMQFAKHGKKIRFFGDDTWLKLFP-----HE 163
           TGS P F+DA       +    +  +D+   Q   + K++ F GDDTW  LF      H 
Sbjct: 156 TGSLPTFIDA-----GSNFDGTVIEEDNLIKQMYLNNKEVFFVGDDTWDALFSPFLSNHS 210

Query: 164 IFTEYEGTNSFFVSDFEQVDHNVTRHL-------EKQIKEKNDWDALILHYLGLDHIGHK 216
           I   YE  N   V D + VD+ V  +        E+  K+ + W+ LI H LG+DH+GHK
Sbjct: 211 I--PYESLN---VWDLDTVDNGVISYFNDNLIRSEEYKKKNSQWNVLIGHMLGVDHVGHK 265

Query: 217 GGPTSKFMGPKHREMDSIIKNLFETVGQDENTLICVMGDHGMNEVGNHGGSSPGETSAGL 276
            GP    M  K  ++++ I ++   +  D++TL+ +MGDHGM+  GNHGG S  E  + L
Sbjct: 266 YGPNHFTMKEKQLQVNNFINDIINVI--DDDTLLVIMGDHGMDHTGNHGGDSIDELESTL 323

Query: 277 VLISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQYKFLTQIQQVDIVPTLSALFNIPFP 336
            L SK+   +++  D         SV    +    YK    I Q+D+VPTL+ L +IP P
Sbjct: 324 FLYSKRQNVWKLEDDH--------SVYNIDDLGSNYK---SINQIDLVPTLALLLDIPIP 372

Query: 337 KNNVG 341
            NN+G
Sbjct: 373 FNNLG 377

>Suva_10.41 Chr10 complement(81579..84632) [3054 bp, 1017 aa] {ON}
           YLL031C (REAL)
          Length = 1017

 Score =  165 bits (417), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 116/340 (34%), Positives = 170/340 (50%), Gaps = 38/340 (11%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQF 75
           S+  F  GF  S++VL+  +    + +      P FNK V++VIDALR DF+   D S  
Sbjct: 49  SIAFFTRGFLLSRHVLDNIS----TQNETTTLHPRFNKTVVLVIDALRFDFVIPVDESGS 104

Query: 76  NYIHELSNNGYAWGFTAFSN--------------PPTVTLPRLKGITTGSTPNFLDAILN 121
           N+     NN  +  + +F+N              PPT TL RLKG+TTGS P F+DA  N
Sbjct: 105 NHNLNYHNNILSL-YDSFANDKDASSLLLKFIADPPTTTLQRLKGLTTGSLPTFIDAGSN 163

Query: 122 VAEDDSSSNLKNQDSWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQ 181
                    +  +D+   Q     K ++F GDDTW+ LF   +  +     S  V D + 
Sbjct: 164 F-----DGTVIEEDNLLKQLHLANKTVKFAGDDTWMALFHPFLSNDSFPLESLNVWDLDS 218

Query: 182 VDHNVTRHLEKQIKEKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFET 241
           VD  V  +    +++  +WD +I H LG+DH+GHK GP    M  K  ++D  I  + ++
Sbjct: 219 VDKGVMDYFHDHLQQDQEWDVMIGHMLGIDHVGHKYGPDHFTMREKQVQVDEFINWILKS 278

Query: 242 VGQDENTLICVMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKS 301
           +  DENTL+ ++GDHGM+  GNHGG S  E  + L L SKK   +         KL   S
Sbjct: 279 I--DENTLLVILGDHGMDHTGNHGGDSIDELESTLFLYSKKPNLW---------KLKDSS 327

Query: 302 VNVAPEEDKQYKFLTQIQQVDIVPTLSALFNIPFPKNNVG 341
                   + Y+    ++Q+D+V +LS L   P P NN+G
Sbjct: 328 NYDISALGRDYR---SVRQIDLVSSLSLLLGQPIPFNNLG 364

 Score = 31.6 bits (70), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 53/135 (39%), Gaps = 14/135 (10%)

Query: 696 VLQYFTFFQFGGTNSIATADLTNAYNGVSEDYNIYFVGFLMCVSNFAPAIYWAMFP---- 751
           +L Y  FF  G   +I +      +  +SE     F    + ++ F P I  ++      
Sbjct: 866 LLSYQHFFTTGHQATIPSVQWDIGFM-LSEKITFPFTHIAIILNTFGPQILVSLSVALLT 924

Query: 752 -WKVIYNQIKPNNKWNVFAENKLPIVYFNCIAGCFLLLSCFI----LRYHLFIWSVFSPK 806
            W    + +KP         N   ++ +N I    L LS FI     R HL +W +F P+
Sbjct: 925 LWSQPPDVLKPQTLLGRIVSNCGILLTYNTI----LCLSSFIWVTHFRRHLMVWKIFCPR 980

Query: 807 LCYYATWNIFMNLIV 821
             + A   I   L+V
Sbjct: 981 FIFAALSLIVTQLVV 995

>Skud_12.36 Chr12 complement(68300..71350) [3051 bp, 1016 aa] {ON}
           YLL031C (REAL)
          Length = 1016

 Score =  163 bits (413), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 115/342 (33%), Positives = 175/342 (51%), Gaps = 43/342 (12%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQF 75
           S+  F  GF  S++VL+      IS+  + +  P FNK V++V+DALR DF+   + S  
Sbjct: 49  SIAFFTRGFLLSRHVLD-----NISALNETSIPPRFNKAVVLVVDALRFDFVIPVNESSS 103

Query: 76  NYIHELSNNGYAWGFTAFSN--------------PPTVTLPRLKGITTGSTPNFLDAILN 121
           N+     NN  +  + +F+N              PPT TL RLKG+TTGS P F+DA  N
Sbjct: 104 NHNLNYHNNILSL-YDSFANDEDASSLLLKFIADPPTTTLQRLKGLTTGSLPTFIDAGSN 162

Query: 122 VAEDDSSSNLKNQDSWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQ 181
                    +  +D+   Q     K ++F GDDTW+ LF   +  +     S  V D + 
Sbjct: 163 F-----DGTVIEEDNLLKQLHLVNKTVKFAGDDTWMALFHPFLSNDSFPLESLNVWDLDT 217

Query: 182 VDHNVTRHLEKQIKEKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFET 241
           VD+ V  +    +++  +WD +I H LG+DH+GHK GP    M  K  ++D  I  + ++
Sbjct: 218 VDNGVMDYFHDHLQQDKEWDVMIGHMLGIDHVGHKYGPNHFTMKEKQFQVDQFIAWILKS 277

Query: 242 VGQDENTLICVMGDHGMNEVGNHGGSSPGETSAGLVLISKK--LKNFEVPSDQKGVKLPI 299
           +  D++TL+ ++GDHGM+  GNHGG S  E  + L L SKK  + NF+  S+     L  
Sbjct: 278 I--DDDTLLVILGDHGMDHTGNHGGDSIDELESTLFLYSKKPNMWNFKDASNYNITNLGC 335

Query: 300 KSVNVAPEEDKQYKFLTQIQQVDIVPTLSALFNIPFPKNNVG 341
                       Y+    ++Q+D+V +LS L   P P NN+G
Sbjct: 336 -----------DYR---SVRQIDLVSSLSLLLGQPIPFNNLG 363

>NCAS0C05800 Chr3 (1193195..1196230) [3036 bp, 1011 aa] {ON}
           Anc_4.28
          Length = 1011

 Score =  163 bits (412), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 111/343 (32%), Positives = 170/343 (49%), Gaps = 39/343 (11%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQF 75
           ++  F  GF  ++NVL  D V  ++    +     FNK V++V+DALR DF+   + S  
Sbjct: 49  AIAFFLKGFLLTRNVL--DNVATLADYQSIENYGKFNKSVILVVDALRFDFVIPVNQSNP 106

Query: 76  NYIHELSNNGYAWGFTAF--------------SNPPTVTLPRLKGITTGSTPNFLDAILN 121
           +Y ++  +N     +  F              ++PPT TL RLKG+TTGS P F+DA  N
Sbjct: 107 DY-NDYYHNNLKVLYEKFEDQSSSSSLLLKFMADPPTTTLQRLKGLTTGSLPTFIDAGSN 165

Query: 122 VAEDDSSSNLKNQDSWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQ 181
                   ++  +D+   Q   + K++ F GDDTW  LF   +    +   S  V D + 
Sbjct: 166 F-----DGSVIEEDNIIKQMFLNDKQVLFVGDDTWDALFNPFLSPMSQPFESLNVWDLDT 220

Query: 182 VDHNVTRHLEKQIKEKND---WDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNL 238
           VD+ V       + E  +   W+ LI H LG+DH+GHK GP    M  K  ++D  I+ +
Sbjct: 221 VDNGVISFFNDHLLENTNDQSWNVLIGHMLGMDHVGHKFGPNHFTMKQKQLQIDKFIREI 280

Query: 239 FETVGQDENTLICVMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLP 298
            +++  D++TL+ +MGDHGM+  GNHGG S  E  + L L SK+              L 
Sbjct: 281 MDSI--DDDTLLVIMGDHGMDHTGNHGGDSKDELESTLFLYSKR---------NNAWNLQ 329

Query: 299 IKSVNVAPEEDKQYKFLTQIQQVDIVPTLSALFNIPFPKNNVG 341
             S      +  +Y+    + Q+D+V TLS L  +P P NN+G
Sbjct: 330 DTSNYDTRNQGDRYR---SVNQIDLVSTLSFLLGLPIPFNNLG 369

 Score = 33.1 bits (74), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 46/205 (22%), Positives = 77/205 (37%), Gaps = 22/205 (10%)

Query: 629 IYGSAKLKLIKNPIKDIQKTLTFLLIFQSPSSYIGLFMVYDIXXXXXXXXXXXXXXXXXM 688
           IYGS    L+ N I  I       +IF  P + I +F++ +                  +
Sbjct: 801 IYGSEYFLLVINWIMSI-------IIFMKPLAQISIFLMCN-QILSILEIIDLLKLKENI 852

Query: 689 ITSTISLVLQYFTFFQFGGTNSIATADLTNAYNGVSEDYNIYFVGFLMCVSNFAPAIYWA 748
           I   +  +L Y  +F  G   +I +      +  +S+          + ++ F P I  A
Sbjct: 853 IGPIVLALLSYQQYFSTGHQATIPSIQWDVGF-ILSDKITFPLTHISLALNTFGPQILIA 911

Query: 749 MFP-----WKVIYNQIKPNNKWNVFAENKLPIVYFNCIAGCFLLLSCFI----LRYHLFI 799
           +       WK   + +KP         N   ++ +N I    L LS FI     R HL +
Sbjct: 912 LSVALLTLWKQPPDVLKPQTILGRIVSNCGVLILYNSI----LCLSSFIWVTHFRRHLMV 967

Query: 800 WSVFSPKLCYYATWNIFMNLIVGWV 824
           W +F P+  +     I   +IV +V
Sbjct: 968 WKIFCPRFLFACMSLIVTQIIVTFV 992

>Smik_12.25 Chr12 complement(61505..64558) [3054 bp, 1017 aa] {ON}
           YLL031C (REAL)
          Length = 1017

 Score =  162 bits (409), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 114/339 (33%), Positives = 169/339 (49%), Gaps = 36/339 (10%)

Query: 16  SVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLF------- 68
           S+  F  GF  S++VL+  +    +SD      P FNK V++VIDALR DF         
Sbjct: 49  SIAFFTRGFLLSRHVLDNISSRNETSDL----PPRFNKAVVLVIDALRFDFAIPVNESDP 104

Query: 69  DQDISQFNYIHEL------SNNGYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNV 122
           D + +  N I  L        N  +      ++PPT TL RLKG+TTGS P F+DA  N 
Sbjct: 105 DHNPNYHNNILSLYDSFTNDKNSSSLLLKFIADPPTTTLQRLKGLTTGSLPTFIDAGSNF 164

Query: 123 AEDDSSSNLKNQDSWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQV 182
                   +  +D+   QF    K ++F GDDTW  LF   +  +     S  V D + V
Sbjct: 165 -----DGTIIEEDNLLKQFFLANKTVKFAGDDTWTALFYPFLSNDSFPLESLNVWDLDTV 219

Query: 183 DHNVTRHLEKQIKEKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETV 242
           D+ V  +    +++  +WD +I H LG+DH+GHK GP    M  K  ++D  I  +  ++
Sbjct: 220 DNGVMDYFHDHLQQDKEWDVMIGHMLGIDHVGHKYGPDHFTMREKQIQVDRFIDWILNSI 279

Query: 243 GQDENTLICVMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSV 302
             D++TL+ ++GDHGM+  GNHGG S  E  + L L SKK + +            +K  
Sbjct: 280 --DDDTLLVILGDHGMDHTGNHGGDSIDELESTLFLYSKKPEMWR-----------LKDA 326

Query: 303 NVAPEEDKQYKFLTQIQQVDIVPTLSALFNIPFPKNNVG 341
                 D  Y +   ++Q+D+V +LS L + P P NN+G
Sbjct: 327 FNYNTSDSGYNY-RSVRQIDLVSSLSLLLDQPIPFNNLG 364

 Score = 32.0 bits (71), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 53/135 (39%), Gaps = 14/135 (10%)

Query: 696 VLQYFTFFQFGGTNSIATADLTNAYNGVSEDYNIYFVGFLMCVSNFAPAIYWAMFP---- 751
           +L Y  FF  G   +I +      +  +SE     F    + ++ F P I  ++      
Sbjct: 866 LLSYQHFFTTGHQATIPSVQWDIGFM-LSEKITFPFTQIAIILNTFGPHILVSLSVALLT 924

Query: 752 -WKVIYNQIKPNNKWNVFAENKLPIVYFNCIAGCFLLLSCFI----LRYHLFIWSVFSPK 806
            W    + +KP         N   ++ +N I    L LS FI     R HL +W +F P+
Sbjct: 925 LWSQPPDVLKPQTLLGRIVSNCGVLLTYNTI----LCLSSFIWVTHFRRHLMVWKIFCPR 980

Query: 807 LCYYATWNIFMNLIV 821
             + A   I   L+V
Sbjct: 981 FIFAALSLIVTQLVV 995

>TPHA0K02180 Chr11 (466234..469320) [3087 bp, 1028 aa] {ON} Anc_4.28
           YLL031C
          Length = 1028

 Score =  154 bits (388), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 107/321 (33%), Positives = 151/321 (47%), Gaps = 52/321 (16%)

Query: 51  FNKLVLVVIDALRSDFLFDQD----ISQFNY------IHELSNN---------------- 84
           F+K V++++DALR DF+   +    I   NY      I EL N                 
Sbjct: 87  FDKAVVLLVDALRFDFVVPINELDPIYNENYHNNIDIISELLNQNDNSTKNESKKDRVQK 146

Query: 85  GYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKNQDSWPMQFAKH 144
             +  F   + PPT T  RLKGITTG  P+FLD I+ + +      +   DS   Q    
Sbjct: 147 SSSLLFKFLAEPPTTTFHRLKGITTGLLPSFLDGIMKLND-----RVVEDDSIIKQLFLR 201

Query: 145 GKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQVDHNVTRHLEKQIKEKN----DW 200
            K I F GDDTW ++F   +  +     S+ + D   VD  V +   + +  KN    +W
Sbjct: 202 NKTIYFSGDDTWSRMFEPYLSPKSVPLESYNIWDLNTVDDGVFKFFNEHLTSKNTSNREW 261

Query: 201 DALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQDENTLICVMGDHGMNE 260
           D LI H +G+DH   K GP    +  K  +++  IK + +++  D+ TL+ VMGDHGM+ 
Sbjct: 262 DILIGHIVGIDHAATKYGPNHITVKQKQIQINEFIKQIVKSL--DDQTLLIVMGDHGMDI 319

Query: 261 VGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQYKFLTQIQQ 320
            GNHGG S GE  + L L SKK   ++                     +    F  +I Q
Sbjct: 320 TGNHGGKSSGELESSLFLYSKKSSVWKQEHSL---------------HENNNDFYKKINQ 364

Query: 321 VDIVPTLSALFNIPFPKNNVG 341
           +DIVPT S LF IP P NN+G
Sbjct: 365 IDIVPTFSLLFGIPIPYNNLG 385

>YKL165C Chr11 complement(137932..140691) [2760 bp, 919 aa] {ON}
           MCD4Protein involved in glycosylphosphatidylinositol
           (GPI) anchor synthesis; multimembrane-spanning protein
           that localizes to the endoplasmic reticulum; highly
           conserved among eukaryotes
          Length = 919

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 83/332 (25%), Positives = 129/332 (38%), Gaps = 50/332 (15%)

Query: 41  SDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQFN--------YIHELSNNGYAWGFTA 92
           S  Q    P   +L L+V D LR+D  FD+     +        +I  L  N   +G + 
Sbjct: 38  SPYQSTPTPPAKRLFLIVGDGLRADTTFDKVTHPVSGKTEFLAPFIRSLVMNNATYGISH 97

Query: 93  FSNPPTVTLP-----------RLKGITTG--STPNFLDAILNVAEDDSSSNLKNQDSWPM 139
            +  PT + P            +  +T G  S P   D+  N  +   + +  + D  PM
Sbjct: 98  -TRMPTESRPGHVAMIAGFYEDVSAVTKGWKSNPVNFDSFFN--QSTHTYSFGSPDILPM 154

Query: 140 --QFAKHGKKIRFFGDDTWLKLFPHEIFTEYE-GTNSFFVSDFEQVDHNVTRHLEKQIKE 196
               A    K+     DTW+     E FT+     ++F     +Q+ HN T +     + 
Sbjct: 155 FKDGASDPNKV-----DTWMYDHTFEDFTQSSIELDAFVFRHLDQLFHNSTLNSTLDYEI 209

Query: 197 KNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQ---DENTLICVM 253
           + D +   LH LG D  GH   P S       + +D  I  L + V +   D+ T     
Sbjct: 210 RQDGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQIPILIDKVNKFFADDKTAFIFT 269

Query: 254 GDHGMNEVGNHGGSSPGETSAGLVL----ISKKLKNFEVPSDQKGVKLPIKSVNVAPEED 309
            DHGM+  G+HG   P  T   LV     ++K + N    SD       + S+       
Sbjct: 270 ADHGMSAFGSHGDGHPNNTRTPLVAWGAGLNKPVHNPFPVSDNYTENWELSSIK------ 323

Query: 310 KQYKFLTQIQQVDIVPTLSALFNIPFPKNNVG 341
                   ++Q DI   +S L  + +PKN+VG
Sbjct: 324 -----RNDVKQADIASLMSYLIGVNYPKNSVG 350

>Smik_11.64 Chr11 complement(123662..126499) [2838 bp, 945 aa] {ON}
           YKL165C (REAL)
          Length = 945

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 81/330 (24%), Positives = 126/330 (38%), Gaps = 46/330 (13%)

Query: 41  SDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQFN--------YIHELSNNGYAWGFTA 92
           S  Q  + P   +L L+V D LR+D  FD+              YI  L  N   +G + 
Sbjct: 64  SPYQSTSNPPAKRLFLIVGDGLRADTTFDKVTHPVTGKTEFLAPYIRSLVMNNATYGISH 123

Query: 93  FSNPPTVTLP-----------RLKGITTG--STPNFLDAILNVAEDDSSSNLKNQDSWPM 139
            +  PT + P            +  +T G  S P   D+  N  +   + +  + D  PM
Sbjct: 124 -TRMPTESRPGHVAMIAGFYEDVSAVTKGWKSNPVNFDSFFN--QSTHTYSFGSPDILPM 180

Query: 140 QFAKHGKKIRFFGDDTWLKLFPHEIFTEYE-GTNSFFVSDFEQVDHNVTRHLEKQIKEKN 198
                    R    DTW+     E FT+     +++      ++ HN T +     + + 
Sbjct: 181 FKDGASDPNRV---DTWMYDHTFEDFTQSSIELDAYVFRHLNELFHNSTLNSTLDYEIRQ 237

Query: 199 DWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQ---DENTLICVMGD 255
           D +   LH LG D  GH   P S       + +D  I  L + V +   D+ T      D
Sbjct: 238 DGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQIPILIDKVNKFFADDKTAFIFTAD 297

Query: 256 HGMNEVGNHGGSSPGETSAGLVL----ISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQ 311
           HGM+  G+HG   P  T   LV     ++K ++N            P+        E   
Sbjct: 298 HGMSAFGSHGDGHPNNTRTPLVAWGAGLNKPVQN----------SFPVFDNYTDNWELSN 347

Query: 312 YKFLTQIQQVDIVPTLSALFNIPFPKNNVG 341
            K    ++Q DI   +S L  + +PKN+VG
Sbjct: 348 IK-RNDVKQADIASLMSYLIGVNYPKNSVG 376

>Skud_11.60 Chr11 complement(124115..126874) [2760 bp, 919 aa] {ON}
           YKL165C (REAL)
          Length = 919

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 84/333 (25%), Positives = 120/333 (36%), Gaps = 52/333 (15%)

Query: 41  SDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQFN--------YIHELSNNGYAWGFTA 92
           S  Q    P   +L L+V D LR+D  FD+              +I  L  N   +G + 
Sbjct: 38  SPYQSTPTPPAKRLFLIVGDGLRADTTFDKVTHPVTGKTEFLAPFIRSLVMNNATYGISH 97

Query: 93  FSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKNQDSWPMQFAK---HGKKIR 149
              P            T S P  +  I    ED S+   K   S P+ F           
Sbjct: 98  TRMP------------TESRPGHVAMIAGFYEDVSAVT-KGWKSNPVDFDSFFNQSAHTY 144

Query: 150 FFGDDTWLKLF------PHEIFT-EYEGTNSFFVSDFEQVDHNVTRHLEKQIKE------ 196
            FG    L +F      P+++ T  Y+ T   F     ++D  V RHL++  +       
Sbjct: 145 SFGSPDILPMFRDGASDPNKVDTWMYDHTFEDFTQSSIELDAYVFRHLDQLFRNSTLNST 204

Query: 197 -----KNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQ---DENT 248
                + D +   LH LG D  GH   P S       + +D  I  L E V +   D+ T
Sbjct: 205 LDYEIRQDGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQIPILIEKVNRFFADDKT 264

Query: 249 LICVMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEE 308
                 DHGM+  G+HG   P  T   L+     L     P           + N     
Sbjct: 265 AFVFTADHGMSAFGSHGDGHPNNTRTPLIAWGAGLNK---PVHNSYPVFDNYTENWELSN 321

Query: 309 DKQYKFLTQIQQVDIVPTLSALFNIPFPKNNVG 341
            K+      I+Q DI   +S L  + +PKN+VG
Sbjct: 322 IKR----NDIKQADIASLMSYLIGVNYPKNSVG 350

>Suva_11.58 Chr11 complement(123117..125876) [2760 bp, 919 aa] {ON}
           YKL165C (REAL)
          Length = 919

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 80/328 (24%), Positives = 122/328 (37%), Gaps = 42/328 (12%)

Query: 41  SDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQFN--------YIHELSNNGYAWGFTA 92
           S  Q    P   +L L+V D LR+D  FD+              +I  L  N   +G + 
Sbjct: 38  SPYQSTPTPPAKRLFLIVGDGLRADTTFDKVTHPVTGKTEFLAPFIRSLVMNNATYGISH 97

Query: 93  FSNPPTVTLP-----------RLKGITTG--STPNFLDAILNVAEDDSSSNLKNQDSWPM 139
            +  PT + P            +  +T G  S P   D+  N  +   + +  + D  PM
Sbjct: 98  -TRMPTESRPGHVAMIAGFYEDVSAVTKGWKSNPVDFDSFFN--QSTHTYSFGSPDILPM 154

Query: 140 --QFAKHGKKIRFFGDDTWLKLFPHEIFTEYE-GTNSFFVSDFEQVDHNVTRHLEKQIKE 196
               A    K+     D W+     E FT+     +++     +Q+  N T +     + 
Sbjct: 155 FKDGASDPNKV-----DAWMYDHTFEDFTQSSIELDAYVFKHLDQLFRNSTLNSTLDYEI 209

Query: 197 KNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQ---DENTLICVM 253
           + D +   LH LG D  GH   P S       + +D  I  L E V +   D+ T     
Sbjct: 210 RQDGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQIPTLIEKVNKFFDDDKTAFVFT 269

Query: 254 GDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQYK 313
            DHGM+  G+HG   P  T   LV     L     P           + N      K+  
Sbjct: 270 ADHGMSAFGSHGDGHPNNTRTPLVAWGAGLNK---PVHTSYPVFDNYTENWELSSIKR-- 324

Query: 314 FLTQIQQVDIVPTLSALFNIPFPKNNVG 341
               ++Q DI   +S L  + +PKN+VG
Sbjct: 325 --NDVKQADIASLMSYLIGVNYPKNSVG 350

>KLLA0B07249g Chr2 complement(630336..633095) [2760 bp, 919 aa] {ON}
           highly similar to uniprot|P36051 Saccharomyces
           cerevisiae YKL165C MCD4 Protein involved in
           glycosylphosphatidylinositol (GPI) anchor synthesis
           multimembrane-spanning protein that localizes to the
           endoplasmic reticulum highly conserved among eukaryotes
          Length = 919

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 90/339 (26%), Positives = 127/339 (37%), Gaps = 76/339 (22%)

Query: 46  NAKPAFNKLVLVVIDALRSDFLFDQDISQFN--------YIHELSNNGYAWGFTAFSNPP 97
           +  PA  +L L+V D LR+D  FD+ +            YI +L  N   +G +    P 
Sbjct: 44  DEAPA-KRLFLIVGDGLRADTTFDKILHPVTGEHDYLAPYIRDLVRNEATYGVSHTRMP- 101

Query: 98  TVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKNQDSWPMQFAK---HGKKIRFFGDD 154
                      T S P  +  I    ED S+     Q++ P+ F       K    FG  
Sbjct: 102 -----------TESRPGHVAMIAGFYEDVSAVTKGWQEN-PVDFDSFFNQSKHTYSFGSP 149

Query: 155 TWLKLF-----PHEIFTEYEGTNSFFVSDFEQ----VDHNVTRH-------------LEK 192
             L +F     P+++     G       DF Q    +D  V RH             LE 
Sbjct: 150 DILPMFKDGATPNKVDAWMYGHE---FEDFTQSSIELDAFVFRHIYELFNNTKSNKTLET 206

Query: 193 QIKEKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQ---DENTL 249
           +IK+  D +   LH LG D  GH   P S       + +D  +K L E V +   DE+T 
Sbjct: 207 EIKQ--DGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDKEVKLLVEKVHEFFDDEDTA 264

Query: 250 ICVMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEED 309
                DHGM+  G+HG   P  T   LV            +   G+  P+K  N AP  D
Sbjct: 265 FIFTADHGMSAFGSHGDGHPNNTRTPLV------------AWGAGINKPVK--NQAPIFD 310

Query: 310 KQYK-------FLTQIQQVDIVPTLSALFNIPFPKNNVG 341
              +           + Q DI   +S L    +P N+VG
Sbjct: 311 NYTENWNLADIKRNDVNQADIASLMSYLIGANYPVNSVG 349

>TDEL0C03690 Chr3 (648638..651400) [2763 bp, 920 aa] {ON} Anc_1.184
           YKL165C
          Length = 920

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 80/325 (24%), Positives = 122/325 (37%), Gaps = 42/325 (12%)

Query: 44  QLNAKPAFNKLVLVVIDALRSDFLFDQDISQFN--------YIHELSNNGYAWGFTAFSN 95
           Q    P   +L L+V D LR+D  FD      +        YI  L  N   +G +  + 
Sbjct: 41  QSTDNPPAKRLFLIVGDGLRADTTFDLITHPTSGKTEYLAPYIRSLVLNNATYGISH-TR 99

Query: 96  PPTVTLP-----------RLKGITTGSTPNFLDAILNVAEDDSSSNLKNQDSWPMQFAKH 144
            PT + P            +  +T G   N +D      +   + +  + D  PM     
Sbjct: 100 MPTESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSAHTYSFGSPDILPMFKEGA 159

Query: 145 GKKIRFFGDDTWLKLFPHEIFTEYE-GTNSFFVSDFEQVDHNVTRHLEKQIKEKNDWDAL 203
               R    DTW      E FT+     +++     + + HN TR      + + D + +
Sbjct: 160 SDPSRV---DTWTYGHEFEDFTQSSIELDAYVFRHLDDLFHNSTRDSTLNDEIRGDGNVV 216

Query: 204 ILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQ---DENTLICVMGDHGMNE 260
            LH LG D  GH   P S       + +D  +  L + V     D++T      DHGM+ 
Sbjct: 217 FLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQVSMLSDKVRSFFGDDDTAFIFTADHGMSA 276

Query: 261 VGNHGGSSPGETSAGLVL----ISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQYKFLT 316
            G+HG   P  T   LV     ++K LKN     D       +        ED Q     
Sbjct: 277 FGSHGDGHPNNTRTPLVAWGAGLNKPLKNDYPVFDNYTFTWGL--------EDVQRH--- 325

Query: 317 QIQQVDIVPTLSALFNIPFPKNNVG 341
            ++Q DI   +S L  + +P N+VG
Sbjct: 326 DVKQADIASLMSYLIGVNYPANSVG 350

>CAGL0M08448g Chr13 complement(841439..844204) [2766 bp, 921 aa]
           {ON} highly similar to uniprot|P36051 Saccharomyces
           cerevisiae YKL165c sporulation protein
          Length = 921

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 80/329 (24%), Positives = 133/329 (40%), Gaps = 44/329 (13%)

Query: 49  PAFNKLVLVVIDALRSDFLFDQDISQFN--------YIHELSNNGYAWGFTAFSNPPTVT 100
           P   +L L+V D LR+D  FD+              +I  L  N   +G +  +  PT +
Sbjct: 46  PPAKRLFLIVGDGLRADTTFDKITHPVTKKADYLAPFIRSLVQNNATYGISH-TRMPTES 104

Query: 101 LP-----------RLKGITTGSTPNFLDAILNVAEDDSSSNLKNQDSWPM--QFAKHGKK 147
            P            +  +T G   N +D      +   + +  + D  PM    A    K
Sbjct: 105 RPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQTAHTYSFGSPDILPMFKDGASDPNK 164

Query: 148 IRFFGDDTWLKLFPHEIFTEYE-GTNSFFVSDFEQVDHNVT--RHLEKQIKEKNDWDALI 204
           +     D W+    +E FT+     +++     +Q+  N +  + L+KQI++  D +A  
Sbjct: 165 V-----DAWMYGHEYEDFTQSSIELDAYVFRHLDQLFKNSSTDKELDKQIRQ--DGNAFF 217

Query: 205 LHYLGLDHIGHKGGPTSKFMGPK----HREMDSIIKNLFETVGQDENTLICVMGDHGMNE 260
           LH LG D  GH   P S           ++++ ++K + E  G D +T      DHGM+ 
Sbjct: 218 LHLLGCDTAGHSYRPYSAEYYDNVIYIDKQVEKLVKQVEEFFG-DNDTAFIFTADHGMSA 276

Query: 261 VGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQYKFLTQIQQ 320
            G+HG   P  T   LV     L N  V  D        ++ N+A  +         ++Q
Sbjct: 277 FGSHGDGHPNNTRTPLVAWGAGL-NRPVRLDTPEFDEYTENWNLANIKRN------DVKQ 329

Query: 321 VDIVPTLSALFNIPFPKNNVGVMMPSILE 349
            DI   +S L    +P N+VG +  + +E
Sbjct: 330 ADIAALMSYLIGTNYPANSVGELPLAYIE 358

>KNAG0C01080 Chr3 complement(209716..212511) [2796 bp, 931 aa] {ON}
           Anc_1.184 YKL165C
          Length = 931

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 77/322 (23%), Positives = 123/322 (38%), Gaps = 44/322 (13%)

Query: 48  KPAFNKLVLVVIDALRSDFLFDQDISQFN--------YIHELSNNGYAWGFTAFSNPPTV 99
           +P   +L L+V D LR+D  FD               YI  L  N   +G +  +  PT 
Sbjct: 45  QPPAKRLFLIVGDGLRADTTFDMITHPVTGKTEYLAPYIRSLVENNATYGISH-TRMPTE 103

Query: 100 TLP-----------RLKGITTGSTPNFLDAILNVAEDDSSSNLKNQDSWPM---QFAKHG 145
           + P            +  +T G   N +D      +   + +  + D  PM     + H 
Sbjct: 104 SRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSTHTYSFGSPDILPMFKDGASDHN 163

Query: 146 KKIRFFGDDTWLKLFPHEIFTEYE-GTNSFFVSDFEQVDHN--VTRHLEKQIKEKNDWDA 202
           K       D W+     E FT+     +++  +  +Q+ +N  V R L+ +I++  +   
Sbjct: 164 KV------DAWMYGHEFEDFTQSSIELDAYVFNHMDQLFYNSTVNRTLDNEIRQNGN--V 215

Query: 203 LILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQ---DENTLICVMGDHGMN 259
             LH LG D  GH   P S       + +D  ++ L + V     D++T      DHGM+
Sbjct: 216 FFLHLLGCDTAGHSYRPYSPEYYDNVKYIDREVEKLMDKVHNFFDDDDTAFIFTADHGMS 275

Query: 260 EVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQYKFLTQIQ 319
             G+HG   P  T   LV     L         K   +PI      P      +    ++
Sbjct: 276 AFGSHGDGHPNNTRTPLVAWGAGLNR------PKLNDVPIYDNYTKPWNLSHIQ-RNDVK 328

Query: 320 QVDIVPTLSALFNIPFPKNNVG 341
           Q DI   +S L    +P N+VG
Sbjct: 329 QADIASLMSYLIGANYPVNSVG 350

>NCAS0B08260 Chr2 (1574633..1577407) [2775 bp, 924 aa] {ON}
           Anc_1.184 YKL165C
          Length = 924

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 78/326 (23%), Positives = 128/326 (39%), Gaps = 52/326 (15%)

Query: 48  KPAFNKLVLVVIDALRSDFLFDQDISQFN--------YIHELSNNGYAWGFTAFSNPPTV 99
           KP   +L L+V D LR+D  FD               YI  L  N   +G +  +  PT 
Sbjct: 45  KPPAKRLFLIVGDGLRADTTFDMITHPVTGKTEFLAPYIRSLVLNNATYGISH-TRMPTE 103

Query: 100 TLP-----------RLKGITTGSTPNFLDAILNVAEDDSSSNLKNQDSWPM--QFAKHGK 146
           + P            +  +T G   N +D      +   + +  + D  PM  + A    
Sbjct: 104 SRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSSHTYSFGSPDILPMFKEGATDPH 163

Query: 147 KIRFFGDDTWLKLFPHEIFTEYE-GTNSFFVSDFEQVDHNVT--RHLEKQIKEKNDWDAL 203
           K+     D W+    +E FT+     +++     + + HN T    L+ +I+++ +    
Sbjct: 164 KV-----DAWMYGHEYEDFTQSSIELDAYVFRHLDSLFHNSTLDSTLDHEIRQEGN--VF 216

Query: 204 ILHYLGLDHIGHKGGPTSKFMGPKHREMD---SIIKNLFETVGQDENTLICVMGDHGMNE 260
            LH LG D  GH   P S       + +D   SI+ +   T   D++T      DHGM+ 
Sbjct: 217 FLHLLGCDTAGHSYRPYSAEYYDNVKYIDEQVSILVDKVHTFFGDDDTAFIFTADHGMSA 276

Query: 261 VGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKS-VNVAPEEDKQYKFL---- 315
            G+HG   P  T   LV            +   G+  P+K+ V +     + +K      
Sbjct: 277 FGSHGDGHPNNTRTPLV------------AWGAGLNKPVKNEVPIYDNYTESWKLADIKR 324

Query: 316 TQIQQVDIVPTLSALFNIPFPKNNVG 341
             ++Q DI   +S L    +P N+VG
Sbjct: 325 NDVKQADITSLMSYLIGTNYPANSVG 350

>AEL113C Chr5 complement(409096..411873) [2778 bp, 925 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL165C
           (MCD4)
          Length = 925

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 76/321 (23%), Positives = 128/321 (39%), Gaps = 38/321 (11%)

Query: 46  NAKPAFNKLVLVVIDALRSDFLFDQ------DISQF--NYIHELSNNGYAWGFTAFSNPP 97
           N +P   +L L+V D LR+D  FD+        ++F   Y+  L  +   +G +  +  P
Sbjct: 43  NEEPPAKRLFLIVGDGLRADTSFDKVKHPVTGKTEFLAPYLRSLVEHNATYGISH-TRMP 101

Query: 98  TVTLP-----------RLKGITTG--STPNFLDAILNVAEDDSSSNLKNQDSWPMQFAKH 144
           T + P            +  +T G    P   D++ N  +   + +  + D  PM  +  
Sbjct: 102 TESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSVFN--QSTHTYSFGSPDILPMFKSGA 159

Query: 145 GKKIRFFGDDTWLKLFPHEIFTEYE-GTNSFFVSDFEQVDHNVTRHLEKQIKEKNDWDAL 203
               +    D W+     E FT+     +++     + +  N T   + + +   D +  
Sbjct: 160 SDPTKV---DAWMYGHEFEDFTQSSIELDAYVFRHMDALFRNATVDSKLRHEMMQDGNVF 216

Query: 204 ILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQ---DENTLICVMGDHGMNE 260
            LH LG D  GH   P S       + +DS ++ L   V +   D++T      DHGM+ 
Sbjct: 217 FLHLLGCDTAGHSYRPYSAEYYDNVKYIDSQLERLVPKVREFFGDDDTAFVFTADHGMSA 276

Query: 261 VGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQYKFLTQIQQ 320
            G+HG   P  T   LV     L N  V +D     +P+   N     D  +     + Q
Sbjct: 277 FGSHGDGHPNNTRTPLVAWGAGL-NRPVLND-----VPVYD-NYTENWDLAHVRRNDVNQ 329

Query: 321 VDIVPTLSALFNIPFPKNNVG 341
            DI   +S L  + +P N+VG
Sbjct: 330 ADIASLMSYLIGLNYPTNSVG 350

>TPHA0A02800 Chr1 complement(603610..606372) [2763 bp, 920 aa] {ON}
           Anc_1.184 YKL165C
          Length = 920

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 95/376 (25%), Positives = 144/376 (38%), Gaps = 60/376 (15%)

Query: 46  NAKPAFNKLVLVVIDALRSDFLFD--------QDISQFNYIHELSNNGYAWGFTAFSNPP 97
           +A PA  +L L+V D LR+D  FD        +      YI  +  N   +G +  +  P
Sbjct: 44  DAPPA-KRLFLIVGDGLRADTTFDLITHPVSGETAYLAPYIRSIVLNNGTYGISH-TRMP 101

Query: 98  TVTLP-----------RLKGITTG--STPNFLDAILNVAEDDSSSNLKNQDSWPM--QFA 142
           T + P            +  +T G    P   D+  N  + + + +  + D  PM  Q A
Sbjct: 102 TESRPGHVAMIAGFYEDVSAVTKGWKENPVNFDSFFN--QTNHTYSFGSPDILPMFKQGA 159

Query: 143 KHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSD-FEQVDHNVT--RHLEKQIKEKND 199
               KI     D W+     E F++       FV D   ++  N T    L +QIK+  D
Sbjct: 160 SDPNKI-----DAWMYGHEFEDFSQSSLELDAFVFDHVNELFKNATLDSDLNEQIKQ--D 212

Query: 200 WDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQ---DENTLICVMGDH 256
            +   LH LG D  GH   P S       + +D  I  L E V     D+ T      DH
Sbjct: 213 GNCFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDMQISQLVEKVNDFFGDDQTAFVFTADH 272

Query: 257 GMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQYKFLT 316
           GM+  G+HG   P  T   LV     +     P      + PI + N        Y    
Sbjct: 273 GMSAFGSHGDGHPNNTRTPLVAWGAGINK---PEKH---QYPIVN-NYTESWGFDYIKRN 325

Query: 317 QIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIKLQENFRQLMIVSNNKDI 376
            ++Q DI   +S L    +P N+VG +  S ++            E  +++  + NN   
Sbjct: 326 DVKQADIASLMSYLIGTNYPANSVGELPISFID-----------GEEGKKMHSLLNNA-- 372

Query: 377 RQLYESYDFENTEIKD 392
           + + E Y  +  EI D
Sbjct: 373 KSILEQYIVKEAEIID 388

>ZYRO0G18458g Chr7 (1522413..1525178) [2766 bp, 921 aa] {ON} highly
           similar to uniprot|P36051 Saccharomyces cerevisiae
           YKL165C MCD4 Protein involved in
           glycosylphosphatidylinositol (GPI) anchor synthesis
           multimembrane-spanning protein that localizes to the
           endoplasmic reticulum highly conserved among eukaryotes
          Length = 921

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 77/325 (23%), Positives = 122/325 (37%), Gaps = 42/325 (12%)

Query: 44  QLNAKPAFNKLVLVVIDALRSDFLFD------QDISQF--NYIHELSNNGYAWGFTAFSN 95
           Q   +P   +L L+V D LR+D  FD          +F   +I  L  N   +G +  + 
Sbjct: 41  QSTDQPPAKRLFLIVGDGLRADTTFDYVRHPATGKKEFLAPFIRSLVLNNATYGISH-TR 99

Query: 96  PPTVTLPR-----------LKGITTGSTPNFLDAILNVAEDDSSSNLKNQDSWPMQFAKH 144
            PT + P            +  +T G   N +D      +   + +  + D  PM     
Sbjct: 100 MPTESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSCFNQSTHTYSFGSPDILPMFKDGA 159

Query: 145 GKKIRFFGDDTWLKLFPHEIFTEYE-GTNSFFVSDFEQVDHNVTRHLEKQIKEKNDWDAL 203
               R    D W+     E FT+     ++F     + + HN T +     + ++D +  
Sbjct: 160 SDPNRV---DAWMYGHEFEDFTQSSIEMDAFVFKHLDDLFHNSTINNTLNNEIRHDGNVF 216

Query: 204 ILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQ---DENTLICVMGDHGMNE 260
            LH LG D  GH   P S       + +D  ++ L E V     D+ T      DHGM+ 
Sbjct: 217 FLHLLGCDTAGHSYRPYSAEYYDNVKYIDGKVETLVEQVRDFFGDDETAFVFTADHGMSA 276

Query: 261 VGNHGGSSPGETSAGLVL----ISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQYKFLT 316
            G+HG   P  T   LV     ++K + N +   D           N     D  +    
Sbjct: 277 FGSHGDGHPNNTRTPLVAWGAGLNKPVHNLKPVYD-----------NYTQGWDLSHIKRH 325

Query: 317 QIQQVDIVPTLSALFNIPFPKNNVG 341
            ++Q DI   +S L    +P N+VG
Sbjct: 326 DVKQADIASLMSYLIGANYPANSVG 350

>SAKL0C05434g Chr3 complement(516536..519643) [3108 bp, 1035 aa]
           {ON} similar to uniprot|P36051 Saccharomyces cerevisiae
           YKL165C MCD4 Protein involved in
           glycosylphosphatidylinositol (GPI) anchor synthesis
           multimembrane-spanning protein that localizes to the
           endoplasmic reticulum highly conserved among eukaryotes
          Length = 1035

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 90/407 (22%), Positives = 154/407 (37%), Gaps = 70/407 (17%)

Query: 49  PAFNKLVLVVIDALRSDFLFDQDISQFN--------YIHELSNNGYAWGFTAFSNPPTVT 100
           P   +L L+V D LR+D  FD+     +        +I  L  N   +G +  +  PT +
Sbjct: 157 PPAKRLFLIVGDGLRADTTFDKITHPVSGETTYLAPFIRSLVKNNATYGIS-HTRMPTES 215

Query: 101 LPR-----------LKGITTGSTPNFLDAILNVAEDDSSSNLKNQDSWPM--QFAKHGKK 147
            P            +  +T G   N +D      +   + +  + D  PM  + A    +
Sbjct: 216 RPGHVAMIAGFYEDVSAVTKGWQENPVDFDSFFNQSAHTYSFGSPDILPMFKEGASDPHR 275

Query: 148 IRFFGDDTWLKLFPHEIFTEYE-GTNSFFVSDFEQVDHNVTRHLEKQIKEK--NDWDALI 204
           +     D W+     E FT+     +++     +Q+ HN T  ++  ++E+     +   
Sbjct: 276 V-----DAWMYGHEFEDFTQSSIELDAYVFRHLDQLFHNST--VDTALREEIMQHGNVFF 328

Query: 205 LHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQ---DENTLICVMGDHGMNEV 261
           LH LG D  GH   P S       R +D  +  L E V     D++T      DHGM+  
Sbjct: 329 LHLLGCDTAGHSYRPYSAEYYDNVRYIDEQVAVLVEKVRDFFGDDDTAFIFTADHGMSAF 388

Query: 262 GNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQYKF--LTQIQ 319
           G+HG   P  T   LV                G+  P++  N  PE D       L +++
Sbjct: 389 GSHGDGHPNNTRTPLVAWG------------AGLNTPVR--NEKPEYDNYTATWDLAEVR 434

Query: 320 -----QVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIKLQENFRQLM---IVS 371
                Q DI   ++ L    +P N+VG +  + L   +    +  L  N R ++   +V 
Sbjct: 435 RNDVNQADIASLMAYLIGTNYPANSVGELPLAYLAGTEEAKLK-ALYNNARSILEQYLVK 493

Query: 372 NNKDIRQLYESYDFEN----------TEIKDIISEMKDIQGELTSSA 408
             + I   +   ++             EI+ +I  +   +GEL   A
Sbjct: 494 EAEVIASQFRYKEYHAFVQKPHGEYLAEIEGLIERIAQGEGELEPQA 540

>NDAI0A00980 Chr1 complement(201468..204245) [2778 bp, 925 aa] {ON}
           Anc_1.184 YKL165C
          Length = 925

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 84/326 (25%), Positives = 130/326 (39%), Gaps = 54/326 (16%)

Query: 49  PAFNKLVLVVIDALRSDFLFD------QDISQF--NYIHELSNNGYAWGFTAFSNPPTVT 100
           P   +L L+V D LR+D  FD         ++F   +I  L      +G +  +  PT +
Sbjct: 45  PPAKRLFLIVGDGLRADTTFDLITHPTTGKTEFLAPFIRSLVKTNATYGISH-TRMPTES 103

Query: 101 LP-----------RLKGITTGSTPNFLDAILNVAEDDSSSNLKNQDSWPM--QFAKHGKK 147
            P            +  +T G   N +D      +   + +  + D  PM    A    K
Sbjct: 104 RPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSTHTYSFGSPDILPMFKDGASDPNK 163

Query: 148 IRFFGDDTWLKLFPHEIFTEYEGTNSFFV-----SDFEQVDHNVTRHLEKQIKEKNDWDA 202
           +     D W+    +E FT+       +V     S F+    NVT  L+ +I+++ +   
Sbjct: 164 V-----DAWMYGHEYEDFTQSSIELDAYVFRHLDSLFKNSTSNVT--LDHEIRQEGN--V 214

Query: 203 LILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQ---DENTLICVMGDHGMN 259
             LH LG D  GH   P S       + +D  +  L + V     DE+T      DHGM+
Sbjct: 215 FFLHLLGCDTAGHSYRPYSAEYYDNVKYIDEQVSLLVDKVHDFFGDEDTAFIFTADHGMS 274

Query: 260 EVGNHGGSSPGETSAGLVL----ISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQYKFL 315
             G+HG   P  T   LV     ++K +KN EVP          +S  +A  +       
Sbjct: 275 AFGSHGDGHPNNTRTPLVAWGAGLNKPVKN-EVPIYDNYT----ESWGLADIKRN----- 324

Query: 316 TQIQQVDIVPTLSALFNIPFPKNNVG 341
             I+Q DI P +S L    +P N+VG
Sbjct: 325 -DIKQADITPLMSYLIGANYPANSVG 349

>KAFR0G00500 Chr7 complement(134741..137509) [2769 bp, 922 aa] {ON}
           Anc_1.184 YKL165C
          Length = 922

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 86/400 (21%), Positives = 152/400 (38%), Gaps = 52/400 (13%)

Query: 49  PAFNKLVLVVIDALRSDFLFDQDISQFN--------YIHELSNNGYAWGFTAFSNPPTVT 100
           P   +L L+V D LR+D  F++              +I  L  N   +G  + +  PT +
Sbjct: 46  PPAKRLFLIVGDGLRADTTFEKVTHPVTGKTEYLAPFIRSLVLNNATYG-VSHTRMPTES 104

Query: 101 LP-----------RLKGITTGSTPNFLDAILNVAEDDSSSNLKNQDSWPM--QFAKHGKK 147
            P            +  +T G   N +D      +   + +  + D  PM    A    K
Sbjct: 105 RPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSRHTYSFGSPDILPMFKDGASDPNK 164

Query: 148 IRFFGDDTWLKLFPHEIFTEYE-GTNSFFVSDFEQVDHNVTRHLEKQIKEKNDWDALILH 206
           +     D W+     E FT+     +++   + +++ +N T       + K + +   LH
Sbjct: 165 V-----DAWMYGHEFEDFTQSSIELDAYVFRNLDELFYNSTIDATLDFEIKQEGNVFFLH 219

Query: 207 YLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVG---QDENTLICVMGDHGMNEVGN 263
            LG D  GH   P S       + +D  +  L   V     D++T      DHGM+  G+
Sbjct: 220 LLGCDTAGHSYRPYSAEYYDNIKYIDEQLSILIPKVHDFFNDDDTAFIFTADHGMSAFGS 279

Query: 264 HGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQYKFLTQIQQVDI 323
           HG   P  T   LV     L   ++       K+PI   N     +  +     ++Q DI
Sbjct: 280 HGDGHPNNTRTPLVAWGAGLNKPQIN------KVPIYD-NYTESWNLSHIKRNDVKQADI 332

Query: 324 VPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIKLQENFRQLM---IVSNNKDIRQLY 380
              +S L    +P N+VG +  + +E  + + F+     N R ++   +V   + I   +
Sbjct: 333 ASLMSYLIGTNYPVNSVGELPLAYIEGKETEKFQ-AFYNNARSILEQYLVKEREVIESQF 391

Query: 381 ----------ESYDFENTEIKDIISEMKDIQGELTSSATN 410
                     +S+     EI D+I  +   + +L  +A N
Sbjct: 392 FYKEYPKFTEKSHQIYLQEIHDLIDRISQGERDLEQAAIN 431

>Ecym_8094 Chr8 (200835..203615) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii AEL113C
          Length = 926

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 80/330 (24%), Positives = 119/330 (36%), Gaps = 60/330 (18%)

Query: 48  KPAFNKLVLVVIDALRSDFLFDQDI------SQF--NYIHELSNNGYAWGFTAFSNPPTV 99
           +P   +L L+V D LR+D  FD+        ++F   +I  L  N   +G +    P   
Sbjct: 45  QPPAKRLFLIVGDGLRADTTFDKITYPSAGEAEFLAPFIRSLVMNNATYGISHTRMP--- 101

Query: 100 TLPRLKGITTGSTPNFLDAILNVAEDDSSSNLKNQDSWPMQFAK---HGKKIRFFGDDTW 156
                    T S P  +  I    ED S+   K     P+ F            FG    
Sbjct: 102 ---------TESRPGHVSMIAGFYEDVSAVT-KGWKENPVNFDSVFNQSAHTYSFGSPDI 151

Query: 157 LKLFPHEIFTEYEGTNSFFVSDFE-------QVDHNVTRHLEKQIKEKN----------- 198
           L +F        + +   +  +FE       ++D  V RHL++  +              
Sbjct: 152 LPMFKDGASDPNKVSAWMYGHEFEDFTQSSIELDAYVFRHLDQLFRNSTVNATLNEEIFQ 211

Query: 199 DWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQ---DENTLICVMGD 255
           D +   LH LG D  GH   P S       + +D  I  L + V     D++T      D
Sbjct: 212 DGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDKQISLLVDKVRDFFGDDDTAFLFTAD 271

Query: 256 HGMNEVGNHGGSSPGETSAGLVL----ISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQ 311
           HGM+  G+HG   P  T   LV     ++K ++N          K PI        E   
Sbjct: 272 HGMSAFGSHGDGHPNNTRTPLVAWGAGLNKPVRN----------KHPIHDNYTKNWELSD 321

Query: 312 YKFLTQIQQVDIVPTLSALFNIPFPKNNVG 341
            K    + Q DI   +S L    +P N+VG
Sbjct: 322 IK-RNDVNQADIASLMSYLIGANYPANSVG 350

>Kpol_2001.28 s2001 (81621..83408,83411..84382) [2760 bp, 919 aa]
           {ON} (81621..83408,83411..84382) [2760 nt, 920 aa]
          Length = 919

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 75/323 (23%), Positives = 120/323 (37%), Gaps = 48/323 (14%)

Query: 49  PAFNKLVLVVIDALRSDFLFDQDISQFN--------YIHELSNNGYAWGFTAFSNPPTVT 100
           P   +L LVV D LR+D  FD+              +I  L  N   +G +  +  PT +
Sbjct: 46  PPAKRLFLVVGDGLRADTTFDKITHPVTGKTEYLAPFIRSLVLNNGTYGISH-TRMPTES 104

Query: 101 LP-----------RLKGITTGSTPNFLDAILNVAEDDSSSNLKNQDSWPMQFAKHGKKIR 149
            P            +  +T G   N +D      +   + +  + D  PM         R
Sbjct: 105 RPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSVHTYSFGSPDILPMFKDGASDPSR 164

Query: 150 FFGDDTWLKLFPHEIFTEYE-GTNSFFVSDFEQVDHNVTRHLEKQIKEKNDWDALILHYL 208
               D W+     E FT+     ++F  +  + +  N T +     + + D +   LH L
Sbjct: 165 V---DAWMYGHEFEDFTQSSIELDAFVFNHLDTLFKNSTTNNTLNAEIRQDGNVFFLHLL 221

Query: 209 GLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQ---DENTLICVMGDHGMNEVGNHG 265
           G D  GH   P S       + +D+ +  L + V +   D+ T      DHGM+  G+HG
Sbjct: 222 GCDTAGHSYRPYSAEYYDNVKYIDNQVSVLVDKVREFFGDDETAFVFTADHGMSAFGSHG 281

Query: 266 GSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQYKF-------LTQI 318
              P  T   LV            +   GV  P++  N  P  D   +           +
Sbjct: 282 DGHPNNTRTPLV------------AWGAGVNKPVR--NEYPIYDNYTEGWNLADIKRNDV 327

Query: 319 QQVDIVPTLSALFNIPFPKNNVG 341
           +Q DI   +S L  + +P N+VG
Sbjct: 328 KQADIASLMSYLIGVNYPSNSVG 350

>TBLA0C05840 Chr3 complement(1411740..1414583) [2844 bp, 947 aa]
           {ON} Anc_1.184 YKL165C
          Length = 947

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 79/325 (24%), Positives = 124/325 (38%), Gaps = 50/325 (15%)

Query: 48  KPAFNKLVLVVIDALRSDFLFDQD----ISQFNYIHE------LSNNGYAWGFTAF---S 94
           +P   +L L+V D LR+D  FD+       + +Y+        L    Y    T     S
Sbjct: 45  EPPAKRLFLIVGDGLRADTTFDKINHPITGETDYLAPFLRSIVLEEGTYGISHTRMPTES 104

Query: 95  NPPTVTL-----PRLKGITTG--STPNFLDAILNVAEDDSSSNLKNQDSWPMQFAKHGKK 147
            P  V +       +  +T G    P   D+  N  +   + +  + D  PM F      
Sbjct: 105 RPGHVAMIAGFYEDVSAVTKGWKENPVNFDSFFN--QSKHTYSFGSPDILPM-FKDGASD 161

Query: 148 IRFFGDDTWLKLFPHEIFTEYE-GTNSFFVSDFEQVDHNVTRHLEKQIKEKNDWDALILH 206
           I     DTW+     E FT+     +++      ++  N T +     + + D +   LH
Sbjct: 162 INRI--DTWMYGHEFEDFTQSSIELDAYVFRHMNELFFNSTVNETLNYEIRQDGNVFFLH 219

Query: 207 YLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVG---QDENTLICVMGDHGMNEVGN 263
            LG D  GH   P S       + +D ++  L + V     D +T      DHGM+  G+
Sbjct: 220 LLGCDTAGHSYRPYSAEYYDNVKYIDKMVSKLVDDVTTFFNDNDTAFIFTADHGMSAFGS 279

Query: 264 HGGSSPGETSAGLVL----ISKKLKNFEVP---SDQKGVKLPIKSVNVAPEEDKQYKFLT 316
           HG   P  T   L+     I+K +KN EVP   +  +G  L     N             
Sbjct: 280 HGDGHPNNTRTPLIAWGAGINKPVKN-EVPIFDNYTEGWNLGSIKRN------------- 325

Query: 317 QIQQVDIVPTLSALFNIPFPKNNVG 341
            ++Q DI   +S L    +P N+VG
Sbjct: 326 DVKQADIASLMSYLIGANYPANSVG 350

>KLTH0F04884g Chr6 complement(431251..434019) [2769 bp, 922 aa] {ON}
           highly similar to uniprot|P36051 Saccharomyces
           cerevisiae YKL165C MCD4 Protein involved in
           glycosylphosphatidylinositol (GPI) anchor synthesis
           multimembrane-spanning protein that localizes to the
           endoplasmic reticulum highly conserved among eukaryotes
          Length = 922

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 81/329 (24%), Positives = 126/329 (38%), Gaps = 55/329 (16%)

Query: 46  NAKPAFNKLVLVVIDALRSDFLFDQ----------DISQFNYIHELSNNGYAWGFTAF-- 93
           +A PA  +L L+V D LR+D  FD+           ++ F     L+N  Y    T    
Sbjct: 44  DAPPA-KRLFLIVGDGLRADTTFDKITHPTTGETAHLAPFLRSLVLNNATYGVSHTRMPT 102

Query: 94  -SNPPTVTL-----PRLKGITTGSTPNFLDAILNVAEDDSSSNLKNQDSWPM--QFAKHG 145
            S P  V +       +  +T G   N +D      +   + +  + D  PM    A   
Sbjct: 103 ESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSAHTYSFGSPDILPMFKDGASDP 162

Query: 146 KKIRFFGDDTWLKLFPHEIFTEYE-GTNSFFVSDFEQVDHNVT--RHLEKQIKEKNDWDA 202
            K+     D W+     E FT+     +++     + + +N T  R L +QI +  +   
Sbjct: 163 NKV-----DAWMYGHEFEDFTQSSIELDAYVFRHLDNLFYNSTMDRELHEQIMQPGN--V 215

Query: 203 LILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQ---DENTLICVMGDHGMN 259
             LH LG D  GH   P S       + +D  +  L   V     D++T      DHGM+
Sbjct: 216 FFLHLLGCDTAGHSYRPYSPEYYDNVKYIDDEVSKLVPKVRDFFGDDDTAFVFTADHGMS 275

Query: 260 EVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQYKF--LTQ 317
             G+HG   P  T   L+            +   G+  P+  +N AP  D   +   L  
Sbjct: 276 AFGSHGDGHPNNTRTPLI------------AWGAGLNRPV--LNKAPIYDNYTEGWDLAN 321

Query: 318 IQ-----QVDIVPTLSALFNIPFPKNNVG 341
           IQ     Q DI   ++ L    +P N+VG
Sbjct: 322 IQRNDVKQADIASLMTYLIGADYPANSVG 350

>Kwal_33.13856 s33 complement(424296..427064) [2769 bp, 922 aa] {ON}
           YKL165C (MCD4) - (putative) involved in cell polarity
           [contig 108] FULL
          Length = 922

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 91/401 (22%), Positives = 143/401 (35%), Gaps = 67/401 (16%)

Query: 49  PAFNKLVLVVIDALRSDFLFDQDISQFN--------YIHELSNNGYAWGFTAFSNPPTVT 100
           P   +L L+V D LR+D  F++     +        +I  L  N   +G +    P    
Sbjct: 46  PPAKRLFLIVGDGLRADTTFEKITHPVSGETAHLAPFIRSLVLNNATYGVSHTRMP---- 101

Query: 101 LPRLKGITTGSTPNFLDAILNVAEDDSSSNLKNQDSWPMQFAK---HGKKIRFFGDDTWL 157
                   T S P  +  I    ED S+   K     P+ F            FG    L
Sbjct: 102 --------TESRPGHVAMIAGFYEDVSAVT-KGWKENPVDFDSFFNQSAHTYSFGSPDIL 152

Query: 158 KLF------PHEIFTEYEGTNSFFVSDFEQ----VDHNVTRHLEKQIKEKNDWDAL---- 203
            +F      PH++     G       DF Q    +D  V RHL+         + L    
Sbjct: 153 PMFKDGATDPHKVDAWMYGHE---FEDFTQSSIELDAFVFRHLDNLFNTSTTNETLRQEI 209

Query: 204 -------ILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQ---DENTLICVM 253
                   LH LG D  GH   P S       + +D  +  L   V     D++T     
Sbjct: 210 TQSGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDQELSKLVVKVRDYFGDDDTAFIFT 269

Query: 254 GDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEE-DKQY 312
            DHGM+  G+HG   P  T   LV     L         K VK P+   +   E  D   
Sbjct: 270 ADHGMSAFGSHGDGHPNNTRTPLVAWGAGL--------NKPVKNPVPIYDNYTEGWDLAT 321

Query: 313 KFLTQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIKLQENFRQLM---I 369
                ++Q DI   +S L    +P N+VG +  S +   +    +  L  N R ++   +
Sbjct: 322 IQRNDVKQADIASLMSYLIGANYPANSVGELPLSYINASEETKLK-ALYSNARSILEQYV 380

Query: 370 VSNNKDIRQLYESYDFENTEIKD---IISEMKDIQGELTSS 407
           V   + I   ++   F     K     ++E++++ G++++ 
Sbjct: 381 VKERETIESQFQYKKFPKFAAKSPAQYLNEIEELIGKVSAG 421

>TBLA0E01480 Chr5 complement(337267..340389) [3123 bp, 1040 aa] {ON}
           Anc_4.28 YLL031C
          Length = 1040

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 70/321 (21%), Positives = 119/321 (37%), Gaps = 81/321 (25%)

Query: 20  FCIGFFPSKNVLEGDAVFEI--SSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDISQFNY 77
           F  GF  ++ V +  ++     + D   N    F K +L++I  +  D L        NY
Sbjct: 53  FTRGFLLTRPVYDDVSIIPTLNTEDEAFNINSKFKKTMLIIISGISFDNLIPIPEESINY 112

Query: 78  IHELSNNGYAWGFTAFSN---------------------PPTVTLPRLKGITTGSTPNFL 116
            +E  +N     +  F+                      PPT TL R+K IT GS P+F+
Sbjct: 113 -NESYHNNLNVLYNNFNQSLQNTSNEESSSSLLIKLKTYPPTDTLQRVKCITGGSVPSFI 171

Query: 117 DAILNVAEDDSSSNLKNQDSWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNS--- 173
           D  +         ++  +D+   Q   + + I F GD  W  L+  + F  ++  N+   
Sbjct: 172 DTGITFY-----GSMIEEDNILKQMYLNNRSIYFTGDKFWNSLY-SKYFQNFKLANNIDD 225

Query: 174 ---FFVSDFEQVDHNV---TRHLEKQIK----------------------EKNDWDALIL 205
              +F       +H+     R  +K I                          DWD LI 
Sbjct: 226 IIDYFQKITTSTNHSYGESNRSSDKPISLDTNLLQNISSIPTISNATVTTPSKDWDILIG 285

Query: 206 HYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQDENTLICVMGDHGMNEVGNHG 265
           H +  D +  K             +++S + +   ++  D +TL+ V+GD+  +   NH 
Sbjct: 286 HIME-DTMNEK---------VTQLKVNSFLNDTINSI--DNDTLLLVLGDY--STANNH- 330

Query: 266 GSSPGETSAGLVLISKKLKNF 286
                    GL + +KK KNF
Sbjct: 331 -----MLDTGLFMYTKKFKNF 346

>Kwal_27.11607 s27 (873092..873775) [684 bp, 227 aa] {ON} YDR226W
           (ADK1) - adenylate kinase [contig 27] FULL
          Length = 227

 Score = 33.1 bits (74), Expect = 2.3,   Method: Composition-based stats.
 Identities = 31/115 (26%), Positives = 47/115 (40%), Gaps = 14/115 (12%)

Query: 131 LKNQDSWPMQFAKHGKKIR----FFGDDTWLKLFPHEIFTEYEGTNSFFVSDF------- 179
           L++Q +   +     KKI        DD  +K+  HE+ T  E  + F +  F       
Sbjct: 46  LRSQVAQKTELGLEAKKIMDQGGLVSDDIMVKMIKHELITNPECKSGFILDGFPRTIPQA 105

Query: 180 EQVDHNVT---RHLEKQIKEKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREM 231
           E++D  +T   R LEK I+ K D + L+    G       G    K   P  +EM
Sbjct: 106 EKLDQMLTEQGRPLEKAIELKIDDELLVSRITGRLVHPASGRSYHKIFNPPKKEM 160

>NCAS0F03460 Chr6 (693881..695062) [1182 bp, 393 aa] {ON} Anc_3.478
           YPR140W
          Length = 393

 Score = 31.6 bits (70), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 4/66 (6%)

Query: 724 SEDYNIYFVGFLMCVSNFAPAIYWAMFPWKVIYNQIKPNNKWNVFAENKLPIVYFNCIAG 783
           +E  N   +  +  +S      +WA FPWK +YN    N +W + AEN   I + N + G
Sbjct: 64  AEKENRGIMTIMNHMSTVDDPTFWAAFPWK-LYNWNPDNVRWCLGAEN---ICFSNKLLG 119

Query: 784 CFLLLS 789
            F  L 
Sbjct: 120 YFFSLG 125

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.140    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 88,052,981
Number of extensions: 4039435
Number of successful extensions: 11208
Number of sequences better than 10.0: 80
Number of HSP's gapped: 11200
Number of HSP's successfully gapped: 104
Length of query: 835
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 717
Effective length of database: 39,950,811
Effective search space: 28644731487
Effective search space used: 28644731487
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 70 (31.6 bits)