Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1035.241.319ON71771736680.0
TPHA0O014601.319ON72172313611e-178
YJL061W (NUP82)1.319ON71372010991e-139
Suva_6.1371.319ON71872310951e-139
ZYRO0G20680g1.319ON69272010821e-137
KAFR0A017201.319ON71670310641e-134
TDEL0D018801.319ON69171110561e-133
Smik_10.1791.319ON71372210551e-133
TBLA0F013101.319ON74272710441e-131
NCAS0A092101.319ON71071610131e-127
NDAI0G057501.319ON73473210141e-126
Skud_10.1581.319ON71672410091e-126
SAKL0D06930g1.319ON6907279751e-121
KNAG0C058401.319ON7477459311e-114
Kwal_14.25801.319ON6877216977e-81
KLTH0H10692g1.319ON6917266751e-77
CAGL0J05214g1.319ON7167146262e-70
Ecym_62901.319ON6717225681e-62
AEL168C1.319ON6737205416e-59
KLLA0F01661g1.319ON6877163934e-39
Suva_15.3575.88ON117283761.7
ZYRO0F07766g8.694ON1482216762.0
CAGL0J08206g1.82ON1898187752.7
Agos_YGOB_G18084singletonOFF35499699.0
NDAI0A061803.47ON583135709.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1035.24
         (717 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1035.24 s1035 complement(57897..60050) [2154 bp, 717 aa] {O...  1417   0.0  
TPHA0O01460 Chr15 complement(293395..295560) [2166 bp, 721 aa] {...   528   e-178
YJL061W Chr10 (320016..322157) [2142 bp, 713 aa] {ON}  NUP82Link...   427   e-139
Suva_6.137 Chr6 complement(228953..231109) [2157 bp, 718 aa] {ON...   426   e-139
ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]...   421   e-137
KAFR0A01720 Chr1 complement(349779..351929) [2151 bp, 716 aa] {O...   414   e-134
TDEL0D01880 Chr4 (366715..368790) [2076 bp, 691 aa] {ON} Anc_1.3...   411   e-133
Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061...   410   e-133
TBLA0F01310 Chr6 complement(329569..331797) [2229 bp, 742 aa] {O...   406   e-131
NCAS0A09210 Chr1 complement(1820713..1822845) [2133 bp, 710 aa] ...   394   e-127
NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON} Anc_1...   395   e-126
Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {...   393   e-126
SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {...   380   e-121
KNAG0C05840 Chr3 (1135516..1137759) [2244 bp, 747 aa] {ON} Anc_1...   363   e-114
Kwal_14.2580 s14 complement(821497..823560) [2064 bp, 687 aa] {O...   273   7e-81
KLTH0H10692g Chr8 complement(921787..923862) [2076 bp, 691 aa] {...   264   1e-77
CAGL0J05214g Chr10 complement(501919..504069) [2151 bp, 716 aa] ...   245   2e-70
Ecym_6290 Chr6 (543547..545562) [2016 bp, 671 aa] {ON} similar t...   223   1e-62
AEL168C Chr5 complement(320121..322142) [2022 bp, 673 aa] {ON} S...   213   6e-59
KLLA0F01661g Chr6 complement(156609..158672) [2064 bp, 687 aa] {...   155   4e-39
Suva_15.357 Chr15 complement(617637..618952,619001..621203) [351...    34   1.7  
ZYRO0F07766g Chr6 (627169..631617) [4449 bp, 1482 aa] {ON} simil...    34   2.0  
CAGL0J08206g Chr10 (809506..815202) [5697 bp, 1898 aa] {ON} simi...    33   2.7  
Agos_YGOB_G18084 Chr5 complement(940800..941861) [1062 bp, 354 a...    31   9.0  
NDAI0A06180 Chr1 complement(1405552..1407303) [1752 bp, 583 aa] ...    32   9.3  

>Kpol_1035.24 s1035 complement(57897..60050) [2154 bp, 717 aa] {ON}
           complement(57897..60050) [2154 nt, 718 aa]
          Length = 717

 Score = 1417 bits (3668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 702/717 (97%), Positives = 702/717 (97%)

Query: 1   MSFELNPIFKRPSVSRELTKRFFFSANNGTRIILFQDSTIRWSFSSDNDHYQSMALRDSD 60
           MSFELNPIFKRPSVSRELTKRFFFSANNGTRIILFQDSTIRWSFSSDNDHYQSMALRDSD
Sbjct: 1   MSFELNPIFKRPSVSRELTKRFFFSANNGTRIILFQDSTIRWSFSSDNDHYQSMALRDSD 60

Query: 61  MDVTGAIISDPGDYLCLYNSHQIRVIEIPWGLTNVDEISNSMASSLQERVYNFNEDKLSV 120
           MDVTGAIISDPGDYLCLYNSHQIRVIEIPWGLTNVDEISNSMASSLQERVYNFNEDKLSV
Sbjct: 61  MDVTGAIISDPGDYLCLYNSHQIRVIEIPWGLTNVDEISNSMASSLQERVYNFNEDKLSV 120

Query: 121 KQVLFHPLSKSSPFLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNRVEN 180
           KQVLFHPLSKSSPFLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNRVEN
Sbjct: 121 KQVLFHPLSKSSPFLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNRVEN 180

Query: 181 IQYVVFADDCLSLYSLTDTDVYCFYPCLPPVASLSKNRVDELINKSIVLYENLGIDADDI 240
           IQYVVFADDCLSLYSLTDTDVYCFYPCLPPVASLSKNRVDELINKSIVLYENLGIDADDI
Sbjct: 181 IQYVVFADDCLSLYSLTDTDVYCFYPCLPPVASLSKNRVDELINKSIVLYENLGIDADDI 240

Query: 241 VRKNVIKQLQLASSLRKKIXXXXXXXXXXXXXXXIDLEFRQTKAQGYFSISPYPESLYTC 300
           VRKNVIKQLQLASSLRKKI               IDLEFRQTKAQGYFSISPYPESLYTC
Sbjct: 241 VRKNVIKQLQLASSLRKKIEEFENANGEVEVNVEIDLEFRQTKAQGYFSISPYPESLYTC 300

Query: 301 TGKQISVLPIGEGNELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLVEIIKFKP 360
           TGKQISVLPIGEGNELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLVEIIKFKP
Sbjct: 301 TGKQISVLPIGEGNELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLVEIIKFKP 360

Query: 361 EELSNMVVLQGELGKFVVSGEKSTILVDTTKWSSVISKCIRDNDLRPLVGLEMKSTITHI 420
           EELSNMVVLQGELGKFVVSGEKSTILVDTTKWSSVISKCIRDNDLRPLVGLEMKSTITHI
Sbjct: 361 EELSNMVVLQGELGKFVVSGEKSTILVDTTKWSSVISKCIRDNDLRPLVGLEMKSTITHI 420

Query: 421 NSDMQINSCGIWNSGEAKSLLLVDTNVVVGYQLFKKEVEFKPESAEEISTELENFTLDKF 480
           NSDMQINSCGIWNSGEAKSLLLVDTNVVVGYQLFKKEVEFKPESAEEISTELENFTLDKF
Sbjct: 421 NSDMQINSCGIWNSGEAKSLLLVDTNVVVGYQLFKKEVEFKPESAEEISTELENFTLDKF 480

Query: 481 TVPENELKAANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQLKILNDISRDVGSKIVQ 540
           TVPENELKAANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQLKILNDISRDVGSKIVQ
Sbjct: 481 TVPENELKAANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQLKILNDISRDVGSKIVQ 540

Query: 541 GQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQLSKLDEKLKKQEHLEKI 600
           GQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQLSKLDEKLKKQEHLEKI
Sbjct: 541 GQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQLSKLDEKLKKQEHLEKI 600

Query: 601 LLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHKQKDQKQNIQFLKKE 660
           LLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHKQKDQKQNIQFLKKE
Sbjct: 601 LLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHKQKDQKQNIQFLKKE 660

Query: 661 LQKIIDISRSESSKGMLNEWEELRQILADDAKIIKECNEQLTQISKELDTKNTVTNS 717
           LQKIIDISRSESSKGMLNEWEELRQILADDAKIIKECNEQLTQISKELDTKNTVTNS
Sbjct: 661 LQKIIDISRSESSKGMLNEWEELRQILADDAKIIKECNEQLTQISKELDTKNTVTNS 717

>TPHA0O01460 Chr15 complement(293395..295560) [2166 bp, 721 aa] {ON}
           Anc_1.319 YJL061W
          Length = 721

 Score =  528 bits (1361), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 280/723 (38%), Positives = 466/723 (64%), Gaps = 24/723 (3%)

Query: 1   MSFELNPIFKRPSVSRELTKRFFFSANNGTRIILFQDSTIRWSFSSDND-HYQSMALRDS 59
           +S +L+ IF R SV +  +KR   + +NG +IIL+Q++T+R+ F +D D +++S+ L + 
Sbjct: 2   VSPQLHTIFNRFSVGKVSSKRSSITVDNGLKIILYQNNTVRYGFVNDADGNFKSITL-EK 60

Query: 60  DMDVTGAIISDP-GDYLCLYNSHQIRVIEIPWGLTNVDEISN-SMASSLQERVYNFNEDK 117
           +M    +II+D  G+YLCL+N  +IRVIE+PW L +  E S+  + + +Q R Y+     
Sbjct: 61  EMIGDVSIIADQIGNYLCLFNEFEIRVIELPWKLWDAKEDSSFQLDNMVQIRSYDLKSFG 120

Query: 118 LSVKQVLFHPLSKSSPFLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNR 177
            +++++LFHPL  + P LVVL   S I  +D+K + K  +IP  C        VMG+ + 
Sbjct: 121 TTIQKILFHPLGLAYPCLVVLLKNSNICSIDIKRILKVEEIPSTCITTFHTKGVMGLSSC 180

Query: 178 VENIQYVVFADDCLSLYSLTDTDVYCFYPCLPPVASLSKNRVDELINKSIVLYENLGIDA 237
           +++I  + F+ D LSLY+LT+TD+Y FYP L P  S++KN +D+L  KSI+L+ENL  D+
Sbjct: 181 IDDIIDISFSSDKLSLYALTETDIYLFYPFLIPTISVTKNEIDQLFQKSIILFENLENDS 240

Query: 238 DDIVRKNVIKQLQLASSL----RKKIXXXXXXXXXXXXXXXIDLEFRQTKAQGYFSISPY 293
            + VR+N+IKQLQL S+L    + ++               I+ E+R   AQG FSI+P+
Sbjct: 241 SEAVRRNIIKQLQLLSTLSGDIKTQMKQVKNTDETKIYNIDINTEYRSVNAQGSFSIAPF 300

Query: 294 PESLYTCTGKQISVLPIGEGNELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLV 353
           PE LY  +   +SV+ IG GNEL+++++D+GTVL++++D ES+MSWD NDY+FNNSF L+
Sbjct: 301 PEELYKQSAVNLSVIQIGHGNELYVITYDDGTVLILYRDLESSMSWDSNDYTFNNSFILL 360

Query: 354 EIIKFKPEELSNMVVLQGELGKFVVSGEKSTILVDTTKWSSVISKCIRDNDLRPLVGLEM 413
           E +KF P+E  +++ +  + G F ++G+++  L+DT+ WS ++S+CI+DND+R L GL +
Sbjct: 361 EKLKFNPDETKSILDIPFKNGIFAIAGDQTVNLIDTSCWSDILSQCIKDNDIRNLAGLSI 420

Query: 414 KSTITHINSDMQINSCGIWNSGEAKSLLLVDTNVVVGYQLFKKEVEFKPESAEEIST--- 470
           +S    IN+  + NSC +WN    K LL +    ++   +    +E   ESAE++     
Sbjct: 421 ESHKQTINTLEEPNSCILWNEHNKKELLFITETKLISSDI----LESNNESAEKLPVPAI 476

Query: 471 ----ELENFTLDKFTVPENELKAANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQLKI 526
               ++E   L  ++ P  E+  A  +++++  VPYSKVIPANI+Q PF ++  E+QL  
Sbjct: 477 NDIKKIEKLQLKNYSQPIKEINIAVQRYKDSCKVPYSKVIPANIRQKPFANDENEDQLAY 536

Query: 527 LNDISRDVGSKIVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQLSK 586
           + +IS+++GSKI+QGQ++ LM++ RL EQQD  +EQL+ TNK L+  K ++  Y  Q +K
Sbjct: 537 ITEISQEIGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNKELLHNKTIKQTYDIQSTK 596

Query: 587 LDEKLKKQEHLEKILLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHK 646
           +    ++   L +   K+   +  I++SQ+ K++P+++ E +LFKE++ Q+L+FN+ V++
Sbjct: 597 IKHITERNTKLNERTSKLIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVLIFNDAVNR 656

Query: 647 QKDQKQNIQFLKKELQKIIDISRSESSKGML----NEWEELRQILADDAKIIKECNEQLT 702
           Q++Q++ I+FL+ EL  II+   ++S   ++    +EW EL  +L  DAKII++CN +L+
Sbjct: 657 QQEQQEAIKFLQTELNNIIE-QPAQSHDAIIDSDEDEWNELCDLLNRDAKIIEDCNAELS 715

Query: 703 QIS 705
             S
Sbjct: 716 SAS 718

>YJL061W Chr10 (320016..322157) [2142 bp, 713 aa] {ON}  NUP82Linker
           nucleoporin component of the nuclear pore complex (NPC);
           also part of the NPC cytoplasmic filaments; contributes
           to nucleocytoplasmic transport and NPC biogenesis; forms
           stable associations with three FG-nucleoporins (Nsp1p,
           Nup159p, and Nup116p)
          Length = 713

 Score =  427 bits (1099), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 272/720 (37%), Positives = 422/720 (58%), Gaps = 34/720 (4%)

Query: 7   PIFKRPSVSRELTKRFFFSANNGTRIILFQDSTIRWSFSSDNDHYQSMAL-RDSDMDVTG 65
           PIF+  S+S   + R+ FS+ NGTRI+  QD+ IRW     +  Y S+   R   +D T 
Sbjct: 11  PIFQ-ASLSASQSPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNFSRHLVLDDTF 69

Query: 66  AIISD-PGDYLCLYNSHQIRVIEIPWGLTNVDEISNSMASSLQERVYNFNED----KLSV 120
            +IS   GD LCL+N ++I V+E+PWG +NV+++S  +  + Q   Y+ +E+    K S+
Sbjct: 70  HVISSTSGDLLCLFNDNEIFVMEVPWGYSNVEDVS--IQDAFQIFHYSIDEEEVGPKSSI 127

Query: 121 KQVLFHPLSKSSPFLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNRVEN 180
           K+VLFHP S     +VVL     I   D+ N   S + PI   LN   +N  G+D RV +
Sbjct: 128 KKVLFHPKSYRDSCIVVLKEDDTITMFDILN---SQEKPI--VLN-KPNNSFGLDARVND 181

Query: 181 IQYVVFADDCLSLYSLTDT---DVYCFYPCLPPVASLSKNRVDELINKSIVLYENLGIDA 237
           I  + F+ D L+LY L  T   D++ FYP LP V  L++  ++ ++NKS+V+YE+L    
Sbjct: 182 ITDLEFSKDGLTLYCLNTTEGGDIFAFYPFLPSVLLLNEKDLNLILNKSLVMYESLDSTT 241

Query: 238 DDIVRKNVIKQLQLASSLRKKIXXXXXXXXXXXXXXXIDLEFRQTKAQGYFSISPYPESL 297
           D IV++NVIKQLQ  S L +                 I  E+R  K QG F+I+P+P  L
Sbjct: 242 DVIVKRNVIKQLQFVSKLHEN-------WNSRFGKVDIQKEYRLAKVQGPFTINPFPGEL 294

Query: 298 YTCTGKQISVLPIGEG-NELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLVEII 356
           Y  T   I+ + I  G NE+  VSFD+G+++++FKD E +MSWDV++Y +NNS  L+E +
Sbjct: 295 YDYTATNIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVYNNSLVLIERV 354

Query: 357 KFKPEELSNMVVLQGELGKFVVSGEKSTILVDTTKWSSVISKCIRDNDLRPLVGLEMKST 416
           K +  E+ +++ L  +LGK  V  +     V+   W+S +SKCI ++DL PL GL+ +S 
Sbjct: 355 KLQ-REIKSLITLPEQLGKLYVISDNIIQQVNFMSWASTLSKCINESDLNPLAGLKFESK 413

Query: 417 ITHINSDMQINSCGIWNSGEAKSLLLVDTNVVVGYQLFKKEVEFKPESAE-EISTELENF 475
           +  I +  +I +    N  +  +L L+ +N  + +Q    +++ +  +AE  ISTE  + 
Sbjct: 414 LEDIATIERIPNLAYINWNDQSNLALM-SNKTLTFQNISSDMKPQSTAAETSISTEKSDT 472

Query: 476 TLD----KFTVPENELKAANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQLKILNDIS 531
             D     FT P NE+   N  FQ+A   P  ++IP+  +Q+P  + A E QL+I  DIS
Sbjct: 473 VGDGFKMSFTQPINEILILNDNFQKACISPCERIIPSADRQIPLKNEASENQLEIFTDIS 532

Query: 532 RDVGSKIVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQLSKLDEKL 591
           ++   +IV+ Q+LG+ +++R+ EQQ +L+ QL  T KI+ +   ++  + AQ  K D +L
Sbjct: 533 KEFLQRIVKAQTLGVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRRKFEAQNKKWDAQL 592

Query: 592 KKQEHLEKILLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHKQKDQK 651
            +Q  L +   K+   L+ I ES K K   +S  E++ FKE+R+QIL FN+FVH QK  +
Sbjct: 593 SRQSELMERFSKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFNSFVHSQKSLQ 652

Query: 652 QNIQFLKKELQKIIDISRSESSKGMLNEWEELRQILADDAKIIKECNEQLTQISKELDTK 711
           Q++ +LK EL + I+    +  K   NEW+ELR++L  D+KIIKECNE+L Q+S+E  TK
Sbjct: 653 QDLSYLKSELTR-IEAETIKVDKKSQNEWDELRKMLEIDSKIIKECNEELLQVSQEFTTK 711

>Suva_6.137 Chr6 complement(228953..231109) [2157 bp, 718 aa] {ON}
           YJL061W (REAL)
          Length = 718

 Score =  426 bits (1095), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 266/723 (36%), Positives = 413/723 (57%), Gaps = 35/723 (4%)

Query: 7   PIFKRPSVSRELTKRFFFSANNGTRIILFQDSTIRWSFSSDNDHYQSMAL-RDSDMDVT- 64
           PIF + S+S   + R+ FS++NGTR+++ QD  IRW     +  Y S+   R   +D T 
Sbjct: 11  PIF-QASLSANQSPRYIFSSHNGTRLVVIQDDIIRWCSLLTDPSYHSLNFSRHLVLDDTF 69

Query: 65  GAIISDPGDYLCLYNSHQIRVIEIPWGLTNVDEISNSMASSLQERVYNFNEDKLS----V 120
            AI S  GD LC Y+  +I V+EIPWG  N+ ++S  +  + Q   Y+ +E +L     +
Sbjct: 70  HAISSASGDLLCFYSDQEIFVMEIPWGYLNLGDVS--IQDAFQVFHYSVDELELGSNSPI 127

Query: 121 KQVLFHPLSKSSPFLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNRVEN 180
           K+VLFHP S +   +VVL +   I   D+ N     + PI   LN  +S+  G+D RV +
Sbjct: 128 KKVLFHPKSYNDSCIVVLKNDDTITMFDILN---QQEAPI--ILNKRNSS-FGLDARVND 181

Query: 181 IQYVVFADDCLSLYSLTDT---DVYCFYPCLPPVASLSKNRVDELINKSIVLYENLGIDA 237
           I    F+ D L+LY L  T   D++ FYP LP V SLS+  +  ++NKS+V+YE+L    
Sbjct: 182 ITDFAFSKDGLTLYCLNTTEGGDIFAFYPFLPSVLSLSEKDLGWILNKSLVMYESLNATT 241

Query: 238 DDIVRKNVIKQLQLASSLRKKIXXXXXXXXXXXXXXXIDLEFRQTKAQGYFSISPYPESL 297
           D  V++N+ KQLQ  S L K                 ID E+R  K QG F+I+P+P  L
Sbjct: 242 DYKVKRNITKQLQFVSKLHKN-------WDSKLAKVKIDDEYRLVKMQGPFTINPFPNEL 294

Query: 298 YTCTGKQISVLPI-GEGNELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLVEII 356
           Y  T  +I+ +PI  + NE+  VSFD+G+++++F+D E +MSWDV++Y +NNS  L+E I
Sbjct: 295 YDFTASKITTIPIDNQQNEIVCVSFDDGSLIILFQDLEMSMSWDVDNYVYNNSLILIERI 354

Query: 357 KFKPEELSNMVVLQGELGKFVVSGEKSTILVDTTKWSSVISKCIRDNDLRPLVGLEMKST 416
           K + +E+ ++  L  +LGK  V+ E S   +D T W+SV+SKCI ++DL  L  ++  S 
Sbjct: 355 KLQQKEMKSLTALPDQLGKLYVTLESSVHQLDCTSWTSVLSKCIDESDLNALADVKFVSK 414

Query: 417 ITHINSDMQINSCGIWNSGEAKSLLLVDTNVVVGYQLFKKEVEFKPESAEEISTELENFT 476
              I +  Q+++    N  +  SL L+    +    +   + E    +  E+ T + +  
Sbjct: 415 FEDIATIHQLSNFAYINWNDKSSLALISKEKLTIQNISNHKKEQSLNAPAELDTNVNSDK 474

Query: 477 LD--------KFTVPENELKAANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQLKILN 528
            D         FT P NE+ + N  FQ+    P  ++IP   +Q+P  + A E QL+I  
Sbjct: 475 SDTGKRGYEISFTQPINEILSLNESFQKVCLSPCERIIPPADRQLPLKNEANENQLEIFT 534

Query: 529 DISRDVGSKIVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQLSKLD 588
           DIS++   KI++ QSLG+ +Y+R+ EQQ +L+ QL  T+KI+ + + +Q    AQ  K +
Sbjct: 535 DISKEFLRKIIKAQSLGVSIYNRIHEQQFELTRQLQSTSKIIAKDEILQKKLEAQTEKWN 594

Query: 589 EKLKKQEHLEKILLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHKQK 648
            +  +Q  L     K+  NL+ + ES K K   +S  E++ FKE+R+QIL FN FVH QK
Sbjct: 595 SQSSRQAELMTRFGKLTENLSKVAESDKFKEQNISHGEMEWFKEIRNQILQFNGFVHSQK 654

Query: 649 DQKQNIQFLKKELQKIIDISRSESSKGMLNEWEELRQILADDAKIIKECNEQLTQISKEL 708
             +Q++ +LK+EL + I+     + K   NEW+ELR++L  D+KIIKECNE+L  +S++L
Sbjct: 655 SIQQDLSYLKRELIR-IESETINADKKSQNEWDELRKMLEVDSKIIKECNEELVHVSQQL 713

Query: 709 DTK 711
            TK
Sbjct: 714 TTK 716

>ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]
           {ON} similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 692

 Score =  421 bits (1082), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 254/720 (35%), Positives = 409/720 (56%), Gaps = 44/720 (6%)

Query: 1   MSFELNPIFKRPSVSRELTKRFFFSANNGTRIILFQDSTIRWSFSSDNDHYQSMALRDSD 60
           MS   + IFKR S S   +KRF  ++ +G++++++QDS+IRW  + D+  Y+ M L  + 
Sbjct: 1   MSIGSHSIFKRASGS---SKRFLCTSQDGSKVVIYQDSSIRWCNAFDS-KYEFMLLEPTI 56

Query: 61  MDVTGAIISDPGDYLCLYNSHQIRVIEIPWGLTNVDEISNSMASSLQERVYNFN--EDKL 118
            DV   ++S  G  L LYNS ++R++EIPWG + V           Q+  Y+ +  +D L
Sbjct: 57  EDVEHVVLSPTGTLLLLYNSREVRIVEIPWGYSQVS------YEGFQKFRYSVDSRQDPL 110

Query: 119 SVKQVLFHPLSKSSPFLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNRV 178
            +K+VLFHPL+     +V+L + + I  +D    +     P    LN  D    G++  V
Sbjct: 111 -IKKVLFHPLAYREHCIVILKTDNTIHLLD--RYYPYDKQPKLLVLNQHD-GAFGMEGLV 166

Query: 179 ENIQYVVFADDCLSLYSLT---DTDVYCFYPCLPPVASLSKNRVDELINKSIVLYENLGI 235
            +I+ + F+ D L+LY+L+     D+Y FYPCLP    +  +++D L++KS+V YENL +
Sbjct: 167 TDIESITFSQDGLTLYALSVAEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSV 226

Query: 236 DADDIVRKNVIKQLQLASSLRKKIXXXXXXXXXXXXXXXIDLEFRQTKAQGYFSISPYPE 295
           +  D  ++N IKQ Q  S LR+ +               I +++ + + QG F+I+P+P+
Sbjct: 227 ETPDATKRNTIKQFQFISKLRQGLENDQTKID-------IPMDWLRVRGQGPFTIAPFPD 279

Query: 296 SLYTCTGKQISVLPIGEGNELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLVEI 355
             Y  T  Q+ +LPIG  N+L L+SFD+GT++V+++D E TM WD   YS+NNS  LVE 
Sbjct: 280 RYYDRTAVQLKILPIGANNDLLLMSFDDGTIVVLYQDLELTMCWDSKGYSYNNSLVLVES 339

Query: 356 IKFKPEELSNMVVLQGELGKFVVSGEKSTI-LVDTTKWSSVISKCIRDNDLRPLVGLEMK 414
           I+ +  EL   V+ QG L +F V G  S I LVDT+ WS ++S CI ++DL P+  L+ K
Sbjct: 340 IRLERGEL---VLKQGTLSQFFVLGGTSDIYLVDTSPWSKILSNCIDNSDLEPIADLQFK 396

Query: 415 STITHINSDMQINSCGIWNSGEAKSLLLVDTNVVVGYQLFKKEVEFKPESAEEISTELEN 474
           S I+ I    QI+S  +W        + V  + V     F K      + +     +  N
Sbjct: 397 SEISKIEGVSQIDSYAMWKKDTEPKDVFVSKDTV-----FVKSTAVNDQPSTVKDEKKAN 451

Query: 475 FTLDKFTV----PENELKAANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQLKILNDI 530
             + ++ V    P +E+ + N  FQ     P SK++  + +Q    + + EEQL+IL  +
Sbjct: 452 VDIPRYEVALNQPMSEILSLNASFQTEAKKPLSKLVEPSKRQTKLNNESNEEQLEILTTV 511

Query: 531 SRDVGSKIVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQLSKLDEK 590
           S++   KIV+ Q+LG  L++R LEQQ +L+ QL  +++IL +  K++    +Q S+ + K
Sbjct: 512 SKEFLQKIVKAQALGFNLHNRCLEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSECESK 571

Query: 591 LKKQEHLEKILLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHKQKDQ 650
           +++Q+ L +    +   L  I ES K + + +++KE+  FKE+R+Q+L+FN +VH QK+Q
Sbjct: 572 IQRQDKLLQRFNSLSEKLGRINESPKFREMNITDKEMAWFKEIRNQVLVFNQYVHHQKNQ 631

Query: 651 KQNIQFLKKELQKII--DISRSESSKGMLNEWEELRQILADDAKIIKECNEQLTQISKEL 708
           +  +++L+KEL+ I   D    E SK   +EW EL  IL  D KIIKECN QL   S E+
Sbjct: 632 QDQLRYLQKELENISLEDKDVGEKSK---SEWTELLSILESDTKIIKECNNQLAHASSEV 688

>KAFR0A01720 Chr1 complement(349779..351929) [2151 bp, 716 aa] {ON}
           Anc_1.319 YJL061W
          Length = 716

 Score =  414 bits (1064), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 254/703 (36%), Positives = 392/703 (55%), Gaps = 52/703 (7%)

Query: 33  ILFQDSTI------RWSFSSDNDHYQSMALRDSDMDVTGAIISDPGDYLCLYNSHQIRVI 86
           IL QDS+I      RW   + + ++    L   D      IIS+ G +LCLY+   + +I
Sbjct: 41  ILAQDSSIYKKNQLRWGSVASSQYHSLPLLFFDDSAYENVIISNSGQFLCLYDKKSLSLI 100

Query: 87  EIPWGLTNVDEISNSMASSLQERVYNFNEDKLSVKQVLFHPLSKSSPFLVVLFSGSQIAF 146
           EIPWG    D    S+ SS Q RV+        +K++LFHP +     +V+LF    I  
Sbjct: 101 EIPWGY---DGAVTSIKSSFQ-RVFRDVNKSSDIKKILFHPKAADDGCVVILFENDVICL 156

Query: 147 VDLKNVFKSSDIPIDCFLNLTDSNVMGIDNRVENIQYVVFADDCLSLYSLTDTD---VYC 203
            DL+   K        FLN T +N +GI+ RV +I+ + F+ D L+LY L+ TD   +Y 
Sbjct: 157 FDLRKSEK-------LFLNKT-ANKLGIETRVTDIEDMEFSQDGLTLYMLSVTDGGDIYA 208

Query: 204 FYPCLPPVASLSKNRVDELINKSIVLYENLGIDADDIVRKNVIKQLQLASSLRKKIXXXX 263
           FYPCLPP  SL K+ +++L NKS +LY++L       VRKNV+KQ++  +SLR       
Sbjct: 209 FYPCLPPKLSLKKSVLEDLFNKSRILYDSLDSTVSIEVRKNVLKQIKFIASLRD-----S 263

Query: 264 XXXXXXXXXXXIDLEFRQTKAQGYFSISPYPESLYTCTGKQISVLPIGEGNELFLVSFDN 323
                      I  +FRQ KAQG F+++PYPE LY  T K+I  L IG  NELF ++FDN
Sbjct: 264 SSDETKNSCLEISNDFRQVKAQGPFTVAPYPEKLYEATAKEIYTLDIGNNNELFAITFDN 323

Query: 324 GTVLVVFKDKESTMSWDVNDYSFNNSFTLVEIIKFKPE--ELSNMVVLQGELGKFVVSGE 381
           GTV ++ KD E +MSW+ ++Y +NNSF L+E ++  PE  +L     L G++  F+    
Sbjct: 324 GTVTLLLKDLELSMSWNADNYVYNNSFVLIESVEMGPESIKLLKSSSLTGQM--FISQNH 381

Query: 382 KSTILVDTTKWSSVISKCIRDNDLRPLVGLEMKSTITHINSDMQINSCGIWNSGEAKSLL 441
            S   +DTT WS  +SKCI ++DL  L+ ++ KS I+ ++    ++  G+W+    + +L
Sbjct: 382 SSVRKIDTTAWSFKVSKCITNSDLTSLIDVDFKSKISDLDIKENVDCYGVWSLRGERGIL 441

Query: 442 LVDTNVVVGYQLFKKEVEFKPESAEEISTELENFTLDK-------------FTVPENELK 488
            V  + V+   L        PES      +L+  +  K             FT P +E+ 
Sbjct: 442 FVSNSSVISRTL--------PESDSSFVIKLDEMSRSKNIEDPVTKKYEVSFTQPISEIM 493

Query: 489 AANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQLKILNDISRDVGSKIVQGQSLGLML 548
             N  FQ     P+ K+I    +Q    +++ E QL  L +IS D+ S IV+GQSLGL+L
Sbjct: 494 NLNDSFQRICRHPFKKIISPEERQTVLSNDSNETQLATLTEISNDLVSNIVEGQSLGLVL 553

Query: 549 YDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQLSKLDEKLKKQEHLEKILLKMESNL 608
            +RL EQQ +L++QL  + +++ +   ++  Y  ++ + ++ LKKQ+ L +    +  NL
Sbjct: 554 RNRLYEQQYELTKQLKESIQLIEKQSLLKSSYDDKMVRWNKNLKKQDELIQRFNALNGNL 613

Query: 609 NTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHKQKDQKQNIQFLKKELQKIIDIS 668
             I ES+++   P+SEKE++ FKE+R+QIL FN+FVH  ++ ++ I FL+K L + I+  
Sbjct: 614 AKIHESKEISKTPISEKEVEWFKEVRNQILKFNDFVHVHRNMQEQINFLRKGLSR-IESK 672

Query: 669 RSESSKGMLNEWEELRQILADDAKIIKECNEQLTQISKELDTK 711
             + S  + +EW E ++IL  D  IIKECNE+LT+   +LD +
Sbjct: 673 VGQRSSHLTSEWAEFKKILETDTNIIKECNEELTKAHTQLDAE 715

>TDEL0D01880 Chr4 (366715..368790) [2076 bp, 691 aa] {ON} Anc_1.319
           YJL061W
          Length = 691

 Score =  411 bits (1056), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 237/711 (33%), Positives = 398/711 (55%), Gaps = 27/711 (3%)

Query: 1   MSFELNPIFKRPSVSRELTKRFFFSANNGTRIILFQDSTIRWSFSSDNDHYQSMALRDSD 60
           M+ E +PIF+    ++  + RFF + ++G R ++ QDS IRW   S+   Y SM L  + 
Sbjct: 1   MTVETHPIFRPSLTAQSGSDRFFLTTSDGGRAVVVQDSCIRWCNVSEPG-YHSMTLERAF 59

Query: 61  MDVTGAIISDPGDYLCLYNSHQIRVIEIPWGLTNVDEISNSMASSLQERVYNFNEDKLSV 120
            DV   ++S+ G++LCLYN  ++R+IE+PW  T V    +SMA++ Q  ++ F  D+  +
Sbjct: 60  KDVKHVVMSNSGEFLCLYNDDELRIIEVPWAYTEV----SSMANAFQ--LFRFVSDEARI 113

Query: 121 KQVLFHPLSKSSPFLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNRVEN 180
           KQVLFHPL+     +V+L     I  ++ ++ F  S   +   LNL++     +D+ + +
Sbjct: 114 KQVLFHPLAYQQETVVILKDDDSITIMNWQD-FGDSKPDV---LNLSN-GTYSLDSSITD 168

Query: 181 IQYVVFADDCLSLYSLT---DTDVYCFYPCLPPVASLSKNRVDELINKSIVLYENLGIDA 237
           ++ + F+ D L+LY L+     D+Y FYPCL P     K  +D L+ KS++ Y+ L +  
Sbjct: 169 VECITFSQDGLTLYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGT 228

Query: 238 DDIVRKNVIKQLQLASSLRKKIXXXXXXXXXXXXXXXIDLEFRQTKAQGYFSISPYPESL 297
           D  V++N IKQL+  S L K+                I    RQ + QG F+I+P+P+ +
Sbjct: 229 DSEVKRNTIKQLKFVSGLHKQ--------QNSQRILEIPEAQRQVRGQGPFTIAPFPKQI 280

Query: 298 YTCTGKQISVLPIGEGNELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLVEIIK 357
           Y+ TG  I+ LPI + NEL ++S D+G + ++ +D + TM+WD   Y++NNSF LVE+I 
Sbjct: 281 YSSTGTGIASLPINDQNELLIMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVELIT 340

Query: 358 FKPEELSNMVVLQGELGKFVVSGEKSTILVDTTKWSSVISKCIRDNDLRPLVGLEMKSTI 417
              +E+  +VV   + G+F V   +    +DT+KWS V++ C+ ++DLRPL   +++S +
Sbjct: 341 LGSQEIQQIVVGDHKYGQFSVMTPEGVFSIDTSKWSGVMASCLTESDLRPLAETKLESEV 400

Query: 418 THINSDMQINSCGIWNSGEAKSLLLVDTNVVVGYQLFKKEVEFKPESAEEISTELENFTL 477
           T         S   WN+   +S++ V    V   Q+  + V  + +       E E +  
Sbjct: 401 TFTELKDSPKSVAWWNT-TPQSVVKVSNREVKSKQV-SEGVSKQDDDITGSRQEPEKYNA 458

Query: 478 DKFTVPENELKAANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQLKILNDISRDVGSK 537
             ++ P  E+   N KFQ   S   SKVIP   +Q P  + A E QL +L + S+D  SK
Sbjct: 459 -HYSQPIAEIMQLNQKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLTEASKDFVSK 517

Query: 538 IVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQLSKLDEKLKKQEHL 597
           I  GQ+LG+ L++R+ EQQ  L+ QL  + +++ + + +   + +Q S+ D    +   L
Sbjct: 518 IAVGQTLGVTLHNRIYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSDAVHARHSTL 577

Query: 598 EKILLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHKQKDQKQNIQFL 657
                K + NL  IQ SQ+ K L +S++E++ FKE+R Q+L FN  VH QK  +  +  L
Sbjct: 578 MSRFNKFKDNLGQIQNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQKRLQDQLIHL 637

Query: 658 KKELQKIIDISRSESSKGMLNEWEELRQILADDAKIIKECNEQLTQISKEL 708
           K+E+ +I  ++  ++S+   +EW ELR +L +D  I+++CN QL   ++++
Sbjct: 638 KQEMNRIAQVTGDQNSQAR-DEWHELRHMLEEDTIILQDCNNQLKSAARQV 687

>Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061W
           (REAL)
          Length = 713

 Score =  410 bits (1055), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 263/722 (36%), Positives = 416/722 (57%), Gaps = 38/722 (5%)

Query: 7   PIFKRPSVSRELTKRFFFSANNGTRIILFQDSTIRWSFSSDNDHYQSMAL-RDSDMDVTG 65
           PIF + S+S   + R+ F++ NGTRI+  QD+ IRW     +  Y S++L R   +D T 
Sbjct: 11  PIF-QASLSASQSPRYIFTSQNGTRIVFIQDNIIRWYNVLTDPCYHSLSLSRHLVLDDTF 69

Query: 66  AIISD-PGDYLCLYNSHQIRVIEIPWGLTNVDEISNSMASSLQERVYNFNEDKLS----V 120
            +IS   GD LC +N  +I V+E+PWG +NV+ IS  +  + Q   Y+ +E +L     +
Sbjct: 70  HVISSTSGDLLCFFNDQEIFVMEVPWGYSNVENIS--IQDAFQVFHYSVDETELGPKSLI 127

Query: 121 KQVLFHPLSKSSPFLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNRVEN 180
           K+VLFHP S     +VVL     I   D+ N     + PI   LN   +N  G+D R+ +
Sbjct: 128 KKVLFHPKSYHDSCIVVLKENDTIIMFDILN---QQEKPI--ILN-KPNNSFGLDARLND 181

Query: 181 IQYVVFADDCLSLYSLTDT---DVYCFYPCLPPVASLSKNRVDELINKSIVLYENLGIDA 237
           I  +VF+ D L+LY L  T   D++ FYP LP    L++N +  ++NKS+V+YE+L    
Sbjct: 182 ITDLVFSKDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKSLVMYESLDPTT 241

Query: 238 DDIVRKNVIKQLQLASSLRKKIXXXXXXXXXXXXXXXIDLEFRQTKAQGYFSISPYPESL 297
           D  V++N+IKQLQ  S L +                 ID E+R  K QG F+I+P+P  L
Sbjct: 242 DVTVKRNIIKQLQFVSKLHEN-------WDSKLNKVDIDSEYRLVKVQGPFTINPFPNEL 294

Query: 298 YTCTGKQISVLPI-GEGNELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLVEII 356
           Y  T K I+ + I  + NE+F +SFD+G+++++ KD E +MSWDV +Y +N+S  L+E +
Sbjct: 295 YDYTAKNIATISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWDVGNYVYNDSLVLIERV 354

Query: 357 KFKPEELSNMVVLQGELGKFVVSGEKSTILVDTTKWSSVISKCIRDNDLRPLVGLEMKST 416
           K + +E+ +++ L  ++GK  V  +     V++T W+S ISKCI ++DL PL  L+ +S 
Sbjct: 355 KMQ-KEIESLITLPEQMGKLYVFSKNFVYQVNSTSWTSTISKCINESDLNPLGDLKFESK 413

Query: 417 ITHINS-DMQINSCGI-WNSGEAKSLLLVDTNVVVGYQLFKKEVEFKP-ESAEEISTELE 473
           I +I + +   N   I WN+    S L + +N  + +Q    + + +  E+  +I TE  
Sbjct: 414 IENIATVEGMPNLAHIYWNNT---SNLALASNKELTFQTVSVDQKMQSTETETDIGTEES 470

Query: 474 NFTLDK----FTVPENELKAANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQLKILND 529
                +    FT P +E+   N  FQ A   P  ++IP+  +Q+P  + A E QL+I  D
Sbjct: 471 GLAKCRYELRFTQPLSEILTLNENFQRACISPCEQIIPSTDRQIPLKNEASENQLEIFTD 530

Query: 530 ISRDVGSKIVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQLSKLDE 589
           +S++   KI + QSLG+ +Y+R+ EQQ +L+ QL  T KI+ +   ++  + AQ  K D 
Sbjct: 531 VSKEFLQKIAKAQSLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKKFEAQNKKWDA 590

Query: 590 KLKKQEHLEKILLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHKQKD 649
           ++ +Q  L +   K+  NL+ I +S K K   +S  E++ FKE+R+QIL FN +VH QK 
Sbjct: 591 QIIRQSKLMERFSKLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQFNCYVHSQKS 650

Query: 650 QKQNIQFLKKELQKIIDISRSESSKGMLNEWEELRQILADDAKIIKECNEQLTQISKELD 709
            +Q++ +LK+EL + I+    +  K   +EW ELR++L  D+KIIKECNE+L   S++L 
Sbjct: 651 LQQDLSYLKRELTR-IETETIQVDKKSQSEWNELRKMLEIDSKIIKECNEELQHASQQLT 709

Query: 710 TK 711
           TK
Sbjct: 710 TK 711

>TBLA0F01310 Chr6 complement(329569..331797) [2229 bp, 742 aa] {ON}
           Anc_1.319 YJL061W
          Length = 742

 Score =  406 bits (1044), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 254/727 (34%), Positives = 404/727 (55%), Gaps = 35/727 (4%)

Query: 6   NPIFKRPSVS---RELTKRFFFSANNGTRIILFQDSTIRWSFS-SDNDHYQSMALRDSDM 61
           +PIFKR  +S   +E + RFFF+ N   R+++ QD +IRW ++ S N H  ++A R+   
Sbjct: 18  HPIFKRNYLSSSFQETSPRFFFTTNRDNRVVVVQDGSIRWCYTFSQNYHSYTIASRN--F 75

Query: 62  DVTGAIISDPGDYLCLYNSHQIRVIEIPWGLTNVDEISNSMASSLQERVYNFNEDKLSVK 121
           D+  ++IS+ G ++C Y+   I ++EIPW  +N   ++ S +  +Q+  Y+F +  L+VK
Sbjct: 76  DIKDSLISNSGSFVCYYSDTDISIMEIPWSHSN--SVNASSSHCIQKYRYSFKKYSLTVK 133

Query: 122 QVLFHPLSKSSPFLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNRVENI 181
           QVLFHPL+     LVVL S   I F+D    F    +  D  LN   S  +G+ +++ +I
Sbjct: 134 QVLFHPLATLESCLVVLLSDDTIVFIDFSKSFDL--LSSDYILN-KKSKSIGLSSQISDI 190

Query: 182 QYVVFADDCLSLYSLTD---TDVYCFYPCLPPVASLSKNRVDELINKSIVLYENLGIDAD 238
           Q + F+ D L+LY+L+    TDVY FYPCLPP A  S  +++ L+NKS+V YE L  D  
Sbjct: 191 QSLTFSQDGLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVVQYEELREDDP 250

Query: 239 DIVRKNVIKQLQLASSLRKKIXXXXXXXXXXXX-XXXIDLEFRQTKAQGYFSISPYPESL 297
             ++ N+IKQL+  S L KK                 + LE+R  + QG F+ISP+P+SL
Sbjct: 251 TALKINIIKQLKFTSDLYKKGKRALEEDTDSKTWKYDVPLEYRLIRPQGPFTISPFPDSL 310

Query: 298 YTCTGKQISVLPIGEGNELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLVEIIK 357
           Y  +   I  +PI   NEL ++SF +G+V+ +F+D E TMSWD ++++ NNS  L+E+IK
Sbjct: 311 YYSSPTHIVSVPIDTTNELLVLSFSDGSVVSLFQDLELTMSWDQDNFNENNSLVLLELIK 370

Query: 358 FKPEELSNMVVLQGELGKFVVSGEKSTILVDTTKWSSVISKCIRDNDLRPLVGLEMKSTI 417
            K + +  +     + G F + G      V T+ WSS ++ CI+ +D+R L  L +KS I
Sbjct: 371 TKEQNIRKLTTYAHQYGTFYILGSVKNFEVLTSHWSSTLAICIKSSDIRDLSNLLIKSVI 430

Query: 418 THI-NSDMQINSCGIWNSGEAKSLLLVDTNVVVGYQLFKKEVEFKPESAEEISTELENFT 476
               N+  ++ S G W S    SLL ++ + V+     K ++    ++   +++EL    
Sbjct: 431 KPFDNAAYELTSGGWWCSPTISSLLFINKSTVIELNE-KPKLLLSDDTTHLLTSELAQKY 489

Query: 477 LD-------KFTVPE----NELKAANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQLK 525
           +        K  +P     ++L   N  F+E  +   +  IP+  + V   +   E QL+
Sbjct: 490 IPPLEDKIFKIELPMGILISDLNNMNTVFKEESNKQLTIPIPSQERNVTLFNKTNENQLE 549

Query: 526 ILNDISRDVGSKIVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQLS 585
            L  IS+ +G KI  GQSLG  +Y+++L+QQ+ +  QL  T ++L + K +   Y  Q  
Sbjct: 550 TLTKISKVIGIKISMGQSLGFGIYNKILDQQNIVELQLRQTQRLLEKEKILNTKYNEQAD 609

Query: 586 KLDEKLKKQEHLEKILLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVH 645
           KL    ++QE L   LL M   L        L ++ +S+KE++ FKE+R Q+LLFN FVH
Sbjct: 610 KLRAFTERQEKLMSRLLIMNEKLKKADLDTNLLNISISKKELEFFKEIRKQVLLFNEFVH 669

Query: 646 KQKDQKQNIQFLKKELQKIIDISRSESS---KGMLNEWEELRQILADDAKIIKECNEQLT 702
           KQKDQ   + F+KKEL +I    + E++   +    +W+ LR +L DDA  I+ C E + 
Sbjct: 670 KQKDQHDTLLFIKKELIRI----KGENAIVDENDFKQWDRLRDMLHDDATTIETCTESIK 725

Query: 703 QISKELD 709
            I+ +LD
Sbjct: 726 NINFDLD 732

>NCAS0A09210 Chr1 complement(1820713..1822845) [2133 bp, 710 aa]
           {ON} Anc_1.319 YJL061W
          Length = 710

 Score =  394 bits (1013), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 242/716 (33%), Positives = 395/716 (55%), Gaps = 28/716 (3%)

Query: 6   NPIFKRPSVSRELTKRFFFSANNGTRIILFQDSTIRWSFSSDNDHYQSMALRDSDMDVTG 65
           +PIF+    +++   RF F++++GTR+++ Q   +RW  S     + SM +     + T 
Sbjct: 10  HPIFQGLDCTQDAAPRFLFTSHHGTRMVVLQGGLLRWC-SVTASSFNSMTIDFFQPESTA 68

Query: 66  ---AIISDPGDYLCLYNSHQIRVIEIPWGLTNVDEISNSMASSLQERVYNFNEDK--LSV 120
              AI+S+ G+++C+Y +H I VIEIPWG       S SM S  Q   YN  +D     +
Sbjct: 69  PQKAILSNSGEFICVYTNHTIEVIEIPWGYVTP---SPSMVSKFQLFSYNNKDDDGYSPI 125

Query: 121 KQVLFHPLSKSSPFLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNRVEN 180
           KQVLFHP +     LVVL+    I+ +D+  + K+        LN   +   GID ++ +
Sbjct: 126 KQVLFHPEAYKDSCLVVLYDNGTISLMDVTQITKT------ITLNKRVA-TFGIDTQITD 178

Query: 181 IQYVVFADDCLSLYSLT---DTDVYCFYPCLPPVASLSKNRVDELINKSIVLYENLGIDA 237
           I+ + F+ D  +LY+L+     D+Y FYPCLP    + + ++  L+++S++LYE+L +D 
Sbjct: 179 IESICFSKDGWTLYALSISDGGDIYAFYPCLPQQLEVKREKITSLLHESVLLYESLKLDT 238

Query: 238 DDIVRKNVIKQLQLASSLRKKIXXXXXXXXXXXXXXXIDLEFRQTKAQGYFSISPYPESL 297
           D  V++NVI+Q+Q  + L   +               I+ E+R  + QG F+I PYPE L
Sbjct: 239 DRDVKRNVIRQVQFVNKLNGLLTENEKNSNEDFIE--IEQEYRLIRGQGPFTIDPYPERL 296

Query: 298 YTCTGKQISVLPIGEGNELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLVEIIK 357
           Y+ T  +IS LPI   NEL  + FD+G++ ++FKD   TMSWDV++Y  NNSF+LVE+++
Sbjct: 297 YSATALEISTLPINSNNELMCMIFDDGSIALLFKDLPLTMSWDVDNYVHNNSFSLVELMQ 356

Query: 358 FKPEELSNMVVLQGELGKFVVSGEKSTILVDTTKWSSVISKCIRDNDLRPLVGLEMKSTI 417
            K  ++  +V      G+F + G+ S  LV T  WS +++K I +++L  L+ +   S +
Sbjct: 357 LKDTDVKRIVSYPDTYGQFFIFGDSSLFLVHTHIWSDLLAKAIDNSNLNELLEMNFTSKL 416

Query: 418 THINSDMQINSCGI--WNSGEAKSLLLVDTNVVVGYQLFKKEVEF---KPESAEEISTEL 472
               +   I  C    W  G    L +   +V +     +K       KP        + 
Sbjct: 417 DFFETTNGITKCSPCKWR-GRDVILFITKEDVYMHPVEMRKSGILGNNKPVLVNNEELKH 475

Query: 473 ENFTLDKFTVPENELKAANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQLKILNDISR 532
           + +    F  P  EL A N  FQ+  S+  SK+I    +QV   +   E QL++L+D+S+
Sbjct: 476 QEYKT-SFKQPVEELMALNKLFQQQCSMGVSKLIAPEERQVLLNNENNEVQLELLSDVSK 534

Query: 533 DVGSKIVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQLSKLDEKLK 592
           +V SKI QGQ+L L L+ RLLEQQ +L+ QL I + I+ +   ++     Q  + D++  
Sbjct: 535 EVISKIGQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRRKSEEQSRRWDDQTS 594

Query: 593 KQEHLEKILLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHKQKDQKQ 652
           +   L K L  +++ +  I  S KLK  P+++KE++ FKE+R+Q+L FN+FVH Q+D ++
Sbjct: 595 RSSQLIKRLQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQVLKFNSFVHNQRDAQE 654

Query: 653 NIQFLKKELQKIIDISRSESSKGMLNEWEELRQILADDAKIIKECNEQLTQISKEL 708
            +  LKK+L +I   +     +    EW+ELR IL  DA+II+ECN++L   ++ L
Sbjct: 655 ELNHLKKDLARISKETSQLRDEKSDKEWDELRDILKHDAQIIQECNKELLSTTEAL 710

>NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON}
           Anc_1.319 YJL061W
          Length = 734

 Score =  395 bits (1014), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 247/732 (33%), Positives = 396/732 (54%), Gaps = 43/732 (5%)

Query: 6   NPIFKRPSVSRELTKRFFFSANNGTRIILFQDSTIRWSFSSDNDHYQSMALR---DSDMD 62
           +PIF    ++ E ++RFFF+++ GTR++L Q   ++W    D   Y SM ++   ++   
Sbjct: 11  HPIFGTSIITNEDSQRFFFTSHQGTRMVLLQGCILKWCNVIDTT-YHSMKVKSIFNNKRK 69

Query: 63  VTGAIISDPGDYLCLYNSHQIRVIEIPWGLTNVDEISNSMASSLQERVYNFNEDKL---- 118
           +    +S+ GD+LC+Y +  I ++EIPWG    ++I + + S  Q   Y+ +        
Sbjct: 70  IIDVKLSESGDFLCIYTTKTIDILEIPWG---YEKIPDELLSKFQPFHYDISSSTSALSS 126

Query: 119 --SVKQVLFHPLSKSSPFLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDN 176
              +KQVLFHP S     LV+L+  S I  +D      +  I I+       +  +G++ 
Sbjct: 127 PSDIKQVLFHPKSYHETCLVILYEDSIIQLID--TTASTETITIN-----QPTGTLGVET 179

Query: 177 RVENIQYVVFADDC-LSLYSLT---DTDVYCFYPCLPPVASLSKNRVDELINKSIVLYEN 232
           RV +I+ + F     L LY+L+     D+Y  YPCLP    +SK  VD L+ KSIVLY++
Sbjct: 180 RVIDIESICFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLYDS 239

Query: 233 LGIDADDIVRKNVIKQLQLASSLR----------KKIXXXXXXXXXXXXXXXIDLEFRQT 282
           L  +  + V++NVIKQLQ A+ L+          K                 +DLE+R  
Sbjct: 240 LKENMSNDVKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDLEYRLV 299

Query: 283 KAQGYFSISPYPESLYTCTGKQISVLPIGEGNELFLVSFDNGTVLVVFKDKESTMSWDVN 342
             QG F+ISP+P  LY+ T K+   + I E NEL +++FD+G+V ++F+D E TMSWD+ 
Sbjct: 300 NFQGPFTISPFPNELYSATAKESQCMKINENNELLIMTFDDGSVALLFRDLELTMSWDIA 359

Query: 343 DYSFNNSFTLVEIIKFKPEELSNMVVLQGELGKFVVSGEKSTILVDTTKWSSVISKCIRD 402
           +Y  +NSF LVE+IK KP ++  +++ Q   GKF +  +   +LV T  WS  ++K I D
Sbjct: 360 NYIHDNSFALVELIKLKPTDIGRLIIYQDNFGKFFLLSDDVIMLVHTNSWSDKLAKAIDD 419

Query: 403 NDLRPLVGLEMKSTITHINSDMQINSCGIWNSGEAKSLLLVDTNVVVGYQLFKKEV---- 458
           ++L  L  +  +S IT  +   + N+C        +S++ V ++ V    L KK      
Sbjct: 420 SNLNILSEIGFESEITWFDVMGKFNNCTPCKYHGKESIIFVSSDNVFVENLTKKHSMNNI 479

Query: 459 --EFKPESAEEISTELENFTLDKFTVPENELKAANYKFQEAVSVPYSKVIPANIKQVPFG 516
                  S EE +      T   F  P +EL   N  FQ+   +P+SK+I    +Q+   
Sbjct: 480 KGSSTSNSNEETAESEYKVT---FKQPIDELMTLNELFQKQCRMPFSKLIKPEDRQIELS 536

Query: 517 SNAMEEQLKILNDISRDVGSKIVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKV 576
           + + E QL+IL D+S+++ +KI+ GQ+LG  L++RL EQQ +L+ QL  T  +  +   +
Sbjct: 537 NESNEIQLEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQIVFEKQDCI 596

Query: 577 QGDYPAQLSKLDEKLKKQEHLEKILLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQ 636
           +      L + +E+L +   L   L  +   L TI +S  L S P++  E++ FKE+R+Q
Sbjct: 597 KNKNKEILKRWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVELEWFKEIRNQ 656

Query: 637 ILLFNNFVHKQKDQKQNIQFLKKELQKIIDISRSESSKGMLNEWEELRQILADDAKIIKE 696
           +  FN+FVH Q+D  + + FLKKEL +I +   S   +    EWEELR IL  D+KIIKE
Sbjct: 657 VHKFNSFVHTQRDANEELSFLKKELDRISNDVTSVVDEKSKKEWEELRAILEQDSKIIKE 716

Query: 697 CNEQLTQISKEL 708
           CN +LT+ ++ +
Sbjct: 717 CNIELTKTTESM 728

>Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {ON}
           YJL061W (REAL)
          Length = 716

 Score =  393 bits (1009), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 261/724 (36%), Positives = 411/724 (56%), Gaps = 32/724 (4%)

Query: 7   PIFKRPSVSRELTKRFFFSANNGTRIILFQDSTIRWSFSSDNDHYQSMAL-RDSDMDVTG 65
           PIF+  S+S   +  + FS++NGTR++  QD+ IRW  S     YQS+   R   +D T 
Sbjct: 11  PIFQ-ASLSASQSPSYIFSSHNGTRVVFIQDNIIRWCNSLTESSYQSLDFSRHLILDDTF 69

Query: 66  AIISDP-GDYLCLYNSHQIRVIEIPWGLTNVDEISNSMASSLQERVYNF----NEDKLSV 120
            +IS   GD L  +N  +I V+E+PWG  N++E S  +  + Q   Y+     N  +  +
Sbjct: 70  RVISSASGDLLGFFNVQEIFVMEVPWGYNNIEEAS--VQDAFQLFHYSVGQVENGSRSLI 127

Query: 121 KQVLFHPLSKSSPFLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNRVEN 180
           K+VLFHP S     +VVL     I   D+ N       PI   LN   SN  G+D RV +
Sbjct: 128 KKVLFHPKSYHDSCIVVLKEDDTITMFDILN---QQHKPI--VLN-KRSNSFGLDARVND 181

Query: 181 IQYVVFADDCLSLYSLTDT---DVYCFYPCLPPVASLSKNRVDELINKSIVLYENLGIDA 237
           I  + F+ D L+LY L  T   DV+ FYP LPPV  L +  +  ++NKS+V+YE+L    
Sbjct: 182 ITDLAFSRDGLTLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYESLDSTT 241

Query: 238 DDIVRKNVIKQLQLASSLRKKIXXXXXXXXXXXXXXXIDLEFRQTKAQGYFSISPYPESL 297
           D  V++N+IKQLQL S L + +               ID E+R  K QG F+I+P+P+ L
Sbjct: 242 DITVKRNIIKQLQLVSKLHENLDSQLGKVE-------IDEEYRLVKMQGPFTINPFPDEL 294

Query: 298 YTCTGKQISVLPIGE-GNELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLVEII 356
           Y  T   I+ +PI    NE+  V FD+G++ ++F+D E +MSWDV++Y  NNS  L+E I
Sbjct: 295 YEYTAANITTIPIDNMQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNYVHNNSLVLIERI 354

Query: 357 KFKPEELSNMVVLQGELGKFVVSGEKSTILVDTTKWSSVISKCIRDNDLRPLVGLEMKST 416
           K +  ++ ++  L  ELGK  V  E S   +D+T WS+++S+CI ++DL  L  ++ +S 
Sbjct: 355 KIQETDIKSLKTLPEELGKLYVFSENSVHQLDSTNWSAILSRCIEESDLNALGDVKFESK 414

Query: 417 ITHINSDMQINSCGIWNSGEAKSLLLVDTNVVVGYQLFK-KEVEFKPESAEEISTELE-- 473
           + +I +    ++    +  +  +L+L     +    +   KE++     A   S  ++  
Sbjct: 415 LENIVTIEHPSNLAYISWNDTSNLVLTARGKLTFQNISNDKELQTTKFDANNKSDRIDAG 474

Query: 474 -NFTLDKFTVPENELKAANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQLKILNDISR 532
            ++ +  FT P NE+ + N  FQ+A   P  K+IP   +Q+P  + A E QL+I   IS+
Sbjct: 475 KHYEM-SFTQPINEILSLNESFQKACISPCEKIIPPAYRQMPLKNEASENQLEIFTGISK 533

Query: 533 DVGSKIVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQLSKLDEKLK 592
           +   KI++ QSLG  +Y+R+ EQQ +L+ QL  T+KI+ +   +Q    AQ  K D ++ 
Sbjct: 534 EFLQKIIKAQSLGFSIYNRIQEQQFELTRQLQATSKIISKDADLQEKLGAQNKKWDAQVS 593

Query: 593 KQEHLEKILLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHKQKDQKQ 652
           +Q  L +   K+  NL+ I ES+KL+   ++  E++ FKE+R+QIL FNNFV  QK  +Q
Sbjct: 594 RQVKLMERFKKLTENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFNNFVRSQKSLQQ 653

Query: 653 NIQFLKKELQKIIDISRSESSKGMLNEWEELRQILADDAKIIKECNEQLTQISKELDTKN 712
           ++ ++KKEL + I+    ++ +   NEW+ELR++L +D+KIIKECNE+L  +S++L T  
Sbjct: 654 DLSYMKKELTR-IEAETIKTDEKTQNEWDELRKMLEEDSKIIKECNEELMHVSQQLTTNT 712

Query: 713 TVTN 716
              N
Sbjct: 713 QSKN 716

>SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {ON}
           similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 690

 Score =  380 bits (975), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 255/727 (35%), Positives = 395/727 (54%), Gaps = 54/727 (7%)

Query: 1   MSFELNPIFKRPSVSRELTKRFFFSANNGTRIILFQDSTIRWSFSSDNDHYQSMALRDSD 60
           MS E +PIF+  SV +E   +   +  +G R+++ Q  TIR   SS N  YQ +    + 
Sbjct: 1   MSAEDHPIFQNISVGKESYPKKLLTTQDGCRVVVIQGDTIRLC-SSGNSQYQIIECGINT 59

Query: 61  MDVTGAIISDPGDYLCLYNSHQIRVIEIPWGLTNVDEISNSMASSLQERVYNFNEDKLSV 120
             V GA +++ G  LC YN  +++VI +P          +S    L+   YN    K  +
Sbjct: 60  --VAGAALNNSGTLLCAYNETELQVIVLP------SPFVSSHGGILKPHTYNITV-KSPI 110

Query: 121 KQVLFHPLSKSSPFLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNRVEN 180
           KQV +HP  K     VVL     IA  +L N     D      +  T  N +G+ + + +
Sbjct: 111 KQVQWHPRGKLDSVPVVLHKDDTIAMYELYN----EDFQQPTAVLNTMQNQLGVTSHITD 166

Query: 181 IQYVVFADDCLSLYSLTDT---DVYCFYPCLPPVASLSKNRVDELINKSIVLYENLGIDA 237
           I+ + F+ D L+LY L  +   DVY  YP LP V  + +  ++    KS + YENL  D 
Sbjct: 167 IESMCFSKDGLALYLLNSSEGGDVYALYPFLPSVLVIPEQHLEMCFYKSCINYENLSSDD 226

Query: 238 DDIVRKNVIKQLQLASSLRKKIXXXXXXXXXXXXXX-XIDLEFRQTKAQGYFSISPYPES 296
              V++NVIKQLQ  S L K+                 I   +R  K QG F+I+P+ E 
Sbjct: 227 SPTVKRNVIKQLQFVSRLHKQYKSETVDKARNGDLVFNIQESYRNAKIQGPFTINPFAEK 286

Query: 297 LYTCTGKQISVLPIGEGNELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLVEII 356
           LY+ T  QI+ +PI E NEL LV FDNGT+L  F+D + +M W+  D S NNS  ++E  
Sbjct: 287 LYSATATQITTMPIDEFNELILVYFDNGTILQCFQDLDLSMCWEEIDSSSNNSLVVLE-- 344

Query: 357 KFKPEELSNMVVLQGEL-----GKFVVSGEKSTILVDTTKWSSVISKCIRDNDLRPLVGL 411
                   ++ +L G++      KF V G KS  +VD+++W+  +S+CI  ++L  L  +
Sbjct: 345 --------SLDILSGQIICLTPHKFAVLGPKS-FVVDSSEWTKALSECINFSNLEVLSQI 395

Query: 412 EMKSTITHINSDMQINSCGIWNSGEAKSLLLVDTNVVVGYQLFKKEVEFKPE---SAEEI 468
            +KSTIT +N        G+W S   K L+ +    V    L        PE   + + +
Sbjct: 396 NIKSTITPVNG--AFTQAGLWESNGEKQLIFMSDKSVKSITL--------PEPNKTKDAV 445

Query: 469 STELENFTLDK----FTVPENELKAANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQL 524
           S  ++  T  K    F+ P  E+   N KFQ   S     VIP ++  +P  +++ E+QL
Sbjct: 446 SKTVQPVTEVKYEPVFSQPIGEILLLNKKFQSECSRATQTVIPPHLMDLPLQNDSNEDQL 505

Query: 525 KILNDISRDVGSKIVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQL 584
            +L DIS++V SKI+QGQ+LGL++++RL EQ+ +L+ QL  +++IL +AK +Q  YP Q 
Sbjct: 506 ALLTDISKEVFSKIIQGQTLGLLIHNRLFEQRYELTRQLERSSEILHKAKCLQERYPDQN 565

Query: 585 SKLDEKLKKQEHLEKILLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFV 644
           S+ +   KKQE+++    K++S LN I  S KLK L +S++E++ FKE++SQ+ LFN FV
Sbjct: 566 SRWEHVSKKQENIDSRFEKLQSRLNEISSSGKLKDLAISQREMEWFKEIKSQVSLFNKFV 625

Query: 645 HKQKDQKQNIQFLKKELQKIIDISRSESSKGMLNEWEELRQILADDAKIIKECNEQLTQI 704
            +Q+D K+ ++F++ EL+          SK  + +W EL+++L+ D++IIKECNE L + 
Sbjct: 626 MQQQDVKEQLEFVQSELKT---AGERRVSKEDVFDWAELQELLSVDSEIIKECNEGLVEA 682

Query: 705 SKELDTK 711
           +KELD K
Sbjct: 683 AKELDEK 689

>KNAG0C05840 Chr3 (1135516..1137759) [2244 bp, 747 aa] {ON}
           Anc_1.319 YJL061W
          Length = 747

 Score =  363 bits (931), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 238/745 (31%), Positives = 402/745 (53%), Gaps = 64/745 (8%)

Query: 5   LNPIFKRPSVSRELTKRFFFSANNGTRIILFQDST--IRWSFSSDNDHYQSMALRDSDM- 61
           L P    PS   +L+ R+ F+ + GT+ +    +   +RW  S   D Y SM L+ S+  
Sbjct: 26  LQPTAGLPS---DLSSRYVFTTDKGTKYVYLDKTNGLLRWG-SVSEDEYNSMPLKISNFA 81

Query: 62  -DVTGAIISDPGDYLCLYNSHQIRVIEIPWGLTNVDEISNSMASSLQERVYNFNEDKLSV 120
                 I+SD G++LC+Y+   + VIE+PW   N +E+S    +S +E      +D   +
Sbjct: 82  DKSVNVILSDSGEFLCVYSKDCVTVIEVPWRYRNPEEMSYVFQTSFKE----IRKDSF-I 136

Query: 121 KQVLFHPLSKSSPFLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNRVEN 180
           K+VLFHP +     +V+LF    I   D+++  K +       LN+   N+ GI++R+ +
Sbjct: 137 KKVLFHPRAIKKTCMVILFEDDTIYLFDVEDNNKIA-------LNVPSGNI-GIEDRITS 188

Query: 181 IQYVVFADDCLSLYSLTD---TDVYCFYPCLPPVASLSKNRVDELINKSIVLYENLGIDA 237
           I  + F+ D L+LY L+     DVY  YPCLPP+ ++S+  +  L+N+S++LY++L    
Sbjct: 189 IADIEFSQDGLTLYVLSAEDCGDVYAIYPCLPPILAMSQKELKSLMNRSVLLYDSLTETT 248

Query: 238 DDIVRKNVIKQLQLASSLRKKIXXXXXXXXXXXXXXXIDLEFRQTKAQGYFSISPYPESL 297
              V+K VIKQ++  S L+                  ID  +R  K QG F+I+P+PE L
Sbjct: 249 PSAVKKGVIKQVEFISQLQN----ISHGKEEISNVLEIDTIYRLAKPQGPFTIAPFPEKL 304

Query: 298 YTCTGKQISVLPIGEGNELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLVEIIK 357
           Y+ T  +I  L IG GNE+  +++DNGT L +FKD E +M+WDV    +NNS  L+E   
Sbjct: 305 YSATATEICPLNIGGGNEILCIAYDNGTALFLFKDLELSMAWDVGGIYYNNSLVLMEEFD 364

Query: 358 FKPEELSNMV----------------VLQGELGK-FVVSG----EKSTIL--VDTTKWSS 394
            + E   +++                V   ++ K F+  G    ++S+++  VDT  WSS
Sbjct: 365 LQTESAVSILKSFKMDGLILFKVSDSVQHIDVSKSFIQDGDLLVQQSSMIRCVDTKAWSS 424

Query: 395 VISKCIRDNDLRPLVGLEMKS---TITHINSDMQINSCGIWNSGEAKSLLLVDTNVVVGY 451
           V+S CI  +D+  L+ +  KS   T     SD  I SCG WN G  + +  + TN  V  
Sbjct: 425 VVSDCIDRHDINALITVSFKSKGHTWAIAGSD--ITSCGAWNHGGTEGVTWI-TNKSVTC 481

Query: 452 QLFKKEVEFKPESAEEISTELENFTLDKFTVPENELKAANYKFQEAVSVPYSKVIPANIK 511
           +  KK+V +KPE +     + + F   +F+VP +EL A N  +Q+   + +  +I    +
Sbjct: 482 KELKKQVSWKPEQSTSSEKKKQAFPKPEFSVPISELNALNINYQDTCRIGFHDIISPLDR 541

Query: 512 QVPFGSNAMEEQLKILNDISRDVGSKIVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILI 571
           Q P  + + E+QL+++  +S  + + + +GQ LG+ LY+RLLEQQ +L++QL  +NKIL+
Sbjct: 542 QKPLLNPSNEKQLQVMTSLSNYLLATVGKGQGLGMTLYNRLLEQQLELTKQLQCSNKILM 601

Query: 572 RAKKVQGDYPAQLSKLDEKLKKQEHLEKILLKMESNLNTIQESQKLKSLPLSEKEIQLFK 631
           +   +      Q S  +EKL KQ  L++    ++  L  I +++K   L ++++E   FK
Sbjct: 602 KQPAIAKKLEEQKSVWNEKLAKQNKLKERFSSLQQKLAAIDKTKKSTDLVITDEESVWFK 661

Query: 632 ELRSQILLFNNFVHKQKDQKQNIQFLKKELQKIIDISRSESSKGMLN-EWEELRQILADD 690
           E++ + L FN+ V+KQ+  + +++FLK+EL     +S S+   G  N EW  L+++L  D
Sbjct: 662 EVKKEALTFNDLVYKQESVQDDLRFLKRELSTF--VSDSQRLPGTANTEWHSLQEMLKHD 719

Query: 691 AKII----KECNEQLTQISKELDTK 711
           + ++    K+  +  +Q+S+   +K
Sbjct: 720 SLLLRADKKDKKDASSQVSRRASSK 744

>Kwal_14.2580 s14 complement(821497..823560) [2064 bp, 687 aa] {ON}
           YJL061W (NUP82) - 82-kDa protein, with putative
           coiled-coil domain, has carboxy-terminal domain,
           containing heptad repeats, that binds Nsp1p; nucleoporin
           [contig 224] FULL
          Length = 687

 Score =  273 bits (697), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 204/721 (28%), Positives = 352/721 (48%), Gaps = 51/721 (7%)

Query: 4   ELNPIFKRPSVSRELTKRFFFSANNGTRIILFQDSTIRWSFSSDNDHYQSMALRDSDMDV 63
           E +PIF   + S   ++RF F+    ++  + Q +T+RW  S+    YQ +   +  +D 
Sbjct: 4   ESHPIFDTKTNSSGKSRRFVFNIGIASKYGVLQGNTLRWC-SAGGHEYQYLEF-EPRIDY 61

Query: 64  TGAIISDPGDYLCLYNSHQIRVIEIPWGLTNVDEISNSMASSLQERVYNFNEDKLSVKQV 123
           T  +I++ G  LCLYNS Q++++ + W  +  D I  S  +               +KQ 
Sbjct: 62  TSVVINESGSLLCLYNSKQVQILAVSWDESKSDTILISPPAG--------------IKQA 107

Query: 124 LFHPLSKSSPFLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNRVENIQY 183
           L+HP  +    L VL +  +I   +L     +    I   LN T +  +G+ + V++I  
Sbjct: 108 LWHPRGRLGSCLAVLTTQDEICLYELLTEDYTEPTTI---LN-TCTKELGMGSVVKDITS 163

Query: 184 VVFADDCLSLYSLTDT---DVYCFYPCLPPVASLSKNRVDELINKSIVLYENLGIDADDI 240
           + F+ D L+LY L+ +   D+Y  YPCLP    +S   +  + NK+++ Y++L  +    
Sbjct: 164 MSFSSDGLTLYLLSTSEGADIYSIYPCLPSEMEISGALLKSVFNKALLQYQDLNDNDSPD 223

Query: 241 VRKNVIKQLQLASSLRKKIXXXXXXXXXXXXXXXIDLEFRQTKAQGYFSISPYPESLYTC 300
           +R+ V KQLQ  S L+KK                I    R  +AQG F+I+P+P++LY  
Sbjct: 224 LRRKVTKQLQFVSKLQKK----NDYKDTESHVVTISKAHRSPRAQGPFTINPFPDNLYLA 279

Query: 301 TGKQISVLPI-GEGNELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLVEIIKFK 359
           TG+Q+ V+ + G   EL L+SFD+GT+L  F D+E  MSW+   +  NNS  ++  +   
Sbjct: 280 TGRQVEVIKLQGCAAELLLISFDDGTILECFPDREPVMSWEDEGFCENNSLIVLGSVNIG 339

Query: 360 PEELSNMVVLQGELGKFVVSGEKSTILVDTTKWSSVISKCIRDNDLRPLVGLEMKSTITH 419
            E    + ++ G    FVV        V   K + VI   + D D+      ++   +  
Sbjct: 340 GE----IALVNGY--TFVVLSSAKVTFVSLRKLAQVIESSLNDCDISYFDEADLSEEVVE 393

Query: 420 INSDMQINSCGIWNSGEAKSLLLVD----TNVVVGYQLFKKEVEFKPESAEEISTELENF 475
            N   +  S  I  S E   + L+     +++ + + L   ++     +A+   T++E +
Sbjct: 394 KNG--RFCSAIICASSEKSCVALLSETTTSHIDIPFSLDAPKMRTALGTAK---TDVEQY 448

Query: 476 TLDKFTVPENELKAANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQLKILNDISRDVG 535
               +  P NE+ A N K Q  +  P    +  +++Q    + + E+QL +L  IS++V 
Sbjct: 449 R--PYGQPLNEVLALNEKVQALLKKPLQTGVSPSLRQAKLNNESNEDQLSLLTSISKEVM 506

Query: 536 SKIVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQLSKLDEKLKKQE 595
           ++I   Q+L L LY RL  QQ +L++ L   +K+     KV      Q S+ +    K +
Sbjct: 507 TRIASAQTLALSLYLRLSCQQGELTQHLETVSKVEELQSKVLRRLKDQSSRWEAAQAKNK 566

Query: 596 HLEKILLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHKQKDQKQNIQ 655
            +   L ++ S L  +  S K +S P+S  E++ FKE+R Q++ FN  VH+Q+     + 
Sbjct: 567 SISSRLEQISSKLKQVSSSGKFQSQPISNHELEWFKEIRDQVIRFNRLVHEQQSLGNTLS 626

Query: 656 FLKKELQKIIDISRSESSKGMLNE------WEELRQILADDAKIIKECNEQLTQISKELD 709
            LK EL+ +   S+   S     +      W+ELR +LA D +II EC + L  ++K+LD
Sbjct: 627 NLKCELEYVHVESKEGKSGSSSADNKDEVPWDELRALLAKDLRIIGECQDSLQGVAKQLD 686

Query: 710 T 710
           +
Sbjct: 687 S 687

>KLTH0H10692g Chr8 complement(921787..923862) [2076 bp, 691 aa] {ON}
           similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 691

 Score =  264 bits (675), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 214/726 (29%), Positives = 367/726 (50%), Gaps = 57/726 (7%)

Query: 4   ELNPIFKRPSVSRELTKRFFFSANNGTRIILFQDSTIRWSFSSDNDHYQSMALRDSDMDV 63
           E +PIF+  S+    ++R      + +R IL + ++++W    D  +Y+ M L ++  + 
Sbjct: 4   EAHPIFQARSLGESRSERLCLHTKDLSRTILLEGNSLKWCLM-DAPNYEYMEL-NAISNY 61

Query: 64  TGAIISDPGDYLCLYNSHQIRVIEIPWGLTNVDEISNSMASSLQERVYNFNEDKLSVKQV 123
           T A+++D G  LCL N  +I+V+ + W  T  +     + +               VKQV
Sbjct: 62  TSAVLNDSGTLLCLNNVDEIQVLALSWDQTRPESYRIKVPAG--------------VKQV 107

Query: 124 LFHPLSKSSPFLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNRVENIQY 183
           L+HP  +    L VL    +I   +L     S D      +    +N +G+ + V++I+ 
Sbjct: 108 LWHPRGRLDSCLTVLNKRDEILLYELL----SEDFSAPTTVLNASTNELGMGSSVKDIES 163

Query: 184 VVFADDCLSLYSLT---DTDVYCFYPCLPPVASLSKNRVDELINKSIVLYENLGIDADDI 240
           V F+ D L+LY ++     DV+  YPC+P   S+++  +    NK+++ Y+ L       
Sbjct: 164 VCFSADGLTLYLMSVSEGADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEGDSPE 223

Query: 241 VRKNVIKQLQLASSLRKKIXXXXXXXXXXXXXXXIDLEFRQTKAQGYFSISPYPESLYTC 300
           ++    +QL   SSL  +                I   +R  +AQG F+ISP+PE LY  
Sbjct: 224 LKLKATRQLHFMSSLYNQPHDADDSQTNLLQTFHIRKAYRNARAQGPFTISPFPEKLYLA 283

Query: 301 TGKQISVLPI-GEGNELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLVEIIKFK 359
           T KQI  + +  E  EL L++FD+ T+L  F D    MSW+ +  S  NS   V  +K  
Sbjct: 284 TAKQIKAIALEDETTELLLITFDDDTILECFPDLTPVMSWEDSGSSEKNSLISVGSLKL- 342

Query: 360 PEELSNMVVLQGELGKFV-VSGEKSTILVDTTKWSSVISKCIRDNDLRPLVGLEMKSTIT 418
           P  +S   ++ G    FV +S EK+ + V+ ++ +  I + + D D   L   ++   IT
Sbjct: 343 PGSIS---LIYGSC--FVLISAEKAAV-VNLSRLTRSIERSLDDCDATELSEEDLTEEIT 396

Query: 419 HINSDMQINSCGIW-NSGEAKSLLLVDTNVV-VGYQLFKKEVEFKPESAEEISTELENFT 476
                 Q  S G+W  SG  K +LL +  +  +     +       E  E+  T  +   
Sbjct: 397 EKKGTFQ--SAGLWPESGMQKIVLLSEKEITSIDISSMQTPASSTTEKIEKSETNRQR-- 452

Query: 477 LDKFTVPENELKAANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQLKILNDISRDVGS 536
              ++ P +E++  N K Q  +  P S VIPA ++Q    +   E+QL +L DIS++V S
Sbjct: 453 --PYSQPLSEVQTLNQKVQSLLKSPLSTVIPAALRQKTLNNTDNEDQLSLLTDISKEVLS 510

Query: 537 KIVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQLSKLDEKLKKQEH 596
           ++   Q+LGL L+ RLL QQD+L++ L   +++  + ++V     +Q  + +     QE 
Sbjct: 511 RVTLAQTLGLSLHLRLLGQQDELAQHLRDVSELRTKKERVSAHLASQKPRWE---AIQEK 567

Query: 597 LEKILLKMES---NLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHKQKDQKQN 653
            + I L+ ES   N+  I +S +L+S P+++ E++ FKELR+Q++ FN  VH+Q+D  + 
Sbjct: 568 NKSIALRFESLHRNMTQISKSSQLQSQPIAKAEMEWFKELRNQVVRFNRLVHEQQDLAEA 627

Query: 654 IQFLKKELQKI-ID----ISRS----ESSKGMLNEWEELRQILADDAKIIKECNEQLTQI 704
           +  LK  L+ + +D     SRS    ES+ G+   W+EL+ +LA D++IIKEC  +L   
Sbjct: 628 LSSLKLSLEYVRVDSAEAASRSKKSAESAGGV--PWDELQAMLAKDSRIIKECQAELQCT 685

Query: 705 SKELDT 710
           ++ELD+
Sbjct: 686 TQELDS 691

>CAGL0J05214g Chr10 complement(501919..504069) [2151 bp, 716 aa]
           {ON} similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061w NUP82 nuclear pore protein
          Length = 716

 Score =  245 bits (626), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 198/714 (27%), Positives = 354/714 (49%), Gaps = 68/714 (9%)

Query: 19  TKRFFFSANNGTRIILFQD-STIRWSFSSDNDHYQSMALRDSDMD----VTGAIISDPGD 73
            +RF FS+++GT+I+   D   +RW  S+    Y+S+   D D+     V GA+ S   D
Sbjct: 18  AQRFLFSSSDGTKIVSIADRGHLRWCHSTSTT-YKSL---DFDLQFEGKVEGAVSSTTAD 73

Query: 74  YLCLYNSHQIRVIEIPWGLTNVDEISNSMASSLQERVYNFNEDKLSVKQVLFHPLSKSSP 133
           Y+C+YN  ++ V+E+PW  +  +   N +        + F+E+  S+KQVLFHP S    
Sbjct: 74  YVCIYNRDELHVLEVPWMYSGEE---NGLKHLCHIYSHKFDENH-SIKQVLFHPKSYLDS 129

Query: 134 FLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSN-VMGIDNRVENIQYVVFADDCLS 192
            ++VL +   I  ++  +     ++     +NL   N  +G+ +R+ +IQ ++F+ D LS
Sbjct: 130 TILVLTNDDSIFMINTDDNRSDKNM-----INLNSKNSALGLYDRINDIQKIIFSQDGLS 184

Query: 193 LYSLT---DTDVYCFYPCLPPVASLSKNRVDELINKSIVLYENLGIDADDIVRKNVIKQL 249
           L  L+     D++  YPCLP    +S + VD L  KS++LY N+ ++     ++N++KQL
Sbjct: 185 LLILSAEEGCDIFTIYPCLPRRWDISLHEVDTLFAKSLLLYNNMNVNTTPQEKRNIVKQL 244

Query: 250 QLASSLRKKIXXXXXXXXXXXXXXXIDLEFRQTKAQGYFSISPYPESLYTCTGKQISVLP 309
                +R +                ++  +   + QG FS++PYP  LY      I+++ 
Sbjct: 245 NFMEKIRGQ----KTAFRNDKKPLILEDAYLNAQPQGPFSMTPYPNELYDFMATDINIIQ 300

Query: 310 IGEGNELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLVEIIKFKPEELSNMVVL 369
           I +   L  ++F NGTVL+   D E  MSWD++ +  +NS  L+E IK +  + +  + +
Sbjct: 301 ITQNISLLAIAFSNGTVLLFLSDLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKFLSI 360

Query: 370 QGELGKFVVSGE-KSTILVDTTKWSSVISKCIRDNDLRPLVGLEMKSTITHINSDMQINS 428
            G  GKFVV+   KS   V+T  WS+++++ I D+D++ L  L++KS I ++        
Sbjct: 361 PGTYGKFVVTDNVKSNFFVNTCDWSTILAQIIDDSDIKLLANLKVKSNIENLQQLATTFK 420

Query: 429 CGIWNSGEAKSLLLVDTNVVVGYQLFKKEVEFKPESAEEISTELENFTLD--------KF 480
             I+   E         N+   Y +  K++E + +  + IS+  ++  +D        K 
Sbjct: 421 SIIYWKNE---------NISCNYIISDKKIE-ELDMLDGISSTTKHKLIDQSNSQVESKL 470

Query: 481 TVPE-----NELKAAN--YKFQEAVSVPYSKV-------IPANIKQVPFGSNAMEEQLKI 526
            +PE      E+K A    + Q    + Y  +       IP  I+  P  +++ E QL+ 
Sbjct: 471 DLPELKNGLYEVKFARPLTEIQHYEQIYYKNLQNQNFTKIPLEIRSAPLKNSSNENQLES 530

Query: 527 LNDISRDVGSKIVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQLSK 586
           L  IS      I   Q+LG +   R+++  ++ S Q+  T +I       +     Q +K
Sbjct: 531 LTKISESYMKMISMAQTLGYIYRKRMIDSIEEFSRQIETTYQINKFWDNFEQIREVQNTK 590

Query: 587 LDEKLKKQEHLEKILLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHK 646
           +D+  +KQ+ L + L  +   +   +E   + +  +S  E + F E++  ++ FN++V K
Sbjct: 591 IDKVKEKQQKLMERLSSLYDKVEGQKEMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRK 650

Query: 647 QKDQKQNIQFLKKELQKII----DISRSESSKGMLNEWEELRQILADDAKIIKE 696
                Q ++F+K++  +I     DIS SE+ K    EW +L+Q+L  D KII E
Sbjct: 651 ASTNHQELEFIKEQQAQIANQKPDIS-SENGK----EWNDLQQLLRTDLKIISE 699

>Ecym_6290 Chr6 (543547..545562) [2016 bp, 671 aa] {ON} similar to
           Ashbya gossypii AEL168C
          Length = 671

 Score =  223 bits (568), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 200/722 (27%), Positives = 338/722 (46%), Gaps = 65/722 (9%)

Query: 1   MSFELNPIFKRPSVSRELTKRFFFSANNGTRIILFQDSTIRWSFSSDNDHYQSMALRDSD 60
           M+ + +PIF+ P   R L+K       N T+I+   D  +R++  +++        +   
Sbjct: 1   MTGDPHPIFQVPPF-RTLSKLHVHVCKNATQIVTCFDKNLRYARVTEH------TFKSKH 53

Query: 61  MDVTGA---IISDPGDYLCLYNSHQIRVIEIPWGLTNVDEISNSMASSLQERVYNFNEDK 117
           +D+  +   I+++ G  +  Y S+ + + ++           +   S L  RV      +
Sbjct: 54  LDIKHSEHSILNNSGTLIAFYGSNDVELFDM-----------DGKKSCL--RV------E 94

Query: 118 LSVKQVLFHPLSKSSPFLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNR 177
           L +KQVL+HPL+     LVVL   + I   +L    K++ +     LN      +GI + 
Sbjct: 95  LGIKQVLWHPLAYLDSCLVVLTKENTIELYELA---KANFMYPTVVLN-EKLPQLGISSH 150

Query: 178 VENIQYVVFADDCLSLYSLT---DTDVYCFYPCLPPVASLSKNRVDELINKSIVLYENLG 234
           V  I  + F+ D L+LY L+     DVY  +P LP    + ++  +    K+  LYE++ 
Sbjct: 151 VSEICSMAFSPDGLTLYLLSLEEGGDVYALHPLLPSRLRIKRSFWESQWYKATALYESID 210

Query: 235 IDADDIVRKNVIKQLQLASSLRKKIXXXXXXXXXXXXXXXIDLEFRQTKAQGYFSISPYP 294
            D  +  +  +I+     S + K I               I    R    +G FSI  +P
Sbjct: 211 KDTPNEKKIAMIEHFDFVSKIYKMIDKDSEFFDVN-----IPEHKRMVTPRGPFSIYGFP 265

Query: 295 ESLYTCTGKQISVLPIG-EGNELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLV 353
           E LY  T  ++  LP+  EG  + ++SFD+GT+L +F D E  MSW     S NN+ + V
Sbjct: 266 EELYNTTATKLITLPVNDEGAYVLILSFDDGTILSLFPDIELLMSWS---RSLNNACSFV 322

Query: 354 EIIKFKPEELSNMVVLQGELGKFVVSGEKSTILVDTTKWSSVISKCIRDNDLRPLVGLEM 413
            I KF+    +   +   E G  ++  EK+   +    +   + +CI++ D+ P+V +++
Sbjct: 323 LIEKFR----AGGEIFAIESGVAIL--EKNNAHIVRFPYLKALGECIKEGDIAPMVDVKL 376

Query: 414 KSTITHINSDMQINSCGIWNSGEAKSLLLVDTNVVVGYQLFKKEVEFKPESAEEISTELE 473
            S IT +       +   WN    K +L +  +V+           FKP     IS    
Sbjct: 377 TSDITPLAGSYH--TVVTWNEPSTKGILFIGNSVIRSIPDDVGLSSFKPRVDPAISQN-- 432

Query: 474 NFTLDKFTV--PEN--ELKAANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQLKILND 529
                K+TV  P    EL   N   Q  +  P   ++P   K VP  S   E QL  L  
Sbjct: 433 ----GKYTVCFPSTMEELLKTNKALQHTLRQPLP-LVPLEQKNVPLNSEFNEHQLATLTK 487

Query: 530 ISRDVGSKIVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQLSKLDE 589
           IS +V  +I+  QSLG ++Y+R   QQ +L  QL   +K+  R+  ++ +  +   +LD 
Sbjct: 488 ISTEVMDRIILAQSLGYLMYNRAATQQFELCRQLETVSKLNDRSVTLKQNTKSLTCRLDS 547

Query: 590 KLKKQEHLEKILLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHKQKD 649
             KK   L   L K++ +L+ + ES K   LPLS KE   F+EL++ +L FN +V +   
Sbjct: 548 VSKKDIALRSRLEKLQQSLDKVNESPKFNELPLSMKERAWFRELKNDVLAFNEYVLQNSK 607

Query: 650 QKQNIQFLKKELQKIIDISRSESSKGMLNEWEELRQILADDAKIIKECNEQLTQISKELD 709
             + + FLKKEL+ +I+ +        L  +E+L+ +L  D+K+I +CN+QL   +K+L+
Sbjct: 608 LCEELNFLKKELE-LIESNHGNIPNEELFNFEKLQDLLTLDSKMIGDCNDQLLAAAKDLE 666

Query: 710 TK 711
            K
Sbjct: 667 NK 668

>AEL168C Chr5 complement(320121..322142) [2022 bp, 673 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL061W
           (NUP82)
          Length = 673

 Score =  213 bits (541), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 193/720 (26%), Positives = 328/720 (45%), Gaps = 59/720 (8%)

Query: 1   MSFELNPIFKRPSVSRELTKRFFFSANNGTRIILFQDSTIRWSFSSDNDHYQSMALRDSD 60
           M+ EL+PIF   ++     +    +  +GT+I+ + +  +R    ++  +    A  D+ 
Sbjct: 1   MTGELHPIFNADALGAS-HRLHAHTHGDGTKIVGYYNKHLRLGRFTEQTYKSWHAEVDAK 59

Query: 61  MDVTGAIISDPGDYLCLYNSHQIRVIEIPWGLTNVDEISNSMASSLQERVYNFNEDKLSV 120
                +I++  G  L  Y  H I V         VD     +  ++             +
Sbjct: 60  ---ASSILNGSGSLLAFYGDHIIEV---------VDREGKKITLTVNG----------GI 97

Query: 121 KQVLFHPLSKSSPFLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNRVEN 180
           KQVL+HPL+     LVVL     I   +L          +   LN   S  +GI +RV +
Sbjct: 98  KQVLWHPLAYLDSCLVVLTGQETIEIYELNEPRYEKPTLV---LNEPTSQ-LGISSRVID 153

Query: 181 IQYVVFADDCLSLYSLTDT---DVYCFYPCLPPVASLSKNRVDELINKSIVLYENLGIDA 237
           I  + FA D LSLY  + +   DV+   P LP      + +     NK+  LY  L  D 
Sbjct: 154 ITNIAFAPDGLSLYLFSTSEGGDVHVICPLLPSRIKADRAKWARQWNKATALYSTLTKDT 213

Query: 238 DDIVRKNVIKQLQLASSLRKKIXXXXXXXXXXXXXXXIDLEFRQTKAQGYFSISPYPESL 297
            D  +   I+ L+  + L + I               I    R+T +QG ++I  +PE L
Sbjct: 214 PDDAKVATIEYLEFVTQLLQAIEKNGSDGELV-----IPEHRRRTISQGPYNIHGFPEKL 268

Query: 298 YTCTGKQISVLPIGEGN-ELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLVEII 356
           Y+  G +++V+P+GE    L L+SFD+ T +++F   E  MSW  +     N++TL+ + 
Sbjct: 269 YSAVGTKLTVVPLGESEAHLLLLSFDDSTNILLFPSTEVLMSWTKD---LKNAYTLMLV- 324

Query: 357 KFKPEELSNMVVLQGELGKFVVSGEKSTILVDTTKWSSVISKCIRDNDLRPLVGLEMKST 416
               EE +             V G  S   V+   +   +  CIRD +L  L  +   S+
Sbjct: 325 ----EEFTATGTAFATCDGVAVLGIDSAQRVEI-PYLQALEDCIRDCNLAALQDINFTSS 379

Query: 417 ITHINSDMQINSCGIWNSGEAKSLLLV---DTNVVVGYQLFKK--EVEFKPESAEEISTE 471
           I  I    + +S   +N+   K ++LV      +V   +  K   E E   +  +E +  
Sbjct: 380 ICKIPG--KFHSVARFNAPGNKGIILVGDHHAKIVPSTEAAKSDTETELDSQPGKEPT-- 435

Query: 472 LENFTLDKFTVPENELKAANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQLKILNDIS 531
              +T+  F     E+   N + Q     P   V PA +K +P  S+  E+ L  L +IS
Sbjct: 436 ---YTV-CFPNSLEEILNTNKELQRRKHQPLPLVPPA-LKNIPLNSDLNEQHLATLTNIS 490

Query: 532 RDVGSKIVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQLSKLDEKL 591
           ++V  +I+  QS GL++++RL  QQ +L  Q+     I  R   ++    A  S+L   L
Sbjct: 491 KEVMDRIILSQSAGLLMHNRLSLQQYELHRQVETVADICSRHSVLRDSSEAMSSRLTSVL 550

Query: 592 KKQEHLEKILLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHKQKDQK 651
           K+   L++ L  ++S LN I  S K   LPLS+KE   F+EL++Q + FN++V +    +
Sbjct: 551 KRDRRLKQRLCMLQSTLNRINSSHKFSDLPLSKKEADWFRELKNQAISFNDYVLQSAQLR 610

Query: 652 QNIQFLKKELQKIIDISRSESSKGMLNEWEELRQILADDAKIIKECNEQLTQISKELDTK 711
             + FLK EL+ + +  + +  +    ++  L+++L  D+KII EC + L+  ++EL+ K
Sbjct: 611 DELAFLKNELESLPEHRQHDRQEEEPFDFRRLQELLKLDSKIITECTDNLSAAARELERK 670

>KLLA0F01661g Chr6 complement(156609..158672) [2064 bp, 687 aa] {ON}
           weakly similar to uniprot|P40368 Saccharomyces
           cerevisiae YJL061W NUP82 Subunit of the nuclear pore
           complex (NPC) forms a subcomplex with Nup159p and Nsp1p
           interacts with Nup116p and is required for proper
           localization of Nup116p in the NPC
          Length = 687

 Score =  155 bits (393), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 163/716 (22%), Positives = 324/716 (45%), Gaps = 101/716 (14%)

Query: 26  ANNGTRIILFQDSTIRWSFSSDNDHYQSMALRDSDMDVTG--AIISDPGDYLCLYNSHQI 83
            NN   I L+QD+ +R      +DH       + ++       +IS  G  +  + + ++
Sbjct: 26  CNNSNTIYLWQDNILR----VQSDHETQYRSYNVELPFVPEQMVISPSGGLVAFHANSEL 81

Query: 84  RVIEIPWGLTNVDEISNSMASSLQERVYNFNEDKLSVKQVLFHPLSKSSPFLVVLFSGSQ 143
            V+E+                + Q R+       L +K++L+HPL+      V+L   S 
Sbjct: 82  YVMEV----------------NEQSRLRKHFNTSLGIKKLLWHPLATYGLSFVILHDDST 125

Query: 144 IAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNRVENIQYVVFADDCLSLYSLTD---TD 200
           I   DL+++   S   I  F   + S   G+ + VE++  + F    L+LY L+     D
Sbjct: 126 IRIYDLEDLEPES---ITVFNRKSRS--FGLSDHVESVCDIAFDPTGLTLYLLSSFNYCD 180

Query: 201 VYCFYPCLPP-----------VASLSKNR--VDELINKSIVLYENL--------GIDADD 239
           +Y  +PCLP            V S +KN    D +++KS+ LY +L        G D D 
Sbjct: 181 IYAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYNSLDKQLKLISGSDPDV 240

Query: 240 -----IVRKNVIKQLQLASSLRKKIXXXXXXXXXXXXXXXIDLEFRQTKAQGYFSISPYP 294
                 ++ +++KQ+Q   + +K                      R +  QG F I  +P
Sbjct: 241 ESDYLTLKHDLLKQIQFFDNYKKNDGIDTFTSKA----------IRNSVPQGPFIIKKFP 290

Query: 295 ESLYTCTGKQISVLPIGEGNELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLVE 354
            +L       ++++P+GE   L  + F +GT +V+F D E  MSW +   +  N+ +++ 
Sbjct: 291 TALNAKEVTGLTIIPVGERLGLLNLQFIDGTNVVLFSDSEIVMSWSLRSNTTFNNLSVIT 350

Query: 355 IIKFKPEELSNMVVLQGELGKFVVSGEKSTILVDTTKWSSVISKCIRDNDLRPLVGLEMK 414
           +   K +      +L     K V +G+ ST +++   W   +++CIR +D   +  ++ +
Sbjct: 351 MFNAKGQ----CQLLNSSEPKLVFTGDSSTTIME-MPWLEPLAQCIRLHDFSIIDDVKFE 405

Query: 415 STITHINSDM-----QINSCGIWNSGEAKSLLLVDTNVVVGYQLFKKEVEFKPESAEEIS 469
           + I  ++         ++   ++N    K +   D +          EV++  + +   S
Sbjct: 406 NKIRTVSGTFLGVLSTLSGDILYNGNSFKVIESNDKSTTQKPINRTDEVKYTYKPSLPTS 465

Query: 470 TELENFTLDKFTVPENELKAANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQLKILND 529
            +  +  L K+    N   +                IP ++  +P  +N+ E QL+++++
Sbjct: 466 GKELDMLLTKYKTEANGFISG---------------IPDSLAPLPLKNNSNERQLEVVSE 510

Query: 530 ISRDVGSKIVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQ---GDYPAQLSK 586
           + ++   ++  GQ +   ++++  E+  +L  QL  TN+I +   K+    GD   + S+
Sbjct: 511 LYKETMKRVKLGQMILFRMFNKSNEEVAELHRQLRKTNEIEMLRNKLNGNLGDLQERYSR 570

Query: 587 LDEKLKKQEHLEKILLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHK 646
            +EK K    LEK L K++   ++I+ ++KL++  +SE E+  FK +++Q+L FNN+VH 
Sbjct: 571 YEEKSKT---LEKRLDKLKETFSSIENNEKLRTSSISEAELVWFKSIKNQVLKFNNYVHL 627

Query: 647 QKDQKQNIQFLKKELQKIIDISRSESSKGMLNEWEELRQILADDAKIIKECNEQLT 702
               ++ ++FL  +L+     ++ +     L E+  L+Q+L +D K+I  C  +L+
Sbjct: 628 TNKLREELEFLDTQLRS---TTKGDDFFSEL-EFSSLQQMLLNDKKVINSCMNELS 679

>Suva_15.357 Chr15 complement(617637..618952,619001..621203) [3519
           bp, 1172 aa] {ON} YHR158C (REAL)
          Length = 1172

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 46/83 (55%), Gaps = 6/83 (7%)

Query: 629 LFKELRSQILLFNNFVHKQK-DQKQNIQFLKKELQKIIDISRSESSKGMLNEWEELRQI- 686
           LF++LRS++   NN  H++  +   +I+ L+ EL ++    +S+SS GM  E +EL  + 
Sbjct: 781 LFEKLRSELQTLNNITHEKALEAGTHIKELETELWRL----KSQSSTGMTKEMDELDSVR 836

Query: 687 LADDAKIIKECNEQLTQISKELD 709
           L    ++++  N  L     EL+
Sbjct: 837 LQSKCELLEADNHSLEDKVNELE 859

>ZYRO0F07766g Chr6 (627169..631617) [4449 bp, 1482 aa] {ON} similar
           to uniprot|P14284 Saccharomyces cerevisiae YPL167C REV3
           Subunit of DNA polymerase zeta which is involved in DNA
           repair required for mutagenesis induced by DNA damage
          Length = 1482

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 45/216 (20%), Positives = 91/216 (42%), Gaps = 30/216 (13%)

Query: 392 WSSVISKCIRDNDLRPLVGLEMKSTITHINSDMQINSCGIWNSGEAKSLLLVDTNVVVGY 451
           W  +I +C      R   G+E+    + +NS+++  +   W    A  +++   +++  +
Sbjct: 756 WGYIIERC------RKHYGIEISEDFSRVNSNLKNKARDRWGFTHASGIMIAGRHMINVW 809

Query: 452 QLFKKEVEFKPESAEEISTELENFTLDKFTVPENELKAANYKFQEAVSVPYSKVIPANIK 511
           +  + E+     S E ++ EL +  + +F+            FQ    +  ++  P+N+K
Sbjct: 810 RSMRSELNLTQYSLENLAFELLDERIPRFS------------FQALTQLWRNRQHPSNVK 857

Query: 512 QV-PFGSNAMEEQLKILNDISRDVGSKIV-QGQSLGLMLYDRLLEQQDKLSEQLIITNKI 569
            V  +    +   +++L    +D  ++IV Q +  G+  Y           E       I
Sbjct: 858 TVINYWMTRVRMNIRLLQ--KQDYIARIVEQARLTGIDFYSVYYRGSQYKVES------I 909

Query: 570 LIRAKKVQGDYPAQLSKLDEKLKKQEHLEKILLKME 605
           L R  K Q D+   LS   +++K Q  LE + L ME
Sbjct: 910 LFRLCK-QEDF-LSLSPSRKQVKNQRALECVPLVME 943

>CAGL0J08206g Chr10 (809506..815202) [5697 bp, 1898 aa] {ON} similar
           to uniprot|P41832 Saccharomyces cerevisiae YNL271c BNI1
           regulator of budding
          Length = 1898

 Score = 33.5 bits (75), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 97/187 (51%), Gaps = 32/187 (17%)

Query: 500 VPYSKVIPANIKQVPFGSNAMEEQLKILNDISRDVG-SKIVQGQSLGLM---LYDRLLEQ 555
           +P SK++  + KQ P   N + +QLK+++ +  +V  +   +G ++ +    LYD +  Q
Sbjct: 647 LPTSKLL--DEKQDP---NKVTKQLKLMDSLVTNVSVTSTEEGSNVNMAIQRLYDSM--Q 699

Query: 556 QDKLSEQLIITNKILIRAKKVQGDYPAQLSKLDEKLKKQEH------------LEKILLK 603
            D+++ + I+ ++ L   KK++ +  A+   L EKL K EH             ++IL K
Sbjct: 700 TDEVARRAILESRTL--TKKLE-EMEAERDMLVEKLSKAEHGLVGQLEMEVKERDRILAK 756

Query: 604 MESNLNTIQ-ESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHKQKDQKQNIQFL----K 658
            +  +  ++ E ++LK   L EK  Q   ELR  + + N+   K K+QK+ I  +    K
Sbjct: 757 NQRVMKQLESELEELKKKHLLEKHEQEV-ELRKMLTILNSRPAKTKEQKKKIGSIEASEK 815

Query: 659 KELQKII 665
           ++LQ+ +
Sbjct: 816 EDLQRAL 822

>Agos_YGOB_G18084 Chr5 complement(940800..941861) [1062 bp, 354 aa]
           {OFF} ANNOTATED BY YGOB -
          Length = 354

 Score = 31.2 bits (69), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 54/99 (54%), Gaps = 15/99 (15%)

Query: 576 VQGDYPAQLSKLDEKL----KKQEHLEKILLKMESNLNTIQESQKLKSLPLSEKEIQLFK 631
            +G Y   L+KL+ ++    K+QEH E+ LL+     + + +SQ  K   LSE+  Q+  
Sbjct: 13  AKGPYTKNLTKLENQIVRFEKEQEHYEEALLEK----DLLIKSQTNKIRELSEQAQQVTL 68

Query: 632 ELRSQILLFNNFVHKQKDQKQNIQFLKKELQKIIDISRS 670
           EL+S+    +  +H+ +D         +EL++ ++++++
Sbjct: 69  ELKSERERLDELLHQWED-------TNRELRQALEMAKA 100

>NDAI0A06180 Chr1 complement(1405552..1407303) [1752 bp, 583 aa]
           {ON} Anc_3.47 YNL304W
          Length = 583

 Score = 31.6 bits (70), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 65/135 (48%), Gaps = 37/135 (27%)

Query: 327 LVVFKDKESTMSWDVNDYSFNNSFTLVEIIKFKPEELSNMVVLQGELGKFVVSGEKSTIL 386
           L++ K+ +ST S DVND   N+++T  + +  K ++           GK   S +++ I+
Sbjct: 234 LLLNKNMDST-SMDVNDN--NDNYTSYDYVDMKQKD---------NDGKKDASNKQNEII 281

Query: 387 VDTTKWSSVISKCIRDNDLRPLVGLEMKSTITHINSDMQINSCGIWN-SGEAK------- 438
           ++T                RP +G+++K+T+ +I  D + N C  W+ +G+ +       
Sbjct: 282 INT----------------RPTIGIDIKTTLINIGGDKRFN-CIFWDPAGQERFKNVMMN 324

Query: 439 SLLLVDTNVVVGYQL 453
           SL  V   +++ Y +
Sbjct: 325 SLYRVSDGIILSYDI 339

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 75,257,397
Number of extensions: 3446804
Number of successful extensions: 16082
Number of sequences better than 10.0: 512
Number of HSP's gapped: 16737
Number of HSP's successfully gapped: 616
Length of query: 717
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 600
Effective length of database: 40,065,477
Effective search space: 24039286200
Effective search space used: 24039286200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)