Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1032.96.27ON31831815080.0
NDAI0F017406.27ON3132939721e-132
KNAG0M012406.27ON3142959701e-131
CAGL0E02519g6.27ON3152739671e-131
Kwal_56.224546.27ON3152749431e-127
NCAS0H015106.27ON3132749411e-127
ZYRO0C07612g6.27ON3192759371e-126
SAKL0E01474g6.27ON3112819361e-126
KLTH0C11044g6.27ON3152909321e-125
TBLA0E030606.27ON3192819241e-124
KAFR0G026506.27ON3212889171e-123
ACL002C6.27ON3292739141e-123
TDEL0G044206.27ON3222799131e-122
Ecym_30316.27ON3282949111e-122
TPHA0M002906.27ON3272988871e-118
KLLA0D01331g6.27ON3082938821e-118
Smik_15.1686.27ON3272768351e-111
YOL002C (IZH2)6.27ON3172768321e-110
Skud_15.1606.27ON3272758261e-109
Suva_15.1736.27ON3272768051e-106
KLTH0C09504g3.90ON3192937489e-98
SAKL0C09218g3.90ON3142927288e-95
Kwal_56.227043.90ON3202937272e-94
Kpol_1053.263.90ON3242806802e-87
KLLA0C12441g3.90ON3152926662e-85
TPHA0A006403.90ON3272786576e-84
NDAI0A071603.90ON3302796551e-83
NCAS0I025703.90ON3142916506e-83
CAGL0G04631g3.90ON3162916507e-83
Smik_4.7693.90ON3162926498e-83
TDEL0D053403.90ON3162946462e-82
ZYRO0B06556g3.90ON3182966444e-82
AFR337W3.90ON3172786392e-81
Skud_4.7663.90ON3162926393e-81
YDR492W (IZH1)3.90ON3162926375e-81
Suva_2.6683.90ON3152946314e-80
TBLA0B022903.90ON3262776282e-79
Ecym_35883.90ON3052746252e-79
KAFR0A081303.90ON3192996053e-76
KNAG0K021603.90ON3232915872e-73
NCAS0C049203.90ON3262973801e-42
TBLA0B082553.90ON2962883721e-41
NDAI0G043003.90ON3182733051e-31
CAGL0I07491g3.90ON3012942411e-22
Suva_15.643.90ON3122321751e-13
Skud_15.533.90ON3122431723e-13
Smik_15.563.90ON3122431652e-12
YOL101C (IZH4)3.90ON3122431627e-12
KAFR0J006705.197ON5092631327e-08
KLLA0F15510g5.197ON6223031328e-08
Skud_12.915.197ON5422381238e-07
Kpol_2002.945.197ON5772481221e-06
NDAI0I023305.197ON5782121212e-06
KNAG0B051005.197ON5383301158e-06
YLR023C (IZH3)5.197ON5432381158e-06
Smik_12.865.197ON5422381141e-05
KNAG0K006703.90ON3212241131e-05
TBLA0C060505.197ON4373211131e-05
AAL153C5.197ON4193131122e-05
NCAS0D026005.197ON5432161094e-05
Suva_10.1045.197ON5412381071e-04
Ecym_71095.197ON5682701042e-04
KLTH0B03498g5.197ON5462461024e-04
TPHA0E031205.197ON569257930.005
TDEL0E043205.197ON450243930.005
SAKL0G12980g5.197ON563243860.034
Kwal_33.151225.197ON566250840.051
CAGL0D03322g5.197ON545242750.74
KNAG0I004201.459ON108539703.7
ZYRO0B10538g5.197ON531240676.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1032.9
         (318 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON} (22700..2...   585   0.0  
NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27      379   e-132
KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.2...   378   e-131
CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {O...   377   e-131
Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C...   367   e-127
NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON...   367   e-127
ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {O...   365   e-126
SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar...   365   e-126
KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {O...   363   e-125
TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27...   360   e-124
KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON...   357   e-123
ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON} Sy...   356   e-123
TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON...   356   e-122
Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to A...   355   e-122
TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27 ...   346   e-118
KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar...   344   e-118
Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {O...   326   e-111
YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}  ...   325   e-110
Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {O...   322   e-109
Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {O...   314   e-106
KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {O...   292   9e-98
SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar...   285   8e-95
Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W...   284   2e-94
Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON...   266   2e-87
KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa] ...   261   2e-85
TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON...   257   6e-84
NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {...   256   1e-83
NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON...   254   6e-83
CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar...   254   7e-83
Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W...   254   8e-83
TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90...   253   2e-82
ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar...   252   4e-82
AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic h...   250   2e-81
Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W...   250   3e-81
YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membr...   249   5e-81
Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W...   247   4e-80
TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON...   246   2e-79
Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar ...   245   2e-79
KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3....   237   3e-76
KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.9...   230   2e-73
NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {...   150   1e-42
TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}             147   1e-41
NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90    122   1e-31
CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {O...    97   1e-22
Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON...    72   1e-13
Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON} ...    71   3e-13
Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON} ...    68   2e-12
YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}  ...    67   7e-12
KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5....    55   7e-08
KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some...    55   8e-08
Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {O...    52   8e-07
Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON} (2295...    52   1e-06
NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197     51   2e-06
KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.1...    49   8e-06
YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON} ...    49   8e-06
Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {O...    49   1e-05
KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {O...    48   1e-05
TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON} Anc_5...    48   1e-05
AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON} Syn...    48   2e-05
NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.1...    47   4e-05
Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {...    46   1e-04
Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}...    45   2e-04
KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {...    44   4e-04
TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {O...    40   0.005
TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {O...    40   0.005
SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]...    38   0.034
Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023...    37   0.051
CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {...    33   0.74 
KNAG0I00420 Chr9 complement(62534..65791) [3258 bp, 1085 aa] {ON...    32   3.7  
ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {...    30   6.3  

>Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON}
           (22700..23656) [957 nt, 319 aa]
          Length = 318

 Score =  585 bits (1508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/318 (90%), Positives = 287/318 (90%)

Query: 1   MVSQNXXXXXXXXXXXXXXXXQVEKDGAKSSYSYIKRGVQLVTWEHLPDWQKDNEHILSG 60
           MVSQN                QVEKDGAKSSYSYIKRGVQLVTWEHLPDWQKDNEHILSG
Sbjct: 1   MVSQNIRRRSITSTSSTVTTVQVEKDGAKSSYSYIKRGVQLVTWEHLPDWQKDNEHILSG 60

Query: 61  YVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMTTIIFDKYVVERYPTTTLKDYLML 120
           YVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMTTIIFDKYVVERYPTTTLKDYLML
Sbjct: 61  YVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMTTIIFDKYVVERYPTTTLKDYLML 120

Query: 121 DLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSF 180
           DLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDY               YYGFYDNSF
Sbjct: 121 DLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDYLGIVVLIVSSMSSILYYGFYDNSF 180

Query: 181 LYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQE 240
           LYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQE
Sbjct: 181 LYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQE 240

Query: 241 TTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLR 300
           TTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLR
Sbjct: 241 TTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLR 300

Query: 301 GLLGSYTIVHTRLSSLTQ 318
           GLLGSYTIVHTRLSSLTQ
Sbjct: 301 GLLGSYTIVHTRLSSLTQ 318

>NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27
          Length = 313

 Score =  379 bits (972), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 174/293 (59%), Positives = 218/293 (74%), Gaps = 2/293 (0%)

Query: 23  VEKDGAKSSYSYIKRGV--QLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHN 80
           +       S   +KR V  +L  W+ +P+WQKDNEHI+SGYV+ETNS K CLHSL ++HN
Sbjct: 21  INNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVRETNSFKGCLHSLFYVHN 80

Query: 81  ESVNIFSHLVPAFCFMTTIIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCL 140
           ES N++SHL+P   F  T++ +KY +  Y TT++ DYLM+DLF FGAF CL++SS FHC 
Sbjct: 81  ESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLFHCF 140

Query: 141 KAHSPYVSSFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVS 200
           K+HS  V++ GNKLDY               Y+GF+DN   ++ FS++TF FG +CA VS
Sbjct: 141 KSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPLFFYFFSSLTFLFGGACATVS 200

Query: 201 LGERFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFG 260
           L + FR+REWRPYRA +FVAFGLSA+LPI AG  YYG++ET IR+QLKW++LEG FYIFG
Sbjct: 201 LKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFIRIQLKWIILEGFFYIFG 260

Query: 261 ALLYGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRL 313
           A LYGVRFPE+  PG FDIWGHSHQ+FHILVVVAA CHLRGLL SY IVH+RL
Sbjct: 261 AFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLLSSYEIVHSRL 313

>KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.27
           YOL002C
          Length = 314

 Score =  378 bits (970), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 168/295 (56%), Positives = 220/295 (74%)

Query: 24  EKDGAKSSYSYIKRGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESV 83
           E DG +   +  K   ++ TW  +P+WQKDNEHI+ GYV+ETNS   C+HSL ++HNESV
Sbjct: 19  EDDGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNESV 78

Query: 84  NIFSHLVPAFCFMTTIIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAH 143
           N++SHL+PA CF + +  +KY V+ + TT+L DYL +DLF  GAFTCL++SS FHC K+H
Sbjct: 79  NVYSHLIPALCFFSVLFLNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSH 138

Query: 144 SPYVSSFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGE 203
           S  V++FGNKLDY               YYGFYD+S +++ FS +T +FG +C VVSL +
Sbjct: 139 SLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKD 198

Query: 204 RFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALL 263
            FR+REWRPYRA +FVAFGLSA+LPI +G   YG++E   R+Q+KW++LEGVFYI GA L
Sbjct: 199 HFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGAFL 258

Query: 264 YGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLSSLTQ 318
           YG+RFPE+  PG +DIWGHSHQ+FHILVVVAALCHL+GL+ SY +VH  LSS T+
Sbjct: 259 YGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYELVHKGLSSATK 313

>CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002c
          Length = 315

 Score =  377 bits (967), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 172/273 (63%), Positives = 213/273 (78%)

Query: 40  QLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMTTI 99
           +L TWE +P+WQKDNEHI +GYV+ET+S+  C+ SL ++HNE+VNI+SHL+PA  F +TI
Sbjct: 37  KLYTWEEIPEWQKDNEHIHTGYVRETSSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTI 96

Query: 100 IFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDYXXX 159
            F+KYVV  Y TTTL DYL++D+F  GAF+CL++SS FHCLK+HS  V+ FGNKLDY   
Sbjct: 97  FFNKYVVPTYSTTTLIDYLIIDIFFLGAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGI 156

Query: 160 XXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAMFV 219
                       YYGF+ N + +  FS IT TFG +CAVVSL + FR+REWRPYRAA+FV
Sbjct: 157 VFLIVASMVSILYYGFHGNPWFFGIFSLITMTFGAACAVVSLKDTFRSREWRPYRAALFV 216

Query: 220 AFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGMFDI 279
            FGLSA+LPI AG   YG  ET  R+QLKWV+LEGVFYIFGA LYG+RFPE++ PG FD+
Sbjct: 217 IFGLSAVLPILAGLFKYGPTETWTRIQLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDL 276

Query: 280 WGHSHQLFHILVVVAALCHLRGLLGSYTIVHTR 312
           WGHSHQ+FHILVVVAALCHL+ LLGSY++VH R
Sbjct: 277 WGHSHQIFHILVVVAALCHLKALLGSYSLVHYR 309

>Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C -
           Hypothetical ORF [contig 185] FULL
          Length = 315

 Score =  367 bits (943), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 162/274 (59%), Positives = 208/274 (75%)

Query: 40  QLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMTTI 99
           +L  W+ +P+WQKDNEHIL+GY+ ET S+ ACL SLL++HNESVNI++HL+P +CF+   
Sbjct: 40  RLYKWDEIPEWQKDNEHILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMT 99

Query: 100 IFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDYXXX 159
           +F++  +ERY TT + DY+M+DLF  G FTCLMMSS FHC K HS  V+  GNKLDY   
Sbjct: 100 LFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGI 159

Query: 160 XXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAMFV 219
                       +YGF+DN+  ++ FS +T  FGL+C +VSL ++FR+R+WRPYRAA+FV
Sbjct: 160 VALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFV 219

Query: 220 AFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGMFDI 279
           AFGLSAL P+ AG  +YG + T  R+QLKWV LEGVFYI GALLYGVRFPER+ PG FDI
Sbjct: 220 AFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDI 279

Query: 280 WGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRL 313
           WG SHQLFH+LVV+AA CHLR LLG+Y  VH+++
Sbjct: 280 WGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 313

>NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON}
           Anc_6.27
          Length = 313

 Score =  367 bits (941), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 163/274 (59%), Positives = 208/274 (75%)

Query: 40  QLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMTTI 99
           +L TW+ +P+WQKDNEHI++GYV+ETNS + C  SL +IHNE+ N++SHLVP   F  T+
Sbjct: 40  KLYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTM 99

Query: 100 IFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDYXXX 159
           +FDKY +  + TTT  DYL+++LF  GAFTCL++SS FHC K+HS  +++FGNKLDY   
Sbjct: 100 LFDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGI 159

Query: 160 XXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAMFV 219
                       +YGFYDN   ++ FS +T +FG +CA+VSL ++FR+REWRPYRA +FV
Sbjct: 160 VVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFV 219

Query: 220 AFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGMFDI 279
           AFGLSA+LPI  G +YYG  ET  R+QLKWVVLEGVFYIFGA LYG+RFPE+   G FDI
Sbjct: 220 AFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDI 279

Query: 280 WGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRL 313
           WGHSHQ+FH+LVVVAA CHL+ LLGSY +VH  L
Sbjct: 280 WGHSHQIFHLLVVVAAFCHLKALLGSYELVHMNL 313

>ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  365 bits (937), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 161/275 (58%), Positives = 205/275 (74%)

Query: 41  LVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMTTII 100
           L TW  +PDWQKDNEHI+ GYV+ETNSI+ CL SLL++HNES+NI++H +P  CF+ T I
Sbjct: 42  LYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESINIYTHFLPGLCFLATCI 101

Query: 101 FDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDYXXXX 160
           FDK+ ++ + TTT  DY+ +D F FGAF+CL++SS FHC K+HS  VS FGNKLDY    
Sbjct: 102 FDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSSRVSVFGNKLDYLGIV 161

Query: 161 XXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAMFVA 220
                      YY F+D++ L+++F+ I F FG+SC + S  + FR+REWRPYRA +FVA
Sbjct: 162 ILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRAGLFVA 221

Query: 221 FGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGMFDIW 280
           FGLSALLPI  G + YG  ET  R+Q+KWV+LEG+FYIFGA LY +RFPERL PG FD  
Sbjct: 222 FGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFLYSIRFPERLAPGAFDFV 281

Query: 281 GHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLSS 315
           GHSHQ+FH+LVV+AALCHL  L+ SY +VHT L S
Sbjct: 282 GHSHQIFHVLVVIAALCHLVALMNSYELVHTNLLS 316

>SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 311

 Score =  365 bits (936), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 162/281 (57%), Positives = 210/281 (74%)

Query: 36  KRGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCF 95
           KR  +L +WE +PDWQKDNEHI  GYV+ETNS   C  SL ++HNESVNI++HL+P  CF
Sbjct: 31  KRVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYMHNESVNIYTHLLPGLCF 90

Query: 96  MTTIIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLD 155
              ++FDK  ++ + TTT  DY+M+DLF  GAFTCL++SS FHCLK HS  ++  GNKLD
Sbjct: 91  FFVVLFDKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNKLD 150

Query: 156 YXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRA 215
           Y               YYGF+D+   ++ FS +T  FG++CA+ SL + FR+REWRPYRA
Sbjct: 151 YLGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYRA 210

Query: 216 AMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPG 275
           A+FVAFGLSA+LPIF+G   YG +ET ++VQ+KWV+L GVFYI GALLY +R PER+ PG
Sbjct: 211 ALFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYIIGALLYALRLPERISPG 270

Query: 276 MFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLSSL 316
            FDIWGHSHQ+FHILVV+AALCHL+ +L SY +VH +L+S+
Sbjct: 271 KFDIWGHSHQIFHILVVIAALCHLKAVLNSYELVHKKLASI 311

>KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  363 bits (932), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 166/290 (57%), Positives = 216/290 (74%), Gaps = 2/290 (0%)

Query: 23  VEKDGAKSSYSYIKRGVQ--LVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHN 80
           VE++ +    S +K+  +  L TW+ +P+WQ+DNEHI+ GY+ ET S   CL SLL++HN
Sbjct: 21  VEENSSLLKDSNLKQRTKRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHN 80

Query: 81  ESVNIFSHLVPAFCFMTTIIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCL 140
           ESVNI++HL+P +CF+   +F++ V+E++ TT L DY+M+DLF  G FTCLMMSS FHC 
Sbjct: 81  ESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCF 140

Query: 141 KAHSPYVSSFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVS 200
           K HS  V+  GNKLDY               +YGF+D    ++ FS +T  FGL+CA VS
Sbjct: 141 KCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVS 200

Query: 201 LGERFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFG 260
           L  +FR+REWRPYRA++FVAFGLSALLP+ AG L+YG++ET  R+QL+WV+L GVFYI G
Sbjct: 201 LSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILG 260

Query: 261 ALLYGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVH 310
           A+LYG+RFPER+ PG FDIWGHSHQLFHILVVVAALCHLR LLG+Y + H
Sbjct: 261 AVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFH 310

>TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27
           YOL002C
          Length = 319

 Score =  360 bits (924), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 159/281 (56%), Positives = 209/281 (74%)

Query: 38  GVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMT 97
           G +L TW+ +P WQ DNE+I +GYV+ETNS+K    SL +IHNESVNI++HL+PAFCF++
Sbjct: 36  GKRLYTWDEIPVWQHDNEYIYTGYVRETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLS 95

Query: 98  TIIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDYX 157
            ++F+ Y V+ +PTTT  DY+ +DLF  GAFTCL +SS FHC K+HS  +S FGNKLDY 
Sbjct: 96  MLLFNTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYL 155

Query: 158 XXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAM 217
                         Y+G++D+ F+++ FS IT  FG++C + SL ++FR REWRPYRAA+
Sbjct: 156 GIVILISTSLISVLYFGYHDDPFIFYIFSGITLCFGIACGIASLKDKFRTREWRPYRAAL 215

Query: 218 FVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGMF 277
           FV FGLS +LPI AG + YG++E   RVQLKW++ EGV YIFGA LYG RFPE+  PG  
Sbjct: 216 FVLFGLSGVLPIIAGIMKYGIREVFERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKV 275

Query: 278 DIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLSSLTQ 318
           DIWG SHQ+FH+LVV+AALCHLRGL+GSY +VH +L +  Q
Sbjct: 276 DIWGQSHQIFHVLVVIAALCHLRGLIGSYELVHQKLDAQLQ 316

>KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON}
           Anc_6.27 YOL002C
          Length = 321

 Score =  357 bits (917), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 163/288 (56%), Positives = 214/288 (74%), Gaps = 1/288 (0%)

Query: 23  VEKDGAKSSYSYIKRGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNES 82
           VE++  ++  S +++ +QL  W  +PDWQKDNEHI+SGYVKETNS  +C+ SL ++HNES
Sbjct: 23  VEQNKGETIRS-LEKIIQLYNWNEIPDWQKDNEHIISGYVKETNSFFSCIESLFYLHNES 81

Query: 83  VNIFSHLVPAFCFMTTIIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKA 142
           VN++SHL+PA CF+ T + +K +V ++ TTT+ DYL +DLF  GAFTCL++SS FHC K+
Sbjct: 82  VNVYSHLIPAVCFLMTSLLNKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKS 141

Query: 143 HSPYVSSFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLG 202
           HS  +++FGNKLDY               YYGFYD   L++ F+ IT +FGL+CA VSL 
Sbjct: 142 HSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLK 201

Query: 203 ERFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGAL 262
           ++FR+RE R YRA +FV FGLSA+LP+  G  +YG   T  R+QLKWV+LEGVFYIFGA 
Sbjct: 202 DKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEGVFYIFGAF 261

Query: 263 LYGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVH 310
           LYG+RFPE+  PG +DIWGHSHQLFHILVV+AALCH + L+ SY  VH
Sbjct: 262 LYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALMCSYEHVH 309

>ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL002C
          Length = 329

 Score =  356 bits (914), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 164/273 (60%), Positives = 198/273 (72%)

Query: 40  QLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMTTI 99
            L +W+ LPDWQKDNEHILSGYV+ETNS +    SL ++HNESVNI+SHL+P  CF+   
Sbjct: 51  SLCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIA 110

Query: 100 IFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDYXXX 159
           +F+KYVV  Y TTT KDYLM+D+FL GA  CL +S  +HC+K+HS  VS FGNKLDY   
Sbjct: 111 LFNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGI 170

Query: 160 XXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAMFV 219
                       YYGFYD++ ++  FS +T +  L+CAVVSL   FR+REWR YRAA+F 
Sbjct: 171 VALISCSMISQMYYGFYDSTAMFSLFSTVTLSLALACAVVSLSPHFRSREWRKYRAAIFT 230

Query: 220 AFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGMFDI 279
           AFGLS LLP+     YYG  E   R+QLKW+ LEGV YI GA+LYGVRFPE+L+PG FDI
Sbjct: 231 AFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDI 290

Query: 280 WGHSHQLFHILVVVAALCHLRGLLGSYTIVHTR 312
           WGHSHQLFH+LVV+AALCHLR LL  Y  VHT 
Sbjct: 291 WGHSHQLFHVLVVIAALCHLRALLSCYKNVHTN 323

>TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON}
           Anc_6.27 YOL002C
          Length = 322

 Score =  356 bits (913), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 165/279 (59%), Positives = 207/279 (74%)

Query: 36  KRGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCF 95
           K+  +L TW+ +P WQ+DNEHILSGYV ET S+  C  SL ++HNESVNI++HL+P   F
Sbjct: 40  KKKRKLYTWDEIPHWQRDNEHILSGYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAF 99

Query: 96  MTTIIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLD 155
           +  + FDK+ V ++ TTTL DY+M+DLF   +FTCL +SS FHCLK HS  V++FGNKLD
Sbjct: 100 LFVLCFDKFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLD 159

Query: 156 YXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRA 215
           Y               YYGF++   L++ FS IT TFG +CAVVSL E FR REWRPYRA
Sbjct: 160 YLGIVVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRA 219

Query: 216 AMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPG 275
           AMFVAFGLSA+LPI  G  YYG  E  +R+Q+KWV+L G+FYI GA+LYGVRFPE+  PG
Sbjct: 220 AMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPG 279

Query: 276 MFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLS 314
            +DIWGHSHQLFH+LVVVAALCHL GL+ SY +VH +++
Sbjct: 280 KYDIWGHSHQLFHVLVVVAALCHLYGLIKSYNLVHLKMA 318

>Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to
           Ashbya gossypii ACL002C
          Length = 328

 Score =  355 bits (911), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 160/294 (54%), Positives = 209/294 (71%)

Query: 25  KDGAKSSYSYIKRGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVN 84
           +D  +++   +K   +L +W  +P+WQ+DNEHIL GYVKETNS K  LHSLL++HNESVN
Sbjct: 32  EDLNQATTIPLKPASKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVN 91

Query: 85  IFSHLVPAFCFMTTIIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHS 144
           I++HL+P  CF   +  +KYV+ R+ TTT KDY ++D F  GAF CL+MS  +HCLK+HS
Sbjct: 92  IYTHLIPGVCFFCVLFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHS 151

Query: 145 PYVSSFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGER 204
             VS  GN+LDY               YYGFY++S +++ FS +T   G  C VV+L  R
Sbjct: 152 YPVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSR 211

Query: 205 FRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLY 264
           FR+R WRPYRA++FVAFGLS++LPI A  LYYG +ET   VQL W++LEGV YIFGA +Y
Sbjct: 212 FRSRLWRPYRASIFVAFGLSSILPILASILYYGSEETWNSVQLGWIILEGVLYIFGAFIY 271

Query: 265 GVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLSSLTQ 318
           G+RFPE + PG FDIWGHSHQLFH+LVV+AALCH + +  SY +VH RL+   Q
Sbjct: 272 GIRFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVHFRLNEAVQ 325

>TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27
           YOL002C
          Length = 327

 Score =  346 bits (887), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 159/298 (53%), Positives = 205/298 (68%), Gaps = 7/298 (2%)

Query: 23  VEKDGAKSSYSYIKR----GVQLVT---WEHLPDWQKDNEHILSGYVKETNSIKACLHSL 75
           +  DG KS+   +K       QL+T   W+ LPDWQKDNEHI  GYVKETNS   C  SL
Sbjct: 28  IANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQKDNEHIHEGYVKETNSFINCFESL 87

Query: 76  LFIHNESVNIFSHLVPAFCFMTTIIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSS 135
            F+HNESVNI+SH+VP  C +  ++ D  +++++PTTT  DY M+DLFL GAF+CL++SS
Sbjct: 88  FFLHNESVNIYSHMVPGLCALFMLLIDINIIKKFPTTTFVDYFMIDLFLAGAFSCLILSS 147

Query: 136 AFHCLKAHSPYVSSFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLS 195
           AFH LK+HS +V+ +GNKLDY               YYGFYD  + +  FS IT  FG++
Sbjct: 148 AFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYGFYDTPYFFHLFSTITILFGIA 207

Query: 196 CAVVSLGERFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGV 255
           C  VSL  +FR+REWRPYRA +FV FGLSA+ P+  G  YYG+++T  R+QLKW+V EG 
Sbjct: 208 CGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIWYYGLEDTFKRIQLKWIVTEGF 267

Query: 256 FYIFGALLYGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRL 313
           FYIFGA LY +R+PER+ PG FD+WGHSHQ+FH+ VV+AA  H  GLL +Y   H  L
Sbjct: 268 FYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIAAYSHFHGLLSAYEYAHEML 325

>KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 308

 Score =  344 bits (882), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 164/293 (55%), Positives = 206/293 (70%), Gaps = 3/293 (1%)

Query: 24  EKDGAKSSYSYIKRGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESV 83
           E  G K +    +R  ++ +W+ +PDWQKDNEHIL GYV+ET S K   HSL ++HNESV
Sbjct: 18  ETPGTKKTVRVYER--RVYSWDEIPDWQKDNEHILHGYVRETQSWKELFHSLFYLHNESV 75

Query: 84  NIFSHLVPAFCFMTTIIF-DKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKA 142
           NI++HL+PA      ++F   +V+  YPTT+  DY M++LF FG  TCL MSS FH +K 
Sbjct: 76  NIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFFFGCATCLTMSSMFHTIKC 135

Query: 143 HSPYVSSFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLG 202
           HS  +++FGNKLDY               +YGF+D+S L++ F+ +T  FGL C  +SL 
Sbjct: 136 HSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSLFGLICGYMSLK 195

Query: 203 ERFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGAL 262
           ++FR+REWRPYRA MFV FGLSA+ PI AGF+ YG  ET  RVQL WV+ EGV YIFGA 
Sbjct: 196 DKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLTWVIWEGVLYIFGAF 255

Query: 263 LYGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLSS 315
           LYGVRFPERL PG FDIWGHSHQLFH+LVVVAALCHL+ L+ SY +VH  LS 
Sbjct: 256 LYGVRFPERLAPGKFDIWGHSHQLFHVLVVVAALCHLKALVVSYGLVHQALSQ 308

>Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  326 bits (835), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 146/276 (52%), Positives = 203/276 (73%)

Query: 40  QLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMTTI 99
           +L +W+ +P+WQ+DN+ IL GYV+ET+S      SL ++HNESVNI+SHLVPA  F T +
Sbjct: 48  RLYSWDEIPEWQRDNDFILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVL 107

Query: 100 IFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDYXXX 159
           + DK  ++ + TTT KD++++DLF  GAF CL++SS+FHCLK+HS  +++ GNKLDY   
Sbjct: 108 LLDKSTIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGI 167

Query: 160 XXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAMFV 219
                       +YG+Y+   L+  F+ IT +FG++C++VSL ++FR REWRPYRA +FV
Sbjct: 168 CILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFV 227

Query: 220 AFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGMFDI 279
            FGLS+++PIF+G   Y   E   ++QL WV+L GV YI GA+LYG+RFPE++ PG FDI
Sbjct: 228 CFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDI 287

Query: 280 WGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLSS 315
           WGHSHQLFH LVV+A+LCHLRGLL SY +VH ++ S
Sbjct: 288 WGHSHQLFHFLVVIASLCHLRGLLNSYELVHIKMES 323

>YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}
           IZH2Plasma membrane protein involved in zinc homeostasis
           and osmotin-induced apoptosis; transcription regulated
           by Zap1p, zinc and fatty acid levels; similar to
           mammalian adiponectins; deletion increases sensitivity
           to elevated zinc
          Length = 317

 Score =  325 bits (832), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 145/276 (52%), Positives = 202/276 (73%)

Query: 40  QLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMTTI 99
           +L +W+ +P+WQ+DN+ IL GYVKET+S      SL ++HNESVNI+SHL+PA  F T +
Sbjct: 38  RLYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVL 97

Query: 100 IFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDYXXX 159
           + DK  ++ + TTT  D++++DLF  GAF CL++SS+FHCLK+HS  +++ GNKLDY   
Sbjct: 98  LLDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGI 157

Query: 160 XXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAMFV 219
                       YYG+++   L+  F+ IT +FG++C++VSL ++FR REWRPYRA +FV
Sbjct: 158 CILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFV 217

Query: 220 AFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGMFDI 279
            FGLS+++PIF+G   Y   E   ++QL WV+L GV YI GA+LYG+RFPE++ PG FDI
Sbjct: 218 CFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDI 277

Query: 280 WGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLSS 315
           WGHSHQLFH LVV+AALCHLRGLL SY +VH ++ +
Sbjct: 278 WGHSHQLFHFLVVIAALCHLRGLLNSYELVHIKMEN 313

>Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  322 bits (826), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 143/275 (52%), Positives = 201/275 (73%)

Query: 40  QLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMTTI 99
           +L +W+ +P+WQ+DN++IL GYV+ET S      SL ++HNESVNI+SHL+PA  F T +
Sbjct: 48  RLYSWDEIPEWQRDNDYILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVL 107

Query: 100 IFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDYXXX 159
           + DK  ++ + TTT KD++++DLF  GAF CL++SS+FHCLK+HS  +++ GNKLDY   
Sbjct: 108 LLDKSTIKVFETTTWKDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGI 167

Query: 160 XXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAMFV 219
                       YYG+Y+   L+  F+ IT +FG++C++V+L ++FR REWRPYRA +FV
Sbjct: 168 CILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFV 227

Query: 220 AFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGMFDI 279
            FGLS+++PIF+G   Y   E   ++QL WV+L GV YI GA+LYG+RFPE++ PG FDI
Sbjct: 228 CFGLSSIVPIFSGLYCYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDI 287

Query: 280 WGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLS 314
           WGHSHQLFH LVV+A+ CHLRGLL SY +VH ++ 
Sbjct: 288 WGHSHQLFHFLVVIASFCHLRGLLNSYELVHLKME 322

>Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  314 bits (805), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 142/276 (51%), Positives = 201/276 (72%)

Query: 40  QLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMTTI 99
           ++ +W+ +P+WQ+DN++IL GYVKET+S      SL ++HNESVNI+SHL+PA  F+T +
Sbjct: 48  RVYSWDEIPEWQRDNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVL 107

Query: 100 IFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDYXXX 159
           + DK  +  + TTT  D++M+DLF  GAF CL++SS+FHC K+HS  +++ GNKLDY   
Sbjct: 108 LLDKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGI 167

Query: 160 XXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAMFV 219
                       YYG+YD    +  F+ IT +FG++C++VSL ++FR REWRPYRA +FV
Sbjct: 168 CILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFV 227

Query: 220 AFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGMFDI 279
            FGLS+++PIF+G  YY   E   ++QL WV+L G  YI GA+LYG+RFPE++ PG FDI
Sbjct: 228 CFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDI 287

Query: 280 WGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLSS 315
           WGHSHQLFH LVV+A+LCH+RG+L SY +VH ++ +
Sbjct: 288 WGHSHQLFHFLVVIASLCHMRGVLNSYELVHIKMQN 323

>KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {ON}
           similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  292 bits (748), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 139/293 (47%), Positives = 192/293 (65%), Gaps = 4/293 (1%)

Query: 25  KDGAKSSYSYIKRGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVN 84
           K G   + +  K G  L  +E LPDWQ+DN+ IL+GYV+ETNS+K C  SL + HNE+VN
Sbjct: 20  KAGTSGATAPGKNG--LCCFEELPDWQRDNDKILAGYVRETNSMKKCFESLTYFHNETVN 77

Query: 85  IFSHLVPAFCFMTTIIF--DKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKA 142
           I++HL+P+  ++  ++F  D +++ ++PTTT+ DY+M++ FL GAF CLM S+ FHCLK 
Sbjct: 78  IYTHLIPSGTYLVMLMFFTDLFLIPQFPTTTMSDYIMINFFLLGAFLCLMCSTCFHCLKQ 137

Query: 143 HSPYVSSFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLG 202
           HS   S+  +K+DY               YYGFYD  F +  F+      G  CA   L 
Sbjct: 138 HSEAQSNIWSKVDYMGIIVLISCSTVSLLYYGFYDYLFHFKMFTIAVVVLGSCCAAFVLN 197

Query: 203 ERFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGAL 262
           +RF A+ WR  RA  FV FG S ++PI  G + +G+ E++ RVQL++V+LE +FYI GA+
Sbjct: 198 DRFNAKNWRACRAGFFVTFGFSGIVPIVVGLVKFGIAESSKRVQLRFVLLEALFYISGAV 257

Query: 263 LYGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLSS 315
           +YG R PE L PG FD  GHSHQ+FHILVV+ +LCH R LLGSY  +HT +SS
Sbjct: 258 IYGFRIPETLLPGKFDFVGHSHQIFHILVVLGSLCHFRALLGSYFFMHTGISS 310

>SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 314

 Score =  285 bits (728), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 133/292 (45%), Positives = 190/292 (65%), Gaps = 2/292 (0%)

Query: 22  QVEKDGAKSSYSYIKRGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNE 81
           +  +  +  S +  K   +L T+E LPDWQKDNE IL GYV+ET S+  C  SLL+ HNE
Sbjct: 12  KTTQKASAESIATAKGRKRLCTFEELPDWQKDNELILDGYVRETRSVSECFKSLLYFHNE 71

Query: 82  SVNIFSHLVPAFCFMTTIIF--DKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHC 139
           +VNI++HLVP   ++  ++F  D  ++ ++P++T+ DY++++ FL GAF CLM SS FHC
Sbjct: 72  TVNIYTHLVPGVTYLLMLMFLTDFILIPKFPSSTMTDYIIINFFLLGAFVCLMCSSCFHC 131

Query: 140 LKAHSPYVSSFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVV 199
           LK HS   S   +K+DY               YYGF+D+ F +  F+ +T   G  CA  
Sbjct: 132 LKQHSEEHSDIWSKVDYMGIIVLISCSMVSILYYGFHDHLFHFKIFTVVTVILGSCCAAF 191

Query: 200 SLGERFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIF 259
            L +RF ++ +R +RA+ FV+FG S L+PI  G + +G+ E+  RVQLK+V LE VFYI 
Sbjct: 192 VLNDRFNSKNFRVFRASFFVSFGFSGLVPIIFGLVKFGISESVHRVQLKYVGLEAVFYIG 251

Query: 260 GALLYGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHT 311
           GA+ YG R PE   PG FD+ GHSHQ+FH++VV+ +LCHLR ++GSY  +HT
Sbjct: 252 GAVFYGFRIPENFGPGKFDLVGHSHQIFHVMVVLGSLCHLRAVVGSYIFMHT 303

>Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W -
           Hypothetical ORF [contig 184] FULL
          Length = 320

 Score =  284 bits (727), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 132/293 (45%), Positives = 190/293 (64%), Gaps = 2/293 (0%)

Query: 25  KDGAKSSYSYIKRGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVN 84
           K+G  S  +   +   L  +E LP+WQ+DNE IL+GYV+ET S++ CL SL + HNE++N
Sbjct: 19  KNGKNSKSAEQTKKSALCRFEELPEWQRDNEKILAGYVRETRSMRKCLESLTYFHNETLN 78

Query: 85  IFSHLVPAFCFMTTIIF--DKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKA 142
           I++HL+P+  ++  ++F  D +++  +P+TT+ DY+M++ +L GAF CL+ S+ FHCLK 
Sbjct: 79  IYTHLIPSGTYLVLLMFFTDVFLIPHFPSTTMSDYIMINFYLLGAFLCLLCSTCFHCLKQ 138

Query: 143 HSPYVSSFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLG 202
           HS   S+  +K+DY               YYGF+D  F +  F+      G  CA   L 
Sbjct: 139 HSEAQSNIWSKVDYMGIIVLISCSTVSLLYYGFHDYLFHFKIFTIAVVVLGSCCAAFVLN 198

Query: 203 ERFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGAL 262
           +RF A+ WR  RA  FV FG S ++PI  G + +GV E++ RVQL++V+LE  FYI GA+
Sbjct: 199 DRFNAKNWRACRAGFFVTFGFSGIVPIIMGLVKFGVAESSKRVQLRFVLLEAFFYIGGAI 258

Query: 263 LYGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLSS 315
           +YG R PE L PG FD  GHSHQ+FHILVV+ +LCH R L+GSY  +HT +SS
Sbjct: 259 IYGFRIPETLIPGKFDFVGHSHQIFHILVVLGSLCHFRALIGSYFFMHTGISS 311

>Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON}
           complement(40099..41073) [975 nt, 325 aa]
          Length = 324

 Score =  266 bits (680), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 130/280 (46%), Positives = 183/280 (65%), Gaps = 4/280 (1%)

Query: 39  VQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMTT 98
           ++L  +  LPDWQKDNE IL+GYV+ETNSIK CL SL   +NES+NI+SHL+ A  +   
Sbjct: 39  IKLCHFHELPDWQKDNEFILTGYVRETNSIKKCLRSLGCFNNESINIYSHLIAAISYFVV 98

Query: 99  IIF--DKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDY 156
           ++F  D   +  +P+TT  DY+++DL+L GAFTCL+ SS FHC+K HS   S   +K+DY
Sbjct: 99  LLFYTDILCIPSFPSTTFVDYMVIDLYLLGAFTCLIGSSLFHCMKQHSESHSDMWSKVDY 158

Query: 157 XXXXXXXXXXXXXXXYYGFYDNSFLYF-TFSAITFTFGLSCAVVSLGERFRAREWRPYRA 215
                          YYG+ D+ F+YF  F+ IT      C +  L +RF ++ +RP RA
Sbjct: 159 IGIICLITCSLISLLYYGYMDH-FIYFKVFTVITLVLATICTICVLDQRFNSKNFRPIRA 217

Query: 216 AMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPG 275
             F+ F +SA++PI AGF  +G  E   R+QL++V  E  FY+ GALLYG R PE L PG
Sbjct: 218 GFFILFSMSAVIPIGAGFSKFGFTEVLQRIQLRFVAWETFFYVVGALLYGFRIPETLYPG 277

Query: 276 MFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLSS 315
            FD+ G SHQ+FHI+V++ ++ HL+ +LGSYT +H+ +SS
Sbjct: 278 NFDLVGSSHQIFHIMVILGSVFHLKAVLGSYTFMHSNISS 317

>KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa]
           {ON} similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  261 bits (666), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 126/292 (43%), Positives = 184/292 (63%), Gaps = 5/292 (1%)

Query: 22  QVEKDGAKSSYSYIKRGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNE 81
           ++E+    +  S IKR   L  +  LP+WQ+DN+ I++GY++ET S+K C+ SL   HNE
Sbjct: 16  KLEQLTPVAISSTIKR---LYRYSELPEWQQDNDKIITGYIRETKSVKECVKSLFLFHNE 72

Query: 82  SVNIFSHLVPAFCFMTTII--FDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHC 139
           S+NI+SHLVP   ++  ++   D ++V ++P +T+   +M+  FL G+  CL  SS FHC
Sbjct: 73  SINIYSHLVPTITYLVLLVGLADMFLVPQFPNSTMMQSVMIHFFLLGSVLCLGCSSFFHC 132

Query: 140 LKAHSPYVSSFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVV 199
           LK HS       +K+DY               YYGF+D+ F +  F+  T   G  C V 
Sbjct: 133 LKQHSESHCHIWSKVDYMGIIIMITCSIISLLYYGFHDHIFHFKCFTVFTVILGTICTVF 192

Query: 200 SLGERFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIF 259
           +L ++F ++ +RP+RA  +V FGLS ++PI  GF  +G  E   RVQLK+V+LE +FYI 
Sbjct: 193 ALHDKFNSKTFRPFRAMFYVTFGLSGIVPIVTGFWKFGAYEAIRRVQLKYVLLEAMFYIA 252

Query: 260 GALLYGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHT 311
           GA++YG RFPE L PG FD  GHSHQ+FHI+VV+ ++CH R +LGSY  +HT
Sbjct: 253 GAVIYGFRFPEVLAPGKFDFVGHSHQIFHIMVVLGSICHFRAILGSYVFMHT 304

>TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON}
           Anc_3.90 YOL101C
          Length = 327

 Score =  257 bits (657), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 126/278 (45%), Positives = 177/278 (63%), Gaps = 4/278 (1%)

Query: 40  QLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMTTI 99
           +L ++  LP+WQKDNE I+ GYV+ETNS   C HSL + HNES+NI++HL+P   +   +
Sbjct: 44  KLYSFHELPEWQKDNELIIQGYVRETNSWFKCFHSLSYFHNESINIYTHLIPGLVYFIML 103

Query: 100 IF--DKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDYX 157
           +F  D  VV  +P+TT+ DY+++D +L GAF CL+ SS FHCLK HS   S+F +K+DY 
Sbjct: 104 LFYTDLLVVPSFPSTTIMDYIVIDFYLLGAFICLVGSSCFHCLKQHSEDQSNFWSKIDYV 163

Query: 158 XXXXXXXXXXXXXXYYGFYDNSFLYF-TFSAITFTFGLSCAVVSLGERFRAREWRPYRAA 216
                         YYG++D+ F+YF  F+ IT      C V  L ERF A+ +RP RA 
Sbjct: 164 GIICLISCSLISLLYYGYFDH-FIYFKVFTLITLILATICTVCVLDERFNAKNFRPIRAG 222

Query: 217 MFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGM 276
            FV F  SA++PI  G + +   E   R+QL++V  E  FY+ GALLYG R PE   PG 
Sbjct: 223 FFVVFATSAVIPICTGLIKFDYVEVINRIQLRFVGWETFFYVVGALLYGYRIPEIFAPGR 282

Query: 277 FDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLS 314
           FD+ G SHQ+FH++VV+ +L HL+ ++GSY  +H  L+
Sbjct: 283 FDLVGSSHQIFHVMVVIGSLFHLKAVIGSYEFMHKSLN 320

>NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {ON}
           Anc_3.90
          Length = 330

 Score =  256 bits (655), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 114/279 (40%), Positives = 183/279 (65%), Gaps = 4/279 (1%)

Query: 36  KRGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCF 95
           KR + L  ++ LP+WQKDN+ IL+GYV+ETNS   C  SL +++NE++NI++HL+P+  +
Sbjct: 48  KRKIHLSKFDELPEWQKDNDKILTGYVRETNSFIHCFQSLFYLNNETINIYTHLIPSIIY 107

Query: 96  MT---TIIFDKYV-VERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFG 151
           +    T IF  ++ + ++PTT++ DY+++++F+ GAFTCL++SS FHCLK HS    +  
Sbjct: 108 LIVSLTFIFINFIAIPKFPTTSVIDYIVINIFILGAFTCLLLSSCFHCLKQHSFKQCTLW 167

Query: 152 NKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWR 211
           +KLDY               Y+G++D    +  F+ +TF+F + C+++ L E+F    +R
Sbjct: 168 SKLDYIGIIILISCSIIPILYFGYFDRLSYFKFFTILTFSFAIVCSIIVLNEKFDLPSYR 227

Query: 212 PYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPER 271
           P RA +F+ F  + L+P+  GF  +G +    R+ L +V+LE +FYI G LLYG R PE 
Sbjct: 228 PLRAGLFMLFSFTGLIPMITGFYIFGYKGVMERISLNFVLLEAIFYIIGTLLYGFRIPET 287

Query: 272 LKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVH 310
            KPG FD++G SHQ+FHI VV+ ++CH   ++ SY ++H
Sbjct: 288 FKPGNFDMFGSSHQIFHIFVVLGSICHFGAVIKSYCLMH 326

>NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON}
           Anc_3.90 YDR492W
          Length = 314

 Score =  254 bits (650), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 122/291 (41%), Positives = 183/291 (62%), Gaps = 5/291 (1%)

Query: 26  DGAKSSYSYIKRGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNI 85
           DG K+  ++ +R   L  +  LP+WQ+DN+ IL+GYV+ET S K CL SLL+ +NE++NI
Sbjct: 27  DGDKTKRNWKRR---LFNFNELPEWQRDNDKILTGYVRETKSFKQCLQSLLYWNNETINI 83

Query: 86  FSHLVPAFCFMT--TIIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAH 143
           ++HL+PA  ++T    + +  VV  +PTT++ DY ++++FL GAF CL++SS FHCLK H
Sbjct: 84  YTHLIPALFYLTISVTLINYVVVPHFPTTSIMDYFVINVFLMGAFVCLILSSCFHCLKQH 143

Query: 144 SPYVSSFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGE 203
           S    +  +KLDY               Y+G++D+ +    F  +TF+F   C++  L E
Sbjct: 144 SSRQCTLWSKLDYMGIIILISCSLIPMIYFGYFDHLYYVNFFIILTFSFATLCSICVLNE 203

Query: 204 RFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALL 263
           +F    +RP+RA +F+ F  S  +PI  GF  +G      RV LK+V  E +FYI GA L
Sbjct: 204 KFNVPHYRPFRAIVFMLFSFSGFIPILTGFYLFGFHGVFERVALKFVAWEALFYITGATL 263

Query: 264 YGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLS 314
           YG R PE  KPG FD  G SHQ+FHILVV+ ++CH R ++ SY ++H+ ++
Sbjct: 264 YGFRIPECFKPGDFDFLGSSHQIFHILVVLGSICHFRAVIKSYILMHSSMN 314

>CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar to
           uniprot|Q03419 Saccharomyces cerevisiae YDR492w
          Length = 316

 Score =  254 bits (650), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 119/291 (40%), Positives = 186/291 (63%), Gaps = 2/291 (0%)

Query: 24  EKDGAKSSYSYIKRGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESV 83
             DG+  ++   K    L  +  LP+WQKDN+ IL GYV+ETNS K CL SLL+++NESV
Sbjct: 21  RNDGSIHAHGEEKSEKLLWHFNELPEWQKDNDKILRGYVRETNSFKRCLQSLLYLNNESV 80

Query: 84  NIFSHLVPAFCFMTTIIF--DKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLK 141
           NI++HL+PA  +++  ++  + +++  YP+T+  DY+++++F  GAF CL+ SS FHC+K
Sbjct: 81  NIYTHLIPAVFYISLSLYLANVFLIPVYPSTSSVDYVIINVFFLGAFFCLLCSSCFHCMK 140

Query: 142 AHSPYVSSFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSL 201
            HS    +  +KLDY               YYG++D+   +  F+ IT    + C+V  L
Sbjct: 141 QHSESQCNVWSKLDYLGIICLISCSTVPMIYYGYFDHISEFTIFTGITLLLAIGCSVFVL 200

Query: 202 GERFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGA 261
            ++F   E+RP RA+ F  FG S ++P+ AGFL +G +    R+ L ++ LE +FYI GA
Sbjct: 201 TDKFNTTEYRPIRASFFTLFGFSGIIPLGAGFLKFGAEGVLQRISLPFIGLEALFYISGA 260

Query: 262 LLYGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTR 312
           ++YG RFPE + PG FD +G SHQ+FHI+VV+ ++CHL  ++ SY ++H+ 
Sbjct: 261 IIYGFRFPETIAPGKFDFFGSSHQIFHIMVVLGSICHLFAMVESYHLIHSN 311

>Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  254 bits (649), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 123/292 (42%), Positives = 187/292 (64%), Gaps = 4/292 (1%)

Query: 25  KDGAKSSYSYIKRGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVN 84
           K  A SS +  ++   L  ++ LP+WQKDN+ IL+GYV+ET S K CL+SL + +NE+VN
Sbjct: 24  KVEAVSSTTVSEKKKLLHNFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNETVN 83

Query: 85  IFSHLVPA---FCFMTTIIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLK 141
           I++HLVPA   F F  T+  + +++  +P+T+  DY ++++FL GAF+CLM SS FHC+K
Sbjct: 84  IYTHLVPAVIYFVFAITLT-NYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMK 142

Query: 142 AHSPYVSSFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSL 201
            HS   S+F +KLDY               Y+G++D+   +  F+ +T      C V  L
Sbjct: 143 QHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTVCVL 202

Query: 202 GERFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGA 261
            E+F    +RP+RA  F+ FG S LLP+  GF  +G+Q    R+++ +V  E +FYI GA
Sbjct: 203 HEKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGA 262

Query: 262 LLYGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRL 313
           ++YG R PE L PG FD  G SHQ+FHI+VV+ ++CHL+ ++GSY ++H+ +
Sbjct: 263 VIYGFRIPETLAPGKFDFLGSSHQIFHIMVVLGSICHLKAIIGSYKLMHSHI 314

>TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90
           YOL101C
          Length = 316

 Score =  253 bits (646), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 124/294 (42%), Positives = 181/294 (61%), Gaps = 3/294 (1%)

Query: 24  EKDGAKSSYSYIKRGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESV 83
           E   A+ S   I  G +L  +  LP+WQ+DN+ IL+GYV+ET S+  CL SL + +NESV
Sbjct: 16  ETQKARDSKDGIM-GKKLYHFNELPEWQQDNDKILTGYVRETKSVLRCLDSLSYWNNESV 74

Query: 84  NIFSHLVPAFCFMTTIIF--DKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLK 141
           NI++HL+ A  +   ++F  D  ++  +P+TT+ DY++++ +L GAF CLM SS FHC K
Sbjct: 75  NIYTHLLSAVAYFVLLLFFTDILLIPSFPSTTMTDYIIINFYLLGAFVCLMCSSCFHCFK 134

Query: 142 AHSPYVSSFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSL 201
            HS   S   +K+DY               YYG++D+ F +  FS IT    ++C+V  L
Sbjct: 135 QHSNSQSDAWSKVDYMGIIGLISCSVISLLYYGYFDHVFYFKLFSVITVVLAMACSVCVL 194

Query: 202 GERFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGA 261
            +RF   + RP RA+ F+ F  S+++PI  G   +G  E   RVQL++V  E  FY+ GA
Sbjct: 195 SDRFNTSDMRPLRASFFITFAFSSVIPIATGMFKFGWTEVFHRVQLRFVGWEAFFYLSGA 254

Query: 262 LLYGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLSS 315
           LLYG R PE + PG FD  G SHQLFH+LVV+ + CHLR ++GSY  +H  +++
Sbjct: 255 LLYGYRIPETIAPGKFDFIGSSHQLFHVLVVLGSFCHLRAVMGSYMFMHAHINA 308

>ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 318

 Score =  252 bits (644), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 121/296 (40%), Positives = 180/296 (60%), Gaps = 2/296 (0%)

Query: 23  VEKDGAKSSYSYIKRGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNES 82
           +     +  Y  +     L  +  LP+WQ+DN+ IL+GY++ET S+  C+ SL   +NE+
Sbjct: 14  IGNGNGEGLYKEVLEEKTLYDFHELPEWQQDNDKILTGYIRETKSVLKCVRSLFIWNNET 73

Query: 83  VNIFSHLVPAFCFMTTI--IFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCL 140
           VNI++HLV A  +   +  I D  +V  +PT+T  DY +++ +L GAF CLM SS FH  
Sbjct: 74  VNIYTHLVSAVSYFLLMLGITDLVMVPHFPTSTFTDYSVINFYLLGAFGCLMCSSCFHTF 133

Query: 141 KAHSPYVSSFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVS 200
           K HS   S   +K+DY               YYGF+D+   +  F+ +T T   +C V  
Sbjct: 134 KQHSGPHSDAWSKVDYMGIIVLITCSMISLIYYGFFDHMEYFRLFTVLTLTLATACTVCV 193

Query: 201 LGERFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFG 260
           L ++F  +++RP RA  F+AFGLS + P+ AG + +G+Q    RVQLK++ LE +FYI G
Sbjct: 194 LSDKFNHKDFRPLRAGFFIAFGLSGVFPVAAGIIKFGIQGGVQRVQLKYLGLEAIFYIAG 253

Query: 261 ALLYGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLSSL 316
           AL+YG R PE + PG FD WGHSHQ+FH+LVV+A+  HL+ ++GSY   H+ L+ +
Sbjct: 254 ALIYGFRIPETMFPGRFDFWGHSHQIFHVLVVIASFLHLKAVMGSYIFKHSHLNGV 309

>AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR492W (IZH1) and
           YOL101C (IZH4)
          Length = 317

 Score =  250 bits (639), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 125/278 (44%), Positives = 171/278 (61%), Gaps = 2/278 (0%)

Query: 36  KRGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCF 95
           KR  +L T++ LP WQKDNE ILSGYV+ETNS+K CL ++ + +NES+NI++HL+P   +
Sbjct: 29  KRIRKLYTFDELPAWQKDNELILSGYVRETNSVKECLRAMTYFNNESINIYTHLIPGVAY 88

Query: 96  MTT--IIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNK 153
           +    I  D  + +  P     ++ ML  +L GAFTCL  SS FHCLK HS   S   +K
Sbjct: 89  LVLFLIFADLVLAQLLPGLDAGEHRMLRFYLLGAFTCLACSSCFHCLKQHSEPHSRLWSK 148

Query: 154 LDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPY 213
           +DY               YYG++     +  FS +T     +CAV+ L + F    +RP 
Sbjct: 149 VDYLGILAQITCSTISLLYYGYHSYPSHFVFFSTLTVALCSACAVLVLNDSFNTVAFRPL 208

Query: 214 RAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLK 273
           RA +F+AFGLS ++P+ AG   +G  E   R+QLK+V+ E VFYI GAL+YG R PER  
Sbjct: 209 RAFLFMAFGLSGVIPVLAGSYQFGFAEWAARIQLKYVLYEAVFYITGALVYGFRIPERFA 268

Query: 274 PGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHT 311
           PG FD+ GHSHQ+FH+LVV+  LCH R + GSY  + T
Sbjct: 269 PGKFDMVGHSHQIFHLLVVLGTLCHFRAVTGSYIFICT 306

>Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  250 bits (639), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 122/292 (41%), Positives = 184/292 (63%), Gaps = 4/292 (1%)

Query: 25  KDGAKSSYSYIKRGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVN 84
           K  A  S +  ++   L  ++ LP+WQKDN+ IL+GYV+ET S K CL SL + +NE+VN
Sbjct: 24  KVEAVQSKTASEKEKLLHNFDELPEWQKDNDKILTGYVRETLSWKKCLRSLFYWNNETVN 83

Query: 85  IFSHLVPA---FCFMTTIIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLK 141
           I++HLVPA   F F  T+  + +++  +P+T+  DY ++++FL GAF+CLM SS FHCLK
Sbjct: 84  IYTHLVPAIIYFLFAITLT-NYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCLK 142

Query: 142 AHSPYVSSFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSL 201
            HS   S+F +KLDY               Y+G++D+   +  F+ +T      C V  L
Sbjct: 143 QHSEEQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHVSYFSLFTTVTLVLATFCTVCVL 202

Query: 202 GERFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGA 261
            E+F    +RP+RA  F+ FG S LLP+  GF  +G+Q    R+++ +V  E +FYI GA
Sbjct: 203 HEKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGA 262

Query: 262 LLYGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRL 313
           ++YG R PE + PG FD  G SHQ+FHI+VV+ +LCHL+ ++ SY ++H+ +
Sbjct: 263 VIYGFRIPETIAPGKFDFLGSSHQIFHIMVVLGSLCHLKAIIDSYKLMHSHI 314

>YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membrane
           protein involved in zinc ion homeostasis, member of the
           four-protein IZH family; transcription is regulated
           directly by Zap1p, expression induced by zinc deficiency
           and fatty acids; deletion increases sensitivity to
           elevated zinc
          Length = 316

 Score =  249 bits (637), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 120/292 (41%), Positives = 186/292 (63%), Gaps = 4/292 (1%)

Query: 25  KDGAKSSYSYIKRGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVN 84
           K  A S  +  ++   L  ++ LP+WQKDN+ IL+GYV+ET S K CL+SL + +NE+VN
Sbjct: 24  KVEAVSGQTVFEKQKLLHNFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNETVN 83

Query: 85  IFSHLVPA---FCFMTTIIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLK 141
           I++HLVPA   F F  T+  + +++  +P+T+  DY ++++FL GAF+CLM SS FHC+K
Sbjct: 84  IYTHLVPAIVYFVFAITLT-NYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMK 142

Query: 142 AHSPYVSSFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSL 201
            HS   S+F +KLDY               Y+G++D+   +  F+ +T      C V  L
Sbjct: 143 QHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTVCVL 202

Query: 202 GERFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGA 261
            ++F    +RP+RA  F+ FG S LLP+  GF  +G+Q    R+++ +V  E +FYI GA
Sbjct: 203 HDKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGA 262

Query: 262 LLYGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRL 313
           ++YG R PE L PG FD +G SHQ+FHI+VV+ ++CHL+ ++ SY ++H+ +
Sbjct: 263 VIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKAIIDSYKLMHSHI 314

>Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W
           (REAL)
          Length = 315

 Score =  247 bits (631), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 121/294 (41%), Positives = 183/294 (62%), Gaps = 4/294 (1%)

Query: 25  KDGAKSSYSYIKRGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVN 84
           K  A  S   +++   L  +  LPDWQ+DN+ IL+GYV+ET S K CL+SL + +NE+VN
Sbjct: 23  KVEALKSKVTLRKEKLLHDFHELPDWQRDNDKILTGYVRETLSWKKCLYSLFYWNNETVN 82

Query: 85  IFSHLVPA---FCFMTTIIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLK 141
           I++HLVPA   F F  T+  + +++  +P+TT  DY ++++FL GAF CLM SS FHC+K
Sbjct: 83  IYTHLVPAIVYFVFGVTLT-NYFLIPVFPSTTWSDYTVINIFLMGAFLCLMCSSCFHCMK 141

Query: 142 AHSPYVSSFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSL 201
            HS   S F +KLDY               Y+G++D++  +  F+ +T      C +  L
Sbjct: 142 QHSEKQSDFWSKLDYLGIISLISCSMIPIIYFGYFDHASYFSLFTIVTLVLATFCTICVL 201

Query: 202 GERFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGA 261
            ++F    +RP+RA  F+ FG S LLP+  G   +G+Q    R+++ +V  E +FYI GA
Sbjct: 202 HDKFNTSTFRPFRAMFFILFGFSGLLPLTTGLFKFGLQGVLNRIRVSFVFWEALFYISGA 261

Query: 262 LLYGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLSS 315
           L+YG R PE L PG FD +G SHQ+FHI+VV+ ++CHL+ ++ SY ++H+   S
Sbjct: 262 LIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKAIIDSYKLMHSHFHS 315

>TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON}
           Anc_3.90 YOL101C
          Length = 326

 Score =  246 bits (628), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 129/277 (46%), Positives = 172/277 (62%), Gaps = 5/277 (1%)

Query: 41  LVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMTTII 100
           L T+E LP WQ+DNE IL+GY++ETNS K CL SL F HNE++NI+SH + A  ++  ++
Sbjct: 43  LYTYEELPSWQQDNEMILTGYIRETNSWKLCLRSLTFFHNETINIYSHGISAAIYLLLLV 102

Query: 101 F---DKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDYX 157
           F   +   +  +PTTTL DYL+LD++L GA TCL +SS FHCLK HS   S   +K+DY 
Sbjct: 103 FFFTNLIYLPSFPTTTLHDYLVLDIYLLGAATCLTLSSCFHCLKQHSQSQSDIWSKMDYI 162

Query: 158 XXXXXXXXXXXXXXYYGFYDNSFLYFTFSAI-TFTFGLSCAVVSLGERFRAREWRPYRAA 216
                         Y+G+ D+ F YF F AI TF   ++C V    E+F  R+W+  RA 
Sbjct: 163 GIICLITCSTISLLYFGYRDH-FNYFKFFAISTFILAITCTVFVTMEKFNTRDWKHVRAL 221

Query: 217 MFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGM 276
            F+AF  S L+P+  G   +G  E   RVQL  + LE + Y+ GALLYG R PE   PG 
Sbjct: 222 FFIAFAGSGLIPLITGINIFGFPEVWQRVQLPSLTLELICYVIGALLYGYRIPEVFAPGK 281

Query: 277 FDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRL 313
           FD  G+SHQ FHI VV+ +L HLR L+GSY  +H+ L
Sbjct: 282 FDNIGNSHQWFHIFVVLGSLLHLRALVGSYYFMHSFL 318

>Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR337W
          Length = 305

 Score =  245 bits (625), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 121/274 (44%), Positives = 171/274 (62%), Gaps = 2/274 (0%)

Query: 40  QLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCF--MT 97
           +L +++ LP+WQKDNE I  GYV+ETNS   CL S+ + +NESVNI++HLVP+  +  + 
Sbjct: 21  RLYSFDELPEWQKDNELIRMGYVRETNSFLECLKSMTYFNNESVNIYTHLVPSVTYFILL 80

Query: 98  TIIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDYX 157
            +  D  V   +P TT+++Y+M+D +LFG F CLM S+ FHCLK HS   +   +K+DY 
Sbjct: 81  LLFVDLVVTPMFPGTTMREYIMIDFYLFGVFVCLMCSTCFHCLKQHSESHNRIWSKVDYI 140

Query: 158 XXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAM 217
                         YYGFYD+       S +T T G+ C    L +RF A ++R  RA  
Sbjct: 141 GIIVQITSSIVSILYYGFYDHISHIKWLSVLTLTLGVCCVTFVLNDRFNAIDYRLLRAIF 200

Query: 218 FVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGMF 277
           F  FG S ++P+  G   +G+ E   R+QLK+V+   +FYIFGAL+YG R PE L PG F
Sbjct: 201 FTVFGFSGVVPVLIGIYQFGLIEWLARIQLKFVLAGTIFYIFGALIYGFRIPEALAPGKF 260

Query: 278 DIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHT 311
           D  GHSHQ+FH+LVV+ ++CH R ++GSY  + T
Sbjct: 261 DFIGHSHQIFHLLVVLGSICHFRAVIGSYVFMRT 294

>KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3.90
           YOL101C
          Length = 319

 Score =  237 bits (605), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 115/299 (38%), Positives = 181/299 (60%), Gaps = 8/299 (2%)

Query: 23  VEKDGAKSSYSYIKRGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNES 82
           + +  + SS    KR   L  +  LP WQ+DN+ IL GYV+ETNS   C+ SL +++NES
Sbjct: 23  ITRTRSDSSIKIEKR--ILYHFHELPTWQQDNDKILGGYVRETNSFTKCIESLFYLNNES 80

Query: 83  VNIFSHLVPAFCFMTTIIF-----DKYV-VERYPTTTLKDYLMLDLFLFGAFTCLMMSSA 136
           +NI+SHL+P+  ++T  +      D+++ +  YPTTT  D++ +++FL GAF CL+ S  
Sbjct: 81  INIYSHLIPSLIYLTIAVMLLIEIDQFLNIPIYPTTTKYDFIFINIFLVGAFLCLLGSGC 140

Query: 137 FHCLKAHSPYVSSFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSC 196
           FH LK HS    +F +++DY               YYGF+D+  L++ F  +T  F   C
Sbjct: 141 FHLLKQHSELQCNFWSRIDYMGIIVLISCSMMPVLYYGFFDHIVLFYCFITLTLAFASVC 200

Query: 197 AVVSLGERFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVF 256
           +++ + E F   ++R  RA +F AFG S L+P+  GF  +G+     R+ LK++  E VF
Sbjct: 201 SIIVMSETFNLSKYRLLRACVFAAFGFSGLIPMIVGFSKFGLSGVFQRISLKFIFWESVF 260

Query: 257 YIFGALLYGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLSS 315
           Y+ GA LYG R PE + PG FD++G SHQLFH  VV+ ++ H + ++ SY ++H+R ++
Sbjct: 261 YLVGATLYGFRIPESILPGKFDLFGSSHQLFHCFVVIGSVLHFKAVIESYILMHSRYTA 319

>KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.90
           YOL101C
          Length = 323

 Score =  230 bits (587), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 122/291 (41%), Positives = 183/291 (62%), Gaps = 4/291 (1%)

Query: 27  GAKSSYSYIKRGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIF 86
           G  S     +RG +L  +E LP WQ+DN+ I +GYV+ET S++ CL SLL+ +NESVN++
Sbjct: 34  GTSSGAPSGQRG-RLCRYEELPAWQQDNDCIRTGYVRETLSVRRCLGSLLYWNNESVNMY 92

Query: 87  SHLVPAFCFMT--TIIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHS 144
           SHLVPA  ++   T+   ++ V R+PTTT  DYL+++ FL GA  CL+ SS FHCLK HS
Sbjct: 93  SHLVPAVLYIAGATLALSQWGVPRFPTTTWSDYLIINTFLVGAGACLLCSSLFHCLKQHS 152

Query: 145 PYVSSFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCA-VVSLGE 203
                  +++DY               Y+G++D       F+A+T   G++C+ VV   +
Sbjct: 153 ERHCEAWSRMDYMGIILLIACSTIPMIYFGYFDYMGHCLLFTAVTVALGVACSGVVLFNK 212

Query: 204 RFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALL 263
           +F +  ++  RAA F+AF  + L+P+  GF+ +G+     R+ LK+V  E VFYI GA+L
Sbjct: 213 QFNSSSFKLVRAAFFIAFAFNGLIPMATGFVKFGIPGVLDRISLKYVWFEAVFYIAGAML 272

Query: 264 YGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLS 314
           YG R PE   PG  D+WG+SHQ+FH++VV  +LCHL+ +L SY+++H  L+
Sbjct: 273 YGFRVPEIWIPGKVDLWGNSHQMFHVMVVFGSLCHLKAVLESYSLMHRHLA 323

>NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {ON}
           Anc_3.90
          Length = 326

 Score =  150 bits (380), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 98/297 (32%), Positives = 159/297 (53%), Gaps = 11/297 (3%)

Query: 26  DGAKSSYSYIKRGVQLVTWEHLPDWQKD--NEHILSGYVKETNSIKACLHSLLFIHNESV 83
           +  K S ++ +R   L   + LP WQK   N  I++GYV+ETNS+  CLH++ + +N++V
Sbjct: 26  NAPKYSVTFPRRPKVLPILKELPQWQKQYSNSKIINGYVRETNSLIKCLHTVTYWNNQTV 85

Query: 84  NIFSHLVPAFCFMTTIIF--DKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLK 141
           NI  + V +  + T ++F  D Y++   P TT+ DY+M++ +LFGAF    ++S F+ L+
Sbjct: 86  NIILNTVFSTVYFTLLLFFTDLYLIPSSPATTMSDYIMVNFYLFGAFQYFALNSIFYLLE 145

Query: 142 AHSPYVSSFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSC--AVV 199
           +HS        KL +               YY F+DN F YF F  I+ T  +S   A+ 
Sbjct: 146 SHSLAKCHLWFKLSHLAFINYISTSIITQLYYTFFDNVF-YFKFLTIS-TLLISSIFAIF 203

Query: 200 SLGERFRAREWRPYRAAMFVAFGLSAL-LPIFAGFLYYGVQETTIRVQLKWVVLEGVFYI 258
           +L E+F  R+ R  R  + + F +S L LP  +    +       RV+ K ++LE   Y+
Sbjct: 204 TLSEQF-LRKNRSQRNMVSITFIVSLLILPTASLMFKFNTFRILRRVEGKAILLELSLYL 262

Query: 259 FGALLYGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLSS 315
           F   L  V+ PER     FD  G+S  ++HI +++ +L H + LL SY  +H+ L +
Sbjct: 263 FSMTLKAVQVPERFSEN-FDFIGNSENIYHICIILGSLLHFKMLLNSYFFMHSGLDA 318

>TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}
          Length = 296

 Score =  147 bits (372), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 87/288 (30%), Positives = 136/288 (47%), Gaps = 28/288 (9%)

Query: 36  KRGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCF 95
           K  +QL  +  LPDWQKDN  I++ YV+ETNS+   L S+   H+ES+NIF+HL+PA   
Sbjct: 3   KHSLQLCNFNDLPDWQKDNPLIVNYYVRETNSLFKSLCSIFLFHSESMNIFTHLIPA--- 59

Query: 96  MTTIIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLD 155
              +++ K+      T     Y ++  +L     C ++SS FH  K  S   + F  KLD
Sbjct: 60  ---LLYAKFTYNAITTLEQVSYPIV-FYLISVIICFLLSSLFHLFKCTSVQSNEFWGKLD 115

Query: 156 YXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREW----- 210
           Y                 GF ++ +     + +T T  L+  V+ L  +   ++      
Sbjct: 116 YVGISLLINATIVSMALLGFNESRYTIMKNTFVTQTSCLTAYVIILAIKSHPKQGENEDD 175

Query: 211 ----------------RPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEG 254
                           +  RA +F + GLS L+P+  G   YG +    ++ +  V+   
Sbjct: 176 NDGTLSEDDDCCCDDHKGTRAKLFASLGLSGLIPVITGLYIYGPKVVYYKINIPMVIASV 235

Query: 255 VFYIFGALLYGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGL 302
           + YI G L+Y  + PE+  PG FD+ G SHQLFHI +V   +CH   +
Sbjct: 236 LCYIVGTLIYVFKIPEKFYPGRFDLVGSSHQLFHIFIVFGTVCHYHAI 283

>NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90
          Length = 318

 Score =  122 bits (305), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 73/273 (26%), Positives = 140/273 (51%), Gaps = 9/273 (3%)

Query: 45  EHLPDWQK--DNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMTTIIF- 101
           + LP+WQ+  ++  +++G++KETNS K CL S ++ HN S+NI  + + A  +   + F 
Sbjct: 37  KELPEWQREFNSGKVITGFLKETNSFKKCLWSTMYWHNSSINISLNGIAATVYFMLLFFF 96

Query: 102 -DKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDYXXXX 160
            D Y++  +P+TT+ DY++L+L+L  A    M+ + F+ +K+HS   +    KL+     
Sbjct: 97  TDCYLIPSFPSTTMSDYIVLNLYLLTATQNFMVGTIFYIMKSHSKQQAFLWYKLNNIGLI 156

Query: 161 XXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFG--LSCAVVSLGERFRAREWRPYRAAMF 218
                      YY ++D  F +  F+ +T       +C+++S       R  + +    +
Sbjct: 157 NHIASSVVTLLYYHYFDYVFYFKFFTIVTLLLITLFTCSIISDSFNKMTRIRKNFLLLAY 216

Query: 219 VAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGMFD 278
           +   L  L+P     L +G+ +   R+ L  ++LE   Y FG  +   + PER     FD
Sbjct: 217 II--LLTLMPSLFAILRFGLAKVLERISLNLIILEIFIYAFGLTIRTSQLPERFFNS-FD 273

Query: 279 IWGHSHQLFHILVVVAALCHLRGLLGSYTIVHT 311
             G+S  ++ + ++V +  H + L+ SY ++H+
Sbjct: 274 FLGNSENVYQLSIIVCSFIHFKILMNSYCLMHS 306

>CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {ON}
           similar to uniprot|Q03419 Saccharomyces cerevisiae
           YDR492w
          Length = 301

 Score = 97.4 bits (241), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 79/294 (26%), Positives = 138/294 (46%), Gaps = 20/294 (6%)

Query: 36  KRGVQ--LVTWEHLPDWQK--DNEHILSGYVKETNSI-KACLHSLLFIHNESVNIFSHLV 90
           K+ VQ  +VT E LP W +   N  I +GY   TN+    CL  L+  +N+S++I+ +LV
Sbjct: 3   KKTVQSKIVTLEKLPVWYRRYGNSRIKTGYFYYTNATYLGCLQKLVKFNNDSISIYMNLV 62

Query: 91  PAFCFMTTIIF--DKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVS 148
                   ++F  D  ++  +P+TT+ DY++++LFL    T     +    LK HS Y  
Sbjct: 63  CGLISGVMLLFYTDVRLIPSHPSTTMTDYIIINLFLMATTTYFATMTLGQLLKGHSEYQG 122

Query: 149 SFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAR 208
              N+                  YY F+D+ FL+  F   T       ++V + ++++  
Sbjct: 123 KLWNQAKQLALVLLLTCSIVTLLYYAFFDHVFLFKLFVIWTCLLMSITSIVIINDQYK-- 180

Query: 209 EWRPYRAAMFVAFG-LSALLPIFAGFLYYGVQETTIRVQLKWVVL--EGVFYIFGALLYG 265
             R  + +  V FG LS  LPI    + +G+ ++  + ++ + VL  E V Y   A+L  
Sbjct: 181 --RVQKLSCVVIFGVLSISLPIAVSIIKFGLFDSYKKQRIPFQVLTWEIVLYSLSAMLQL 238

Query: 266 VRFPERLKPGMFD-IW-----GHSHQLFHILVVVAALCHLRGLLGSYTIVHTRL 313
            R PE     + D  W     G+S Q+  ++ + A + H   ++ +Y +VH  +
Sbjct: 239 TRLPELTLSTLGDSFWIVDYLGNSDQVSQLVTIFAIIVHFNTIIFAYEVVHASI 292

>Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 72.0 bits (175), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 106/232 (45%), Gaps = 10/232 (4%)

Query: 90  VPAFCFMTTIIF-DKYVVERYPTTT-LKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYV 147
           + +FC +  I F D Y++  +PTTT + DY++ + +L   F   M+   +H +K  S   
Sbjct: 75  MSSFCLL--IFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMIHFIYHFIKNISLQQ 132

Query: 148 S-SFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFR 206
                 K  Y               YY FYD  F +  F+ +    GL+   V L ++  
Sbjct: 133 HIEIWQKFSYLANINLLISSQITILYYLFYDYVFFFKIFTLLMTFIGLAAYFVILTDKLN 192

Query: 207 AREWRPYRAAMFVAFGLSAL-LPIFAGFLYY-GVQETTIRVQLKWVVLEGVFYIFGALLY 264
           + + R  +   F++  +    LP+    + + G++    R++L  +  E V  +  +++Y
Sbjct: 193 SYK-RFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKDRIKLNAITWELVTLVVASMIY 251

Query: 265 GVRFPERL--KPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLS 314
             RFPE L  +    + W HS   FH+L+   A  H   L+ SY ++H+ L+
Sbjct: 252 VTRFPESLCRRNEKEEGWNHSEYFFHLLISGTAFYHFFILIQSYILMHSSLN 303

>Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 70.9 bits (172), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 110/243 (45%), Gaps = 9/243 (3%)

Query: 80  NESVNIFSHLVPAFCFMTTIIF--DKYVVERYPTTT-LKDYLMLDLFLFGAFTCLMMSSA 136
           NES+    +L+ +      +IF  D Y++  +PTTT + DY++ + +L   F   M+   
Sbjct: 62  NESLVALIYLLGSMSSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFV 121

Query: 137 FHCLKAHSPYVS-SFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLS 195
           +H +K  S         K  Y               YY FYD  F +  F+ +    GL 
Sbjct: 122 YHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLV 181

Query: 196 CAVVSLGERFRAREWRPYRAAMFVAFGLSAL-LPIFAGFLYY-GVQETTIRVQLKWVVLE 253
                L ++  + + R  +   F++  +    LP+    + + G++    R+++K +  E
Sbjct: 182 AYFFILTDKLNSSK-RFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKERIKVKAITCE 240

Query: 254 GVFYIFGALLYGVRFPERL--KPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHT 311
            V  +  +++Y  RFPE L  +    + W HS  LFH+++   A  H   L+ SY ++H+
Sbjct: 241 LVALVAASIIYVTRFPESLFRRNKKEESWNHSEYLFHLVISGTAFYHFFILIQSYILMHS 300

Query: 312 RLS 314
            L+
Sbjct: 301 SLN 303

>Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 68.2 bits (165), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/243 (25%), Positives = 109/243 (44%), Gaps = 9/243 (3%)

Query: 80  NESVNIFSHLVPAFCFMTTIIF--DKYVVERYPTTT-LKDYLMLDLFLFGAFTCLMMSSA 136
           NESV    +L+ +      +IF  D Y++  +PTTT + DY++ + +L   F   M+   
Sbjct: 62  NESVVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFI 121

Query: 137 FHCLKAHSPYVS-SFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLS 195
           +H +K  S         K  Y               YY FYD  F +  F+ +    GL 
Sbjct: 122 YHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLV 181

Query: 196 CAVVSLGERFRAREWRPYRAAMFVAFG-LSALLPIFAGFLYY-GVQETTIRVQLKWVVLE 253
                L ++  + + R  +   F++   +   LP+    + + G++    R+++  +  E
Sbjct: 182 AYFFILTDKLISSK-RFNKTVFFISVSVICCSLPLLTAIITFDGLENLKERIKVNAITWE 240

Query: 254 GVFYIFGALLYGVRFPERLKPGMF--DIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHT 311
            V  +  +++Y  RFPE    G    + W HS  LFH+++  AA  H   L+ SY ++H+
Sbjct: 241 LVALVAASIIYVTRFPELFLRGKKKEEGWNHSEYLFHLIISGAAFYHFFILIQSYILMHS 300

Query: 312 RLS 314
            L+
Sbjct: 301 SLN 303

>YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}
           IZH4Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by fatty acids and altered zinc levels; deletion
           reduces sensitivity to excess zinc; possible role in
           sterol metabolism
          Length = 312

 Score = 67.0 bits (162), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 109/243 (44%), Gaps = 9/243 (3%)

Query: 80  NESVNIFSHLVPAFCFMTTIIF--DKYVVERYPTTT-LKDYLMLDLFLFGAFTCLMMSSA 136
           NES+    +L+ +      +IF  D Y++  +PTTT + DY++ + +L   F   M+   
Sbjct: 62  NESLVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFI 121

Query: 137 FHCLKAHSPYVS-SFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLS 195
           +H +K  S         K  Y               YY FYD  F +  F+ +    GL 
Sbjct: 122 YHFVKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLV 181

Query: 196 CAVVSLGERFRAREWRPYRAAMFVAFGLSAL-LPIFAGFLYY-GVQETTIRVQLKWVVLE 253
                L ++  + + R  +   F++  +    LP+    + + G++    R+++  +  E
Sbjct: 182 AYFFILTDKLISSK-RFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKERIKVNAITWE 240

Query: 254 GVFYIFGALLYGVRFPERL--KPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHT 311
            V  +  +++Y  RFPE L  +    + W HS  LFH+L+   A  H   L+ SY ++H+
Sbjct: 241 LVALVAASIIYVTRFPESLFRRNKKEEGWNHSEYLFHLLISGTAFYHFFILIQSYILMHS 300

Query: 312 RLS 314
            L+
Sbjct: 301 SLN 303

>KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5.197
           YLR023C
          Length = 509

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 69/263 (26%), Positives = 108/263 (41%), Gaps = 45/263 (17%)

Query: 37  RGVQLVTWEHLPDWQ-----KDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVP 91
           R  +L   EHL  +Q     ++N +I++ Y +  +S K  L S+  +HNE+ NI+SHL+ 
Sbjct: 183 RAYELGKSEHLHYYQLPFPYRENRYIINNY-RFYDSHKKSLLSIFKLHNEATNIWSHLLG 241

Query: 92  AFCFM--------TTIIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAH 143
           A  F+         +II    +V   PTT     L L LF+F +  C++ S+ +H     
Sbjct: 242 AIYFLYVLFHDLPNSIIVSSSMV---PTTA---KLFLYLFVFASLKCMLSSTFYHTFNGT 295

Query: 144 SPYVSSFGNK---LDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVS 200
           S  +     K   +DY               +   YD   +   +   +F  G+    ++
Sbjct: 296 S--MLKLRRKFMCVDYSGISILITSSILSIQFISLYDYPNILKFYMCASFMLGVLGIFMN 353

Query: 201 LGERFRAREWRPYRAAMFV------AFGLSALL----PIFAGFLYYGVQETTIRVQLKWV 250
               F + E RP R   F+      AF L  L+     IFA           I V L   
Sbjct: 354 WSPLFDSPEARPLRIKFFILLSSCGAFALLHLVFLEKSIFAA----------IDVLLPLT 403

Query: 251 VLEGVFYIFGALLYGVRFPERLK 273
               V+Y+ G + YG   PER +
Sbjct: 404 NKSIVWYLVGVVFYGSFIPERFR 426

>KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some
           similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 622

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 66/303 (21%), Positives = 119/303 (39%), Gaps = 35/303 (11%)

Query: 35  IKRGVQLVTWEH--------------LPDWQKDNEHILSGYVKETNSIKACLHSLLFI-- 78
           IK+ +Q   W++              LP   ++N +I+ GY    + +K+ L  + +   
Sbjct: 278 IKKTIQFYNWDNACDLGRQRHLHFYELPFPWRENRYIIHGYRFYDSHVKSVLSVVNWYGW 337

Query: 79  HNESVNIFSHLVPA--FCFMTTIIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSA 136
           HNE++NI+SHL  A    ++  I      V       L   L++ +FL     CL+ SS 
Sbjct: 338 HNETLNIWSHLFGAVYLAYLLFIQLPTTKVFMSQDVPLFGKLIIQVFLIAGVKCLLSSSV 397

Query: 137 FHCLKAHS--PYVSSFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFS-----AIT 189
           +H L      P    F   +DY               +   Y+ +    + S     +++
Sbjct: 398 WHTLNGTCCLPLRCKFAC-IDYTGITVLITASILSTEFVSVYNLATQSLSTSMTVYMSLS 456

Query: 190 FTFGLSCAVVSLGERFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKW 249
              G+  + ++   RF   E RP+R A +V      ++      +  G+  ++   +  W
Sbjct: 457 LCLGIFGSFMNWSPRFDRPESRPFRIAFYVLLAGLGMISFLHLTISRGIDHSSQFFKPVW 516

Query: 250 VVLEGVFYIFGALLYGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIV 309
                ++Y+ G + YG   PER        W    +L + +   A LC    +L  +  V
Sbjct: 517 -NRSLIWYLIGVVFYGSFIPER--------WRTDVELDYTIPTDAELCSNLDILTKHKHV 567

Query: 310 HTR 312
           H R
Sbjct: 568 HFR 570

>Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 95/238 (39%), Gaps = 16/238 (6%)

Query: 46  HLPDWQKDNEHILSGYVKETNSIKACLHSLLFI--HNESVNIFSHLVPAFCFMTTIIFD- 102
            LP   ++N +I+ GY       K+ L  + +   HNE+ NI+SHL+ A   +   I+D 
Sbjct: 219 QLPFPWRENRYIIHGYRFYNTHSKSLLSIINWYGWHNETSNIWSHLLGAMYIIYLAIYDF 278

Query: 103 -KYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHS--PYVSSFGNKLDYXXX 159
            +  V R P    +   ++ +FL  A  C++ S  +H     S     S F   +DY   
Sbjct: 279 PQSEVWRNPNVPQQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLRLRSKFAC-VDYSGI 337

Query: 160 XXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAMFV 219
                       +   Y   +   T+  I+   G+    ++   RF   E RP R   F+
Sbjct: 338 TILITASILTTEFVTMYSCYWAMCTYMGISLALGVIGVFMNWSPRFDRPEARPLRIRFFI 397

Query: 220 AFG----LSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLK 273
                  LS L  IF   +YY       R+         V+Y+ G + YG   PER +
Sbjct: 398 LLATMGVLSFLHLIFLTDIYYAS-----RLFGPVTYKSVVWYLVGVVFYGSFIPERFR 450

>Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON}
           (229517..231250) [1734 nt, 578 aa]
          Length = 577

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 55/248 (22%), Positives = 99/248 (39%), Gaps = 36/248 (14%)

Query: 46  HLPDWQKDNEHILSGY--VKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMTTIIFD- 102
            LP   ++N +I++GY    + + +   + +    HNE+ NI+SHL+ A  F   ++F+ 
Sbjct: 255 QLPFPWRENRYIINGYRFYHKNSKLLLSVFNWYGFHNETANIWSHLLGAIYFAYIVLFEF 314

Query: 103 -KYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFH------CLKAHSPYVSSFGNKLD 155
            K  + + P        ++ LFL     C++ S  +H       +K    Y       +D
Sbjct: 315 PKSFIVQSPEVPPSAKYIVYLFLLAGIKCMLASVFWHTFNGTCSIKLRPKYCC-----VD 369

Query: 156 YXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRA 215
           Y               +   YD+  +   + +++  FG     ++   +F + E RP R 
Sbjct: 370 YSGITILITASILTAEFVSLYDHRSIMTVYMSLSLLFGCFGLYLNWSPKFDSPEARPLRI 429

Query: 216 AMFV---AFGLSALLPI-------FAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYG 265
             F+   A G  A   +       +A +LY  V   +I           V+Y+ G   YG
Sbjct: 430 KFFILLAALGGLAFFHVAYLEGMAYAAWLYSPVTSKSI-----------VWYLIGVFFYG 478

Query: 266 VRFPERLK 273
              PER +
Sbjct: 479 SFIPERFR 486

>NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197
          Length = 578

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 87/212 (41%), Gaps = 32/212 (15%)

Query: 79  HNESVNIFSHLVPAFCFMTTIIFD-----KYVVERYPTTTLKDYLMLDLFLFGAFTCLMM 133
           HNES NI++HL+ A   +   I+D      +  E+ PTT     L++ LFLF A  CL+ 
Sbjct: 289 HNESSNIWTHLLGAIYLIYLSIYDFPNSEIFQSEKVPTTA---KLIVYLFLFAAIKCLLA 345

Query: 134 SSAFHCLKAHS--PYVSSFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFT 191
           S  +H     S     S F   +DY               +   Y + F    +  I+ +
Sbjct: 346 SVFWHTFNGTSFLKLRSKFA-CVDYSGITILITASILTTEFVTMYSSFFAMCIYMTISLS 404

Query: 192 FGLSCAVVSLGERFRAREWRPYRAAMFV---AFGLSALLPI-------FAGFLYYGVQET 241
            G+    ++   +F   E RP R   F+   + G+ + L +       +A +L   V   
Sbjct: 405 LGMFGVFMNWSPKFDRPEARPLRIKFFILLASMGVLSFLHLTYLTNLQYATWLLTPVTNK 464

Query: 242 TIRVQLKWVVLEGVFYIFGALLYGVRFPERLK 273
           +I           V+Y+ G + YG   PER +
Sbjct: 465 SI-----------VWYLVGVVFYGSFIPERFR 485

>KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.197
           YLR023C
          Length = 538

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 71/330 (21%), Positives = 127/330 (38%), Gaps = 74/330 (22%)

Query: 40  QLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFI--HNESVNIFSHLVPAF--CF 95
           +L+ +  LP   ++N +I+  Y    +++K+ L ++ +   HNE+ NI+SH +  F   +
Sbjct: 215 KLLHYYELPFPWRENRYIIHNYRFYDSNVKSLLSAINWYGWHNETSNIWSHFLGFFYVVY 274

Query: 96  MTTIIFDKYVV---ERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHC------LKAHSPY 146
           +    F + VV   +R P++      ++ +FLF A  CL+ S+ +H       LK    +
Sbjct: 275 LAVYEFPQSVVFQSDRIPSSA---KFVVYIFLFAAMKCLIASAFWHTFNGTAFLKMRRRF 331

Query: 147 VSSFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFR 206
                  +DY               +    D+  +   +  I+ T G+    ++   +F 
Sbjct: 332 AC-----VDYSGISILITASILTAEFVTLNDHRPMMILYMTISLTLGIIGVFLNCSPQFD 386

Query: 207 AREWRPYRAAMFVAFGLSALLP-IFAGFLYYGVQETTIRVQLKWVVLEG--VFYIFGALL 263
             E RP R   F+      +L  I A +L    +     V L   +     V+Y+ G + 
Sbjct: 387 TPEARPLRIRFFMLLAAMGVLSFINASYL----ESWAYAVDLLSPITNKSIVWYLVGVVF 442

Query: 264 YGVRFPERL---------------------------------KP--------GMFDIW-- 280
           YG   PER                                  KP        G+F  W  
Sbjct: 443 YGSFIPERFRTDVVVDDRIPTTFQLGTDLDIITKDKEIHFRHKPTCCHHPRKGIFSCWWV 502

Query: 281 ---GHSHQLFHILVVVAALCHLRGLLGSYT 307
              G SH  +HI VV+  + H + ++  +T
Sbjct: 503 DYVGCSHTFWHIFVVLGVVGHYKAIIDMFT 532

>YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON}
           IZH3Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by zinc deficiency; deletion reduces sensitivity
           to elevated zinc and shortens lag phase, overexpression
           reduces Zap1p activity
          Length = 543

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 97/238 (40%), Gaps = 16/238 (6%)

Query: 46  HLPDWQKDNEHILSGYVKETNSIKACLHSLLFI--HNESVNIFSHLVPAFCFMTTIIFD- 102
            LP   ++N +I+ GY       K+ L    +   HNE+ NI+SHL+ A   +   I+D 
Sbjct: 220 QLPFPWRENRYIIHGYRFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAIYIIYLAIYDF 279

Query: 103 -KYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHS--PYVSSFGNKLDYXXX 159
            +  V R      +   ++ +FL  A  C++ S  +H     S     S F   +DY   
Sbjct: 280 PQSEVWRNSQVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFAC-VDYSGI 338

Query: 160 XXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAMFV 219
                       +   Y   +  +T+ +I+   G+    ++   RF   E RP R   F+
Sbjct: 339 TILITASILTTEFVTMYSCYWAMYTYMSISLALGVFGVFMNWSPRFDRPEARPLRIRFFI 398

Query: 220 AFG----LSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLK 273
                  LS L  IF   L+Y     +  V  K V    V+Y+ G + YG   PER +
Sbjct: 399 LLATMGVLSFLHLIFLTDLHYAATLFS-PVTYKSV----VWYLVGVVFYGSFIPERFR 451

>Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 95/238 (39%), Gaps = 16/238 (6%)

Query: 46  HLPDWQKDNEHILSGYVKETNSIKACLHSLLFI--HNESVNIFSHLVPAFCFMTTIIFD- 102
            LP   ++N +I+ GY       K+ L    +   HNE+ NI+SHL+ A   +   I+D 
Sbjct: 219 QLPFPWRENRYIIHGYRFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAMYLIYLAIYDF 278

Query: 103 -KYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHS--PYVSSFGNKLDYXXX 159
            +  V + P    +   ++ +FL  A  C++ S  +H     S     S F   +DY   
Sbjct: 279 PQSEVWKNPKVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFAC-VDYSGI 337

Query: 160 XXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAMFV 219
                       +   Y   +   T+  I+   G+    ++   RF   E RP R   F+
Sbjct: 338 TILITASILTTEFVTMYSCYWAMCTYMGISLALGIFGVFMNWSPRFDRPEARPLRIRFFI 397

Query: 220 AFG----LSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLK 273
                  LS L  IF   L Y  +  +  V  K V    V+Y+ G   YG   PER +
Sbjct: 398 LLATMGVLSFLHLIFLTDLRYAARLFS-PVTYKSV----VWYLVGVAFYGSFIPERFR 450

>KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {ON} 
          Length = 321

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 97/224 (43%), Gaps = 11/224 (4%)

Query: 90  VPAFCFMTTIIFDK-YVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVS 148
           V A  F+  + F   Y+V R+ +TT+ DY++L++FL  AF C    +A H ++    + +
Sbjct: 102 VTAVYFVLLVFFTDVYLVPRHVSTTMTDYVLLNVFLATAFQC----AACHMVQC---FTT 154

Query: 149 SFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCA---VVSLGERF 205
           + G+ L                 YY +YDN F +   +  T  + L  A   V S     
Sbjct: 155 TAGSVLSTITMLNHWACSAVTLLYYSYYDNVFYFKLLALFTANWTLVVAAVTVTSTASNS 214

Query: 206 RAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYG 265
             R+W   R  + V   +   +P+  G L +G  +   R+  + ++ E   Y+   + YG
Sbjct: 215 PKRQWWSRRTLLLVYVVVLVSVPLVVGLLRFGTAKVLRRLDWRLLLAELAVYLISGVFYG 274

Query: 266 VRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIV 309
               + L    F +  H+  L H+ +++ A   +R      T+V
Sbjct: 275 GTEKDTLPKLPFYVAFHTASLIHLQLLLNAFHLMRAGTNKPTLV 318

>TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON}
           Anc_5.197 YLR023C
          Length = 437

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 64/321 (19%), Positives = 111/321 (34%), Gaps = 66/321 (20%)

Query: 46  HLPDWQKDNEHILSGYVKETNSIKACLHSLLFI---HNESVNIFSHLVPAFCFMTTIIF- 101
            LP   ++N +I+ GY    +++K CL S++     HNE++NI+SHL      +   +F 
Sbjct: 118 QLPFPWRENRYIIKGYRFYDSNVK-CLLSVVNYYGWHNETLNIWSHLGGFLTLLYIAVFV 176

Query: 102 ----DKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNK---L 154
               + Y  E  PTT     ++L +FL     C++ S  +H       Y  +   K   +
Sbjct: 177 YPNTEVYQSELIPTTA---KMLLFVFLIAGMKCMLASVFWHTFDGTCSY--TLRPKFCCV 231

Query: 155 DYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYR 214
           DY               Y          F + +++   G     ++   +F   E RP R
Sbjct: 232 DYTGITILITASILTAEYVSLSHAPIWMFIYMSLSLALGTFGVYINWSPKFDGPEARPLR 291

Query: 215 AAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERL-- 272
              FV       L  F   ++         +    +    ++Y+ G   YG   PE+   
Sbjct: 292 IKFFVTLSAMGCLS-FVHLIFTTSLRHACWLLAPIISKSTIWYVIGVFFYGSFIPEKYRS 350

Query: 273 -----------------------------------------KPGMFDIW-----GHSHQL 286
                                                    K G+  +W     G SH +
Sbjct: 351 DYILDKTIPTSKQLSCDLSIITKDRHIHFRDQPTPNKNGPRKTGLRSLWWVDYVGQSHTI 410

Query: 287 FHILVVVAALCHLRGLLGSYT 307
           +HI V++  + H +  L  +T
Sbjct: 411 WHIFVLLGVVGHYKACLDMFT 431

>AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR023C
          Length = 419

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 72/313 (23%), Positives = 118/313 (37%), Gaps = 56/313 (17%)

Query: 44  WEHLPDWQKDNEHILSG---YVKETNSIKACLHSLLFIHNESVNIFSHLVPA--FCFMTT 98
           WE LP   ++N +I+ G   Y     S+ + L++  + HNE++NI+SHLV A    ++  
Sbjct: 108 WE-LPYAWRENRYIIYGHRFYHSHRKSLLSVLNAYGW-HNETINIWSHLVGAAVLAYLLC 165

Query: 99  IIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHC------LKAHSPYVSSFGN 152
             + +  V R           +  FL     C+  S A+H       LK  S +V     
Sbjct: 166 WGWPRSDVYRAAQVPRLAKWAIGAFLACGVKCMASSVAWHTFNGTCHLKLRSRFVC---- 221

Query: 153 KLDYXXXXXXXXXXXXXXXYYGFYDNSF-LYFTFSAITFTFGLSCAVVSLGERFRAREWR 211
            +DY                   Y  S  L + +   +   G +  V++    F   E R
Sbjct: 222 -VDYTGITLLVTASVVTTVAVTLYGLSRPLMYAYMVASIGLGTAAGVMNWSPHFDRPEAR 280

Query: 212 PYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPER 271
           P R A++V  GL+AL  +    ++  V+  +  +    V    V+Y  G + Y    PER
Sbjct: 281 PLRIAVYV--GLAALGLVSFVHVWMQVRWASAHLMAPLVYKSLVWYGIGVVFYATLVPER 338

Query: 272 LKPGM-----------------------------------FDIWGHSHQLFHILVVVAAL 296
            +  +                                    D + HSH L+H+ VV+  +
Sbjct: 339 WRSDVTLDCCSGPVHEAACRQFRDLPPVARKDRQFWSLWWVDYFCHSHFLWHVFVVLGVV 398

Query: 297 CHLRGLLGSYTIV 309
            H R +L    IV
Sbjct: 399 GHYRAVLQMSRIV 411

>NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.197
           YLR023C
          Length = 543

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 50/216 (23%), Positives = 82/216 (37%), Gaps = 40/216 (18%)

Query: 79  HNESVNIFSHLVPAFCFMTTIIFD-----KYVVERYPTTTLKDYLMLDLFLFGAFTCLMM 133
           HNE+ NI++HL+     +   ++D      ++ ++ PTT     L++ LFLF A  CL  
Sbjct: 255 HNETSNIWTHLIGGLYLIYMAVYDFPRSEIFLSDKIPTTA---KLIVYLFLFAAIKCLFA 311

Query: 134 SSAFH------CLKAHSPYVSSFGNKLDYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSA 187
           S  +H       LK  S +       +DY               +   Y +      + A
Sbjct: 312 SVFWHSFNGTCTLKLRSKFAC-----VDYSGISILITASILTTEFVTLYSSYRAMCVYMA 366

Query: 188 ITFTFGLSCAVVSLGERFRAREWRPYRAAMFVAFGLSALLPI----------FAGFLYYG 237
           I+ + G+    ++   +F   E RP R   FV      +L            +A +L   
Sbjct: 367 ISLSLGIFGVFMNWSPKFDRPEARPLRIKFFVLLASMGVLSFLHLTFLTDWKYATWLLAP 426

Query: 238 VQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLK 273
           V   +I           V+Y  G + YG   PER +
Sbjct: 427 VTNKSI-----------VWYCIGVVFYGSFIPERFR 451

>Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {ON}
           YLR023C (REAL)
          Length = 541

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 96/238 (40%), Gaps = 16/238 (6%)

Query: 46  HLPDWQKDNEHILSGYVKETNSIKACLHSLLFI--HNESVNIFSHLVPAFCFMTTIIFD- 102
            LP   ++N +I+ GY       K+ L  + +   HNE+ NI++HL+ A   +   ++D 
Sbjct: 219 QLPFPWRENRYIIHGYRFYNTHYKSLLSVINWYGWHNETSNIWTHLLGAMYIVYLAVYDF 278

Query: 103 -KYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHS--PYVSSFGNKLDYXXX 159
               V + P    +   ++  FL  A  C++ S  +H     S     S F   +DY   
Sbjct: 279 PHSEVWQNPEVPQQARWIVFAFLAAALKCMLSSVFWHTFNGTSFLGLRSKFAC-VDYSGI 337

Query: 160 XXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAMFV 219
                       +   Y   +   T+  I+   G+    ++   RF   E RP R   F+
Sbjct: 338 TILITASILTTEFVTMYSCYWAMCTYMTISLALGVFGVFMNWSPRFDRPEARPLRIRFFI 397

Query: 220 AFG----LSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLK 273
                  LS L  IF   L+Y +   +  V  K V    V+Y+ G + YG   PER +
Sbjct: 398 LLATMGVLSFLHLIFLTDLHYAIWLFS-PVTNKSV----VWYLVGVVFYGSFIPERFR 450

>Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}
           similar to Ashbya gossypii AAL153C
          Length = 568

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 62/270 (22%), Positives = 111/270 (41%), Gaps = 35/270 (12%)

Query: 26  DGAKSSYSYIK-----RGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFI-- 78
           DG   SYS+ K     R   L  +E LP   ++N +I+ G+ +  +S K  L S+L +  
Sbjct: 220 DGGDKSYSWAKSYMLGRARHLHYYE-LPQPWRENPYIIYGH-RFYHSHKKSLLSILNVYG 277

Query: 79  -HNESVNIFSHLVPAFC--------FMTTIIFDKYVVERYPTTTLKDYLMLDLFLFGAFT 129
            HNE++NI+SH+  A          F  + +F+   V +     +       +FL     
Sbjct: 278 WHNETINIWSHIAGAIILLYIMLRGFPNSDVFNSTQVPKVAKGAIY------VFLLCGIK 331

Query: 130 CLMMSSAFHCLKA--HSPYVSSFGNKLDYXXXXXXXXXXXXXXXYYGFYD-NSFLYFTFS 186
           C++ S  +H      H P  S F + +DY                +  Y       + + 
Sbjct: 332 CMVSSVMWHTFSGTCHLPLRSRF-SCVDYTGITILITASVMTTEAFTLYRLAPKAMYLYM 390

Query: 187 AITFTFGLSCAVVSLGERFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQE--TTIR 244
            I+   G+  A  +   RF   + R +R A +V      L+     F++  V    ++ R
Sbjct: 391 GISLCLGVFAAFTNWSRRFDGPDSRIFRVAFYVILAGLGLI----SFVHLTVHSDWSSSR 446

Query: 245 VQLKWVVLEG-VFYIFGALLYGVRFPERLK 273
           + +  ++ +  V+Y+ G + Y    PER +
Sbjct: 447 LMITPLINKSIVWYLIGVVFYATLVPERWR 476

>KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 546

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 65/246 (26%), Positives = 99/246 (40%), Gaps = 27/246 (10%)

Query: 46  HLPDWQKDNEHILSGYVKETNSIKACLHSLLFI---HNESVNIFSHLVPA--FCFMTTII 100
            LP   ++N  I+ GY +  NS    L S+      HNE+VNI++HL  A  F F+    
Sbjct: 219 ELPFPWRENRFIIHGY-RFYNSYSKSLLSIFNWYGWHNETVNIWTHLCGALYFAFLIFKG 277

Query: 101 FDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKA--HSPYVSSFGNKLDYXX 158
           F +  V +          M  +FL     C + S  +H      H    S+    +DY  
Sbjct: 278 FSQTTVYQSELVPTAAKFMAFVFLTAGLECFLFSVVWHTFNGICHLKQRSNCAC-VDYTG 336

Query: 159 XXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLG------ERFRAREWRP 212
                        +     +S   FT+S + FT G S A+ ++G       +F   E RP
Sbjct: 337 ITVLVTASILTTEFVTLSGSSDATFTWSLLFFT-GASAALGAVGVFMNWSPKFDRPESRP 395

Query: 213 YRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQ----LKWVVLEGV-FYIFGALLYGVR 267
            R A ++      LL  F  F Y   +     V     +K V ++ + +YI G + YG  
Sbjct: 396 LRIAFYL------LLASFGFFSYLHSRLFNTAVDSSDLIKPVFMKSLAWYIIGVVFYGTF 449

Query: 268 FPERLK 273
            PER +
Sbjct: 450 IPERWR 455

>TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {ON}
           Anc_5.197 YLR023C
          Length = 569

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 97/257 (37%), Gaps = 53/257 (20%)

Query: 46  HLPDWQKDNEHILSGYVKETNSIKACLHSLLF--IHNESVNIFSHLVPAF--CFMTTIIF 101
            LP   ++N++I+ GY       +  L    +  +HNE+ NI++H++ AF   ++ T+ F
Sbjct: 248 ELPFPWRENKYIIHGYRFHDKFYQLILSVFNWYGVHNETTNIWTHMLAAFYLIYLLTVDF 307

Query: 102 DKYVV----ERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKA-HSPYVSSFGNKLDY 156
            K  +    E  P TT   Y++  +FL     C+  S  +H      S  +      +DY
Sbjct: 308 QKTFIVLDTEHVPATT--KYIIY-MFLGAGIKCMFASVFWHTFNGTTSIRLRPKFCCVDY 364

Query: 157 XXXXXXXXXXXXXXXYYGFYD----NSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRP 212
                          Y   YD     SF Y   S I   FGL    ++   +F + E RP
Sbjct: 365 TGITLLISASIMSAEYITLYDYPKAMSF-YMILSGIFAVFGL---YLNWSPKFDSPEARP 420

Query: 213 YRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEG----------------VF 256
            R   FV      LL    G  +  +           V LEG                ++
Sbjct: 421 LRIKFFV------LLAAVGGLSFVNL-----------VCLEGLSRAIWLFSPVTNKSVIY 463

Query: 257 YIFGALLYGVRFPERLK 273
           YI G   YG   PER +
Sbjct: 464 YIIGVFFYGSFIPERFR 480

>TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {ON}
           Anc_5.197 YLR023C
          Length = 450

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 52/243 (21%), Positives = 94/243 (38%), Gaps = 26/243 (10%)

Query: 46  HLPDWQKDNEHILSGYVKETNSIKACLHSLLFI--HNESVNIFSHLVPAFCFMTTIIFD- 102
            LP   ++N  I+ GY    +  K+ L  + +   HNE+ NI++HL  A   +   ++D 
Sbjct: 136 QLPFPWRENRFIIHGYRFYDSHYKSLLSIVNWYGWHNETANIWTHLGGALYVLWLAVYDF 195

Query: 103 -KYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFH------CLKAHSPYVSSFGNKLD 155
            +  V       +    ++ +FL  A  C++ S   H      CL   S +       +D
Sbjct: 196 PRTSVWESEQVPMVAKCIVYVFLAAALKCMLASVFGHTFNGTCCLALRSKFAC-----VD 250

Query: 156 YXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRA 215
           Y               +   Y+  +    + A++   G+   +++   +F   E RP R 
Sbjct: 251 YSGITMLITASILTTEFVTMYNYPWSLRFYLAVSTVLGIFGVIMNWSPKFDRPEARPLRI 310

Query: 216 AMFVAF----GLSAL-LPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPE 270
             F+      GLS + L +  G+ Y       +  +        V+Y+ G   YG   PE
Sbjct: 311 KFFILLAAMGGLSFMQLGLLGGWKYASWLMAPVTHK------SLVWYLLGVAFYGSFVPE 364

Query: 271 RLK 273
           R +
Sbjct: 365 RFR 367

>SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]
           {ON} some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 563

 Score = 37.7 bits (86), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 92/243 (37%), Gaps = 20/243 (8%)

Query: 47  LPDWQKDNEHILSGYVKETNSIKACLHSLLFI--HNESVNIFSHLVPAFCFMTTIIFDKY 104
           LP   ++N  I+ GY    +  K+ L  L +   HNE+ NI++HL  +        ++  
Sbjct: 237 LPFPWRENRFIIHGYRFYHSHTKSLLSILNWYGWHNETTNIWTHLFGSLYIAYLAFYEFP 296

Query: 105 VVERYPTTTLKDYL--MLDLFLFGAFTCLMMSSAFHCLKAHSP-YVSSFGNKLDYXXXXX 161
               Y +  +  +   M+ LFL   F CL+ S  +H        ++ S    +DY     
Sbjct: 297 QSSVYLSGDVPQFAKYMVYLFLGAGFKCLVSSVTWHTFNGTCKLHLRSKFACMDYTGITV 356

Query: 162 XXXXXXXXXXY---YGFYDNSFLYFTFSAITFTFGLSCAVVSLG------ERFRAREWRP 212
                     +   YG  DN     TFS I F   +S  +   G       RF   E RP
Sbjct: 357 LITASIMTAEFVSLYGNGDNPNSPVTFSLI-FYMAVSSVLCCFGVFMNWSPRFDRPESRP 415

Query: 213 YRAAMFVAFGLSALLPIFAGFLYYGVQETT--IRVQLKWVVLEGVFYIFGALLYGVRFPE 270
            R A ++       L      L      ++  IR  L   V    +Y+ G + YG   PE
Sbjct: 416 LRIAFYLLLAGMGFLAFLHLTLITNFAHSSWLIRPVLDKSV---CWYLIGVIFYGSFIPE 472

Query: 271 RLK 273
           R +
Sbjct: 473 RWR 475

>Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023C -
           Hypothetical ORF [contig 94] FULL
          Length = 566

 Score = 37.0 bits (84), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 101/250 (40%), Gaps = 35/250 (14%)

Query: 46  HLPDWQKDNEHILSGYVKETNSIKACLHSLLFI---HNESVNIFSHLVPAFCFMTTIIFD 102
            LP   ++N  I+ GY +  NS K  L S+      HNE+VNI++HL  A  ++  ++F 
Sbjct: 239 ELPFPWRENRFIIHGY-RFYNSYKKSLLSIFNWYGWHNETVNIWTHLGGAL-YLAYLLFR 296

Query: 103 K------YVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKA--HSPYVSSFGNKL 154
                  Y  E  PT       M  +FL     C + S  +H      H    S+    +
Sbjct: 297 GFSQTAVYQSELVPTAA---KCMAFVFLLSGLECFLFSVVWHTFNGICHLQQRSNCAC-V 352

Query: 155 DYXXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFT-----FGLSCAVVSLGERFRARE 209
           DY               +      +   FT+S + FT      G+    ++   +F   E
Sbjct: 353 DYTGITILVTASILTTEFVTLSGAAEAPFTWSLLFFTTTSSILGVIGVYMNWSPKFDRPE 412

Query: 210 WRPYRAA---MFVAFGLSALLPIFAGFLYYGVQETTIRVQ--LKWVVLEGV-FYIFGALL 263
            RP R A   +  +FG       F  +L+  +  T+I     +K V+ + + +Y+ G + 
Sbjct: 413 SRPLRIAFYLLLASFG-------FFSYLHSRIFHTSISSSELIKPVLSKSLAWYLIGVVF 465

Query: 264 YGVRFPERLK 273
           YG   PER +
Sbjct: 466 YGTFIPERWR 475

>CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q07959 Saccharomyces cerevisiae
           YLR023c
          Length = 545

 Score = 33.5 bits (75), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 52/242 (21%), Positives = 94/242 (38%), Gaps = 26/242 (10%)

Query: 47  LPDWQKDNEHILSGYVKETNSIKACLHSLLFI---HNESVNIFSHLVPAFCFMTTIIF-- 101
           LP   ++N  I++GY +  NS K  L S++     HNE+ NI++HL+     +  + +  
Sbjct: 219 LPFPWRENRCIINGY-RFYNSHKKSLLSIVNWYGWHNETSNIWTHLLGGLYILYLMFYQF 277

Query: 102 ---DKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHS--PYVSSFGNKLDY 156
              + ++ E+ P       L+  +FL  A  CL  S  +H     S       F   +DY
Sbjct: 278 PSSEVFMSEQVPKAA---KLITYVFLIAAAKCLFSSVFWHTFNGTSLLRLRCKFAC-VDY 333

Query: 157 XXXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAA 216
                          +   Y   +   ++ A++   G+    ++   +F   E RP R  
Sbjct: 334 SGISILITASILTTEFVTMYQCPWAMVSYMALSTALGIFGVFMNWSPKFDRPEARPLRIK 393

Query: 217 MFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVV-----LEGVFYIFGALLYGVRFPER 271
            F+      +L          +  +T      W++        V+Y+ G + YG   PER
Sbjct: 394 FFILLASMGILSFLHLTFITSLSHST------WLLSPITKKSVVWYLVGVVFYGSFIPER 447

Query: 272 LK 273
            +
Sbjct: 448 WR 449

>KNAG0I00420 Chr9 complement(62534..65791) [3258 bp, 1085 aa] {ON}
           Anc_1.459 YJR035W
          Length = 1085

 Score = 31.6 bits (70), Expect = 3.7,   Method: Composition-based stats.
 Identities = 12/39 (30%), Positives = 23/39 (58%)

Query: 44  WEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNES 82
           W  LP+W+K +  I +  + +T  +   +HSLLF + ++
Sbjct: 280 WPDLPEWRKPHPDIPTARLNDTFKVPGEIHSLLFNYQKT 318

>ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 531

 Score = 30.4 bits (67), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 49/240 (20%), Positives = 89/240 (37%), Gaps = 20/240 (8%)

Query: 46  HLPDWQKDNEHILSGYVKETNSIKACLHSLLFI--HNESVNIFSHLVPAFCFMTTIIF-- 101
            LP   ++N++I+ GY    +  K+ L  + +   HNE+ NI++HL+     +    +  
Sbjct: 209 QLPFPYRENKYIIHGYRFYASHKKSFLSIINWYGWHNETSNIWTHLLGGLYLIYLAFYHF 268

Query: 102 ---DKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKA-HSPYVSSFGNKLDYX 157
              + ++ +R P        ++ +FL  A  C+  S  +H     H   + S    +DY 
Sbjct: 269 PHSNIWLSDRVPKPA---KCIVAVFLAAAIKCMFASVFWHTFNGTHLLRLRSKFACVDYT 325

Query: 158 XXXXXXXXXXXXXXYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAM 217
                         +   YD       +   +   G+    ++   +F   E RP R   
Sbjct: 326 GITILITASILTVEFVTMYDYKISLLFYMICSLALGIIGVSMNWSPKFDRPEARPLRIKF 385

Query: 218 FV---AFGLSALLP-IFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLK 273
           F+     G S+ +  +F     Y     T            V+Y+ G   YG   PER +
Sbjct: 386 FILLATVGCSSFIRLVFLTNWRYAADLLTPLTNK-----SVVWYLIGVFFYGSFIPERFR 440

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.329    0.142    0.451 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,412,095
Number of extensions: 1160269
Number of successful extensions: 3192
Number of sequences better than 10.0: 72
Number of HSP's gapped: 3129
Number of HSP's successfully gapped: 72
Length of query: 318
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 209
Effective length of database: 40,982,805
Effective search space: 8565406245
Effective search space used: 8565406245
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 66 (30.0 bits)