Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1032.86.21ON34334315890.0
TPHA0J003406.21ON3383345931e-73
Kpol_1037.266.21ON3423325661e-69
TBLA0G010506.21ON3503395574e-68
YOR007C (SGT2)6.21ON3463535513e-67
KAFR0L004106.21ON3313355432e-66
NCAS0H008306.21ON3383425391e-65
Skud_15.1686.21ON3483575373e-65
Smik_15.1766.21ON3453575355e-65
SAKL0E01210g6.21ON3233325311e-64
TDEL0G044806.21ON3433385321e-64
ZYRO0C07788g6.21ON3343355276e-64
NDAI0D008106.21ON3493515192e-62
KNAG0M011706.21ON3393305121e-61
Suva_15.1826.21ON3463555095e-61
ACR005W6.21ON3273315076e-61
CAGL0E02739g6.21ON3433304842e-57
Kwal_56.224336.21ON3223364823e-57
KLLA0D01155g6.21ON3353414754e-56
KLTH0C11220g6.21ON3273374622e-54
Ecym_30256.21ON3183274543e-53
NCAS0D026706.21ON3512293613e-39
TPHA0M002706.21ON3773743502e-37
TBLA0A072706.21ON3733623381e-35
NDAI0I022406.21ON3503703185e-33
TPHA0D028805.617ON5851102135e-18
CAGL0H08195g5.617ON583942073e-17
Suva_8.805.617ON586942002e-16
TBLA0E033005.617ON582941967e-16
YOR027W (STI1)5.617ON589941942e-15
Skud_15.1925.617ON589961923e-15
NDAI0F009105.617ON583931914e-15
Kpol_1018.695.617ON590941888e-15
Smik_15.2055.617ON589941852e-14
KLLA0A07062g5.617ON581941834e-14
KNAG0B032005.617ON579951782e-13
Kwal_55.199355.617ON593941745e-13
SAKL0G07084g5.617ON5851141711e-12
AEL224W5.617ON580941692e-12
NCAS0G008105.617ON584951683e-12
ZYRO0A05676g5.617ON5721071683e-12
TDEL0A048405.617ON576931649e-12
KLTH0E02178g5.617ON5931101631e-11
KAFR0C058905.617ON575931568e-11
Ecym_55825.617ON584941551e-10
KAFR0B066103.481ON5111121504e-10
NDAI0B057903.481ON523741496e-10
NCAS0F034903.481ON512741488e-10
TPHA0D032203.481ON513691471e-09
KNAG0A079003.481ON512711462e-09
SAKL0F03102g3.481ON513741443e-09
CAGL0D05060g3.481ON510711434e-09
Kpol_505.413.481ON513741407e-09
Smik_6.2153.481ON513741372e-08
Suva_7.4083.481ON513741372e-08
KLLA0F24046g2.152ON604821372e-08
YGR123C (PPT1)3.481ON513741372e-08
TDEL0D055003.481ON512741363e-08
Skud_7.4323.481ON513741353e-08
Ecym_44133.481ON510711353e-08
Skud_8.1782.152ON638941346e-08
NCAS0A00490singletonON620921337e-08
Smik_8.1952.152ON635951311e-07
YHR117W (TOM71)2.152ON639941292e-07
KLTH0B05170g2.152ON593961283e-07
Kwal_55.211753.481ON511691273e-07
KLTH0F14542g3.481ON513691265e-07
Suva_15.3142.152ON644941265e-07
AAR083C3.481ON538741256e-07
TBLA0C039503.481ON512741212e-06
NDAI0B043402.152ON6641011212e-06
Ecym_82042.152ON597821176e-06
Suva_14.2192.152ON617941168e-06
Kwal_33.147672.152ON594941151e-05
Smik_14.2072.152ON617941151e-05
ABR131W2.152ON594821151e-05
NCAS0B070102.152ON625961151e-05
CAGL0L12936g2.152ON6001491141e-05
KLLA0B10912g3.481ON512671142e-05
Skud_14.2112.152ON617941132e-05
SAKL0E10956g2.152ON600941132e-05
Kwal_27.118908.506ON334981113e-05
KAFR0E029808.506ON3801441095e-05
NDAI0F028102.152ON6091161096e-05
YNL121C (TOM70)2.152ON617941096e-05
TDEL0B013108.506ON380781079e-05
NCAS0B024008.506ON380851061e-04
NDAI0C033505.72ON649941061e-04
CAGL0L04048g2.152ON587821024e-04
KNAG0A039508.506ON386881014e-04
TBLA0C055302.152ON610941016e-04
NCAS0D013905.72ON6311041017e-04
KAFR0J025706.328ON12137947e-04
TPHA0M016303.367ON1043981008e-04
Kpol_513.28.506ON37490998e-04
ZYRO0B04224g3.481ON51369990.001
TDEL0B051402.152ON59994990.001
TBLA0H033808.506ON37578980.001
CAGL0I02288g5.72ON63991980.001
TPHA0A052905.72ON666122980.001
CAGL0H07425g8.506ON38075970.001
ZYRO0G06512g2.152ON60494970.002
NCAS0G024802.152ON59682970.002
Kpol_1006.43.367ON73299970.002
TBLA0H015203.367ON689145960.002
KNAG0H035302.152ON61467960.002
Smik_3.1596.328ON11570890.003
KAFR0F007202.152ON60894950.003
TPHA0D038606.328ON12076880.004
Kpol_1028.516.328ON11793880.004
KAFR0H008703.367ON88798940.005
KNAG0H006103.367ON97396940.005
TBLA0B079705.72ON68791940.005
NCAS0A112003.367ON90796940.005
Smik_2.2543.367ON102096940.005
KLLA0B09262g3.367ON94196940.005
NDAI0A051003.367ON100796940.005
Kpol_172.23.367ON418143930.005
TPHA0E007407.412ON746130930.006
Ecym_25598.506ON37085920.006
Suva_4.3613.367ON96396930.006
TDEL0C050903.367ON75998930.006
YBR112C (CYC8)3.367ON96696930.006
AGL268C8.506ON37988920.006
Kpol_1050.825.72ON63991920.006
KNAG0I025206.328ON11779860.007
Skud_2.2403.367ON98496920.007
ZYRO0C16522g3.367ON97496920.008
CAGL0D01364g3.367ON114896920.008
TBLA0I023106.328ON11655850.008
TBLA0F012303.367ON118998910.010
ADL344W3.367ON91096910.011
Kpol_1048.212.152ON59794900.011
SAKL0A01672g6.328ON12857850.011
SAKL0B07986g3.367ON880149910.011
ZYRO0C11594g5.72ON62891890.016
Ecym_34593.367ON111596890.017
SAKL0H10934g8.506ON38088880.019
KLTH0F10428g3.367ON79596880.024
Kwal_23.36703.367ON80296880.025
TPHA0I015102.152ON60394870.028
Kwal_55.218395.689ON69091870.034
Kpol_331.1singletonON21877830.054
NDAI0J001307.546ON140391850.057
NDAI0C052908.506ON37986840.058
KLTH0E11748g8.506ON37888840.061
YBR155W (CNS1)8.506ON38575830.070
Skud_2.2828.506ON38559830.072
NCAS0D045006.328ON12155780.086
Ecym_40315.689ON68863830.092
KLLA0B09966g8.506ON37088820.094
KNAG0E006805.72ON639100830.10
CAGL0K09240g6.328ON14264780.11
TPHA0L014208.506ON37475820.11
Smik_2.2958.506ON38588810.12
Kwal_56.247505.72ON61994820.14
TDEL0G009605.72ON62291810.15
KAFR0L018707.412ON712125810.16
KLTH0F18150g5.689ON68947800.20
Ecym_20906.328ON17248770.20
YCR060W (TAH1)6.328ON11183740.24
Kpol_1018.1067.412ON753118790.29
ABR206W5.72ON614102780.37
Kpol_1043.605.689ON70659780.38
KLTH0H00704g5.72ON62194780.39
SAKL0H02244g5.72ON628132770.46
Suva_4.4058.506ON38588760.53
NDAI0E040407.412ON783130750.78
KLLA0E20857g7.412ON710122750.87
CAGL0C01903g7.412ON76984750.96
KLTH0C00572g2.665ON72067741.1
Ecym_42298.343ON38278731.3
KLLA0C08910g6.328ON11547691.4
Skud_4.5068.470ON61151731.6
Suva_14.263.32ON904118731.7
ZYRO0B03828g7.412ON727147731.7
Suva_2.347.412ON76380721.7
Suva_2.4108.470ON61151721.8
Smik_4.4918.470ON61251721.9
KNAG0A041208.470ON60251722.0
Skud_3.1356.328ON11848682.1
KAFR0C018505.352ON64655722.1
YBL084C (CDC27)7.412ON75880722.2
TPHA0F014102.227ON34544712.2
SAKL0E14542g5.689ON69059712.3
Smik_2.367.412ON75180712.5
NCAS0B025608.470ON57859712.6
YDR244W (PEX5)8.470ON61251712.9
TPHA0L012108.470ON58884703.1
KAFR0E028208.470ON56264703.3
CAGL0E01573g3.32ON904160703.7
YNL313C (EMW1)3.32ON904107703.8
KLLA0C15455g8.470ON56651693.8
Kwal_14.8742.665ON72267694.3
ZYRO0C03564g3.5ON1096100695.1
Suva_3.956.328ON11170645.1
KLLA0E07239g3.32ON896104685.5
Smik_4.7743.84ON58439685.7
Kwal_27.107407.412ON62881686.3
CAGL0H07095g5.352ON66155686.4
ADR230W5.689ON68562686.7
Kwal_27.117378.470ON57564677.3
Kwal_55.221523.5ON110190677.3
KLLA0A05258g5.72ON632100677.6
KNAG0L020105.689ON70280677.7
KLTH0E10934g8.470ON56864678.3
Smik_14.183.32ON904107678.3
ZYRO0D00572g2.665ON785110678.9
NDAI0C051308.470ON59064669.0
TDEL0B076002.665ON752110679.1
CAGL0K11209g8.470ON59051669.6
TPHA0B047201.55ON91782669.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1032.8
         (343 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...   616   0.0  
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...   233   1e-73
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...   222   1e-69
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...   219   4e-68
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...   216   3e-67
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...   213   2e-66
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...   212   1e-65
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...   211   3e-65
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...   210   5e-65
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...   209   1e-64
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...   209   1e-64
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...   207   6e-64
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...   204   2e-62
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...   201   1e-61
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...   200   5e-61
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...   199   6e-61
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...   191   2e-57
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...   190   3e-57
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...   187   4e-56
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...   182   2e-54
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...   179   3e-53
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...   143   3e-39
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...   139   2e-37
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...   134   1e-35
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...   127   5e-33
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    87   5e-18
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    84   3e-17
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    82   2e-16
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    80   7e-16
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    79   2e-15
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    79   3e-15
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     78   4e-15
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    77   8e-15
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    76   2e-14
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    75   4e-14
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    73   2e-13
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    72   5e-13
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    70   1e-12
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    70   2e-12
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    69   3e-12
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    69   3e-12
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    68   9e-12
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    67   1e-11
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    65   8e-11
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    64   1e-10
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    62   4e-10
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    62   6e-10
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    62   8e-10
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    61   1e-09
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    61   2e-09
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    60   3e-09
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    60   4e-09
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    59   7e-09
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    57   2e-08
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    57   2e-08
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...    57   2e-08
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    57   2e-08
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    57   3e-08
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    57   3e-08
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    57   3e-08
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...    56   6e-08
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       56   7e-08
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...    55   1e-07
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...    54   2e-07
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...    54   3e-07
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    54   3e-07
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    53   5e-07
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...    53   5e-07
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    53   6e-07
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    51   2e-06
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...    51   2e-06
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...    50   6e-06
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...    49   8e-06
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...    49   1e-05
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...    49   1e-05
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...    49   1e-05
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    49   1e-05
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...    49   1e-05
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    49   2e-05
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...    48   2e-05
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...    48   2e-05
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    47   3e-05
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    47   5e-05
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...    47   6e-05
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...    47   6e-05
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    46   9e-05
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    45   1e-04
NDAI0C03350 Chr3 complement(769764..771713) [1950 bp, 649 aa] {O...    45   1e-04
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...    44   4e-04
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    44   4e-04
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...    44   6e-04
NCAS0D01390 Chr4 (251721..253616) [1896 bp, 631 aa] {ON} Anc_5.72      44   7e-04
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    41   7e-04
TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa] ...    43   8e-04
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    43   8e-04
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    43   0.001
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    43   0.001
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    42   0.001
CAGL0I02288g Chr9 complement(203605..205524) [1920 bp, 639 aa] {...    42   0.001
TPHA0A05290 Chr1 complement(1198497..1200497) [2001 bp, 666 aa] ...    42   0.001
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    42   0.001
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    42   0.002
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...    42   0.002
Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON...    42   0.002
TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.3...    42   0.002
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...    42   0.002
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    39   0.003
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    41   0.003
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    39   0.004
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    39   0.004
KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.3...    41   0.005
KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.36...    41   0.005
TBLA0B07970 Chr2 (1887119..1889182) [2064 bp, 687 aa] {ON} Anc_5...    41   0.005
NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa] ...    41   0.005
Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {O...    41   0.005
KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly...    41   0.005
NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON} Anc_...    41   0.005
Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)...    40   0.005
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    40   0.006
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    40   0.006
Suva_4.361 Chr4 complement(631697..632812,632933..633154,633188....    40   0.006
TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {O...    40   0.006
YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}  ...    40   0.006
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    40   0.006
Kpol_1050.82 s1050 complement(185867..187786) [1920 bp, 639 aa] ...    40   0.006
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    38   0.007
Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON...    40   0.007
ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]...    40   0.008
CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} simil...    40   0.008
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    37   0.008
TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {...    40   0.010
ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic ho...    40   0.011
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...    39   0.011
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    37   0.011
SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {...    40   0.011
ZYRO0C11594g Chr3 complement(907459..909345) [1887 bp, 628 aa] {...    39   0.016
Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar ...    39   0.017
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    39   0.019
KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly...    39   0.024
Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C...    39   0.025
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...    38   0.028
Kwal_55.21839 s55 (998426..1000498) [2073 bp, 690 aa] {ON} YOR08...    38   0.034
Kpol_331.1 s331 (1620..2276) [657 bp, 218 aa] {ON} (1620..2276) ...    37   0.054
NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {O...    37   0.057
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    37   0.058
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    37   0.061
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    37   0.070
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    37   0.072
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    35   0.086
Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON} s...    37   0.092
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    36   0.094
KNAG0E00680 Chr5 complement(122876..124795) [1920 bp, 639 aa] {O...    37   0.10 
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    35   0.11 
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    36   0.11 
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    36   0.12 
Kwal_56.24750 s56 complement(1132221..1134080) [1860 bp, 619 aa]...    36   0.14 
TDEL0G00960 Chr7 (191061..192929) [1869 bp, 622 aa] {ON} Anc_5.7...    36   0.15 
KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7....    36   0.16 
KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weak...    35   0.20 
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    34   0.20 
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    33   0.24 
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    35   0.29 
ABR206W Chr2 (787387..789231) [1845 bp, 614 aa] {ON} Syntenic ho...    35   0.37 
Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON} (1235...    35   0.38 
KLTH0H00704g Chr8 (70712..72577) [1866 bp, 621 aa] {ON} similar ...    35   0.39 
SAKL0H02244g Chr8 (216327..218213) [1887 bp, 628 aa] {ON} simila...    34   0.46 
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    34   0.53 
NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.4...    33   0.78 
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    33   0.87 
CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {...    33   0.96 
KLTH0C00572g Chr3 complement(57378..59540) [2163 bp, 720 aa] {ON...    33   1.1  
Ecym_4229 Chr4 complement(477067..478215) [1149 bp, 382 aa] {ON}...    33   1.3  
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    31   1.4  
Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W ...    33   1.6  
Suva_14.26 Chr14 complement(41582..44296) [2715 bp, 904 aa] {ON}...    33   1.7  
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    33   1.7  
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    32   1.7  
Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W ...    32   1.8  
Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W ...    32   1.9  
KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {O...    32   2.0  
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    31   2.1  
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...    32   2.1  
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    32   2.2  
TPHA0F01410 Chr6 complement(327058..328095) [1038 bp, 345 aa] {O...    32   2.2  
SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weak...    32   2.3  
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    32   2.5  
NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {O...    32   2.6  
YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}  PEX5Peroxi...    32   2.9  
TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8....    32   3.1  
KAFR0E02820 Chr5 (570013..571701) [1689 bp, 562 aa] {ON} Anc_8.4...    32   3.3  
CAGL0E01573g Chr5 complement(149084..151798) [2715 bp, 904 aa] {...    32   3.7  
YNL313C Chr14 complement(45308..48022) [2715 bp, 904 aa] {ON}  E...    32   3.8  
KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} simi...    31   3.8  
Kwal_14.874 s14 complement(90148..92316) [2169 bp, 722 aa] {ON} ...    31   4.3  
ZYRO0C03564g Chr3 (281661..284951) [3291 bp, 1096 aa] {ON} simil...    31   5.1  
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    29   5.1  
KLLA0E07239g Chr5 complement(655635..658325) [2691 bp, 896 aa] {...    31   5.5  
Smik_4.774 Chr4 complement(1365084..1366838) [1755 bp, 584 aa] {...    31   5.7  
Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {...    31   6.3  
CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} simila...    31   6.4  
ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic ...    31   6.7  
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    30   7.3  
Kwal_55.22152 s55 (1134267..1137572) [3306 bp, 1101 aa] {ON} YOL...    30   7.3  
KLLA0A05258g Chr1 (466776..468674) [1899 bp, 632 aa] {ON} simila...    30   7.6  
KNAG0L02010 Chr12 (357972..360080) [2109 bp, 702 aa] {ON} Anc_5....    30   7.7  
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    30   8.3  
Smik_14.18 Chr14 complement(29815..32529) [2715 bp, 904 aa] {ON}...    30   8.3  
ZYRO0D00572g Chr4 complement(42511..44830,45510..45547) [2358 bp...    30   8.9  
NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON} Anc_8...    30   9.0  
TDEL0B07600 Chr2 (1331773..1334031) [2259 bp, 752 aa] {ON} Anc_2...    30   9.1  
CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON} sim...    30   9.6  
TPHA0B04720 Chr2 complement(1107735..1110488) [2754 bp, 917 aa] ...    30   9.8  

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/343 (90%), Positives = 312/343 (90%)

Query: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60
           MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN
Sbjct: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60

Query: 61  KSDLKTITLKGLGLQNVSDVVELEVKNEEISXXXXXXXXXXXXXGNKQMSLKNYKSAIDK 120
           KSDLKTITLKGLGLQNVSDVVELEVKNEEIS             GNKQMSLKNYKSAIDK
Sbjct: 61  KSDLKTITLKGLGLQNVSDVVELEVKNEEISEDKKKEAEALKLEGNKQMSLKNYKSAIDK 120

Query: 121 YSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEG 180
           YSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEG
Sbjct: 121 YSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEG 180

Query: 181 NNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSGPPPLNTTDVL 240
           NNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSGPPPLNTTDVL
Sbjct: 181 NNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSGPPPLNTTDVL 240

Query: 241 TDIATVLGSSFGSLXXXXXXXXXXXXXXXXXXPEMMQQVEGLMQNPVVRQFAENVANGNG 300
           TDIATVLGSSFGSL                  PEMMQQVEGLMQNPVVRQFAENVANGNG
Sbjct: 241 TDIATVLGSSFGSLMNNTQMMQRAQQMMQTQNPEMMQQVEGLMQNPVVRQFAENVANGNG 300

Query: 301 PGGLSDVLNNPSVKEVANGLMNGYNVASSVTVEEPESKNPEKQ 343
           PGGLSDVLNNPSVKEVANGLMNGYNVASSVTVEEPESKNPEKQ
Sbjct: 301 PGGLSDVLNNPSVKEVANGLMNGYNVASSVTVEEPESKNPEKQ 343

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  233 bits (593), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 133/334 (39%), Positives = 192/334 (57%), Gaps = 19/334 (5%)

Query: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60
           M+ +NK+  ALIV+YL+ ++D KEVS DNA+SLNVA+DCI++ FE +  S +  +   FN
Sbjct: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60

Query: 61  KSDLKTITLKGLGLQNVSDVVELEVKNEEISXXXXXXXXXXXXXGNKQMSLKNYKSAIDK 120
            + L T  L G    + ++ +++ + ++                GNK M+ K+Y+SAI K
Sbjct: 61  GNGL-TSFLSG----SATNDIQVNIADDAADEEQKATAEGLKLEGNKAMATKDYESAIKK 115

Query: 121 YSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEG 180
           YS+AIE+ P+N  YY+NRAAAY  ++ + +AV DA +AIK++PTYSK YSRLG AK A+G
Sbjct: 116 YSEAIEVLPTNAVYYANRAAAYSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQG 175

Query: 181 NNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSGPPPLNTTDVL 240
             EDA+ A+KKVL++EGDK+T++MK DYE AKK V+  + L K  P        N     
Sbjct: 176 KVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTP-KEAETESNADAGT 234

Query: 241 TDIATVLGSSFGSLXXXXXXXXXXXXXXXXXXPEM-------------MQQVEGLMQNPV 287
                     F  L                  P++             MQQ+E +MQNP 
Sbjct: 235 GAAGMGGMGGFPDLSSMLGGGLGGGLGDLLKNPQIMQAAQQMMQNPNAMQQMESMMQNPA 294

Query: 288 VRQFAENVANGNGPGGLSDVLNNPSVKEVANGLM 321
           VRQ AEN A+G G   LS ++NNP +K++A  + 
Sbjct: 295 VRQMAENFASGEGTPDLSAMMNNPDLKDMAKNMF 328

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score =  222 bits (566), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 127/332 (38%), Positives = 190/332 (57%), Gaps = 12/332 (3%)

Query: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60
           MS++NKD  ALI+++L  ++D  EVSEDNA+SLNVA+DCI++ FE +  S   ++   F 
Sbjct: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60

Query: 61  KSDLKTITLKGLGLQNVSDVVE---LEVKNEEISXXXXXXXXXXXXXGNKQMSLKNYKSA 117
            + L +  L G    + +       ++V   E               GNK M+ K+Y+ A
Sbjct: 61  GNSLSSY-LNGSTSASAATTTADETVKVNVTEDDTEASEAAEALKLEGNKAMAGKDYELA 119

Query: 118 IDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKL 177
           I KY++AI   P+N  Y++NRAAAY  ++ +  AV DAN+AIK++PTYSK YSRLG AK 
Sbjct: 120 IKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKF 179

Query: 178 AEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSGPPPLNTT 237
           A+G  EDA+ A+KKVL++EGDK+TE+MK DYE AKK V+  + L K+    +     ++ 
Sbjct: 180 AQGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAESDSA 239

Query: 238 DVLTDIATVLG-SSFGSLXXXXXXXX-------XXXXXXXXXXPEMMQQVEGLMQNPVVR 289
                 A + G   F S+                         PE M+QVE +MQNP V+
Sbjct: 240 SAADPFAGMGGMPDFSSMLGGGGLGNLLNNPQLMQAAQQMMQDPEAMKQVESMMQNPSVK 299

Query: 290 QFAENVANGNGPGGLSDVLNNPSVKEVANGLM 321
           Q A+  ++GNG    S ++N+PS++++A  + 
Sbjct: 300 QMADQFSSGNGTPDFSALMNDPSIRDMAKNMF 331

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score =  219 bits (557), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 122/339 (35%), Positives = 191/339 (56%), Gaps = 34/339 (10%)

Query: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60
           MS +NKD   L+V++L   I+ K VS DNA+SLNVAIDCI++ FE             F 
Sbjct: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFE-------------FE 47

Query: 61  KSDLKTITLKGLGLQNVSDV------------------VELEVKNEEISXXXXXXXXXXX 102
           K D+K+      G ++++++                  V +  K+EE             
Sbjct: 48  KDDVKSTLASKFGGKSLTELLDAATNAKGRSSSPEDIKVSISDKDEEEDKELAAKAEALK 107

Query: 103 XXGNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLD 162
             GNK M+ K+Y  A++KY+ AI++ P+   YY+NRAAAY   E +  A+ DA +AIK++
Sbjct: 108 LEGNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVE 167

Query: 163 PTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLN 222
           P +SK YSRLG AK A+G +++A+ A+KK LE++GDK+T++MK DYE AKK V+  + + 
Sbjct: 168 PNWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVE 227

Query: 223 KNVPDPSGPPPLNTTDVLTDIATVLGSSFGSLXXXXXXXXXXXXXXXXXXPEMMQQVEGL 282
           K+    +      +   + D+A++LG   GS                   P  M+Q+E +
Sbjct: 228 KSATPSASASASASAGGMPDMASMLGGGLGSF--LNNPQIMQAAQQMMSNPRAMEQMESM 285

Query: 283 MQNPVVRQFAENVANGNGPGGLSDVLNNPSVKEVANGLM 321
           MQNP +RQ AEN+++G+   G+ D +NNP+++E+A+ L 
Sbjct: 286 MQNPSIRQMAENLSSGSSE-GMGDFMNNPAIREMASNLF 323

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score =  216 bits (551), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 129/353 (36%), Positives = 197/353 (55%), Gaps = 19/353 (5%)

Query: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60
           MS + ++  ALIVNY   I++ KE+SED A+SLNVA+DCIS+ F      E + ++ +  
Sbjct: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGF----EREAVSGILG 56

Query: 61  KSDLKTITLKGLGLQNVSDVVE---------LEVKNEEISXXXXXXXXXXXXXGNKQMSL 111
           KS+ K   L  + L + S V E         +E+   E               GNK M+ 
Sbjct: 57  KSEFKGQHLADI-LNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMAN 115

Query: 112 KNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSR 171
           K+Y+ AI+KY++AI++ P+N  YY+NRAAA+  ++++  AV DA +AI +DP+Y + YSR
Sbjct: 116 KDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSR 175

Query: 172 LGAAKLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSGP 231
           LG AK A+G  E+A+ A+KKVL++EGD +TE MK DYE+AKK V+  + L K VP+ S  
Sbjct: 176 LGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRD 235

Query: 232 PPLNTTDVLTDIATVLGSSFGSLXXXXXX---XXXXXXXXXXXXPEMMQQVEGLMQNPVV 288
             ++ +   +        S                         P  MQ ++ +MQ+P +
Sbjct: 236 ADVDASQGASAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSI 295

Query: 289 RQFAENVANGNGPGGLSDVLNNPSVKEVANGLMNGYNVASSVTVEEPESKNPE 341
           RQ AE  A+G G   LSD++NNP+++ +A  L  G    S  T E P+++N +
Sbjct: 296 RQMAEGFASGGGTPNLSDLMNNPALRNMAGNLFGGAGAQS--TDETPDNENKQ 346

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score =  213 bits (543), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 131/335 (39%), Positives = 189/335 (56%), Gaps = 17/335 (5%)

Query: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVF- 59
           M L+NK+   LIV+YL K+ +  +VSED  +SLNVAIDCI+D FE +  S   +I   F 
Sbjct: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60

Query: 60  --NKSDLKTITLKGLGLQNVS-DVVELEVKNEEISXXXXXXXXXXXXXGNKQMSLKNYKS 116
             +  +L  + ++    +NV+ +V + E++N+E               GNK M++K++  
Sbjct: 61  NLSLPELLEVAMENSAKENVTVNVPKDELENDE---ETKVKAEKLKLEGNKAMAMKDFDL 117

Query: 117 AIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAK 176
           AI KYS+AI I P+N  YY+NRAAAY  ++DF  A  DA +AI++DP YSK YSRLG AK
Sbjct: 118 AIAKYSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAK 177

Query: 177 LAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSGPPPLNT 236
            A    E+A+ A+KKVL+LEGDK+TE+MK DYE AKK V+  + L K     S P   + 
Sbjct: 178 YALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKK---ESTPKEESV 234

Query: 237 TDVLTDIATVLGSSFGSLXXXXXX------XXXXXXXXXXXXPEMMQQVEGLMQNPVVRQ 290
           T+   + A        S+                        P  M +++ +MQNP +RQ
Sbjct: 235 TESAANAAAGGFPDMSSMLGGGLNGLLNNPQLMQAAQQMMSDPNAMSKIQSMMQNPSIRQ 294

Query: 291 FAENVANGNGPGGLSDVLNNPSVKEVANGLMNGYN 325
            AEN  NGN P   S ++N+P++K++A     G N
Sbjct: 295 MAENFQNGNTP-DFSQLMNDPNIKDMAKNFFGGNN 328

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  212 bits (539), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 133/342 (38%), Positives = 199/342 (58%), Gaps = 32/342 (9%)

Query: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60
           MSL+NK+ G+LIV++L  +I  KE+SED+A+SLNVAIDCI++ FE +  +  + + D F+
Sbjct: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60

Query: 61  KSDLKTITLKGLGLQNVSDV-----VELEVKNEEISXXXXXXXXXXXXXGNKQMSLKNYK 115
              LK I          S+      V + V++ EI              GNK M+ K+Y+
Sbjct: 61  GKTLKEILSSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLE----GNKAMAAKDYR 116

Query: 116 SAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAA 175
            AI+KYS+AI+  P+N  YY+NRAAAY  ++++ NA+ DA  AI++DP YSK YSRL  A
Sbjct: 117 LAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFA 176

Query: 176 KLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKN---VPDPS--- 229
           K A    E+A+  +KKVL++EGDK+T  MK D+E AK  V++ + L K+    P+PS   
Sbjct: 177 KYALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSA 236

Query: 230 GPPPLN--TTDVLTDIATVLG--------SSFGSLXXXXXXXXXXXXXXXXXXPEMMQQV 279
           G  P N      + D++++ G        SSF                     P  MQ++
Sbjct: 237 GQQPANPFAGSGMPDMSSLFGNGGGMGGLSSF-----LNNPQVMQAAQQMMSDPNSMQKM 291

Query: 280 EGLMQNPVVRQFAENVANGNGPGGLSDVLNNPSVKEVANGLM 321
           + +MQNP +R+ A+N+A+G+    L D++NNPSVK++AN L 
Sbjct: 292 QEMMQNPNLREMAQNLASGD--ANLDDLMNNPSVKDMANNLF 331

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score =  211 bits (537), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 129/357 (36%), Positives = 191/357 (53%), Gaps = 29/357 (8%)

Query: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60
           MS +  +  +LIVNY   I++ KE+SED+A+SLNVA+DCIS+ F      E + +  +  
Sbjct: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGF----EREAVPSILE 56

Query: 61  KSDLKTITLKGLGLQNVSDVVE---------LEVKNEEISXXXXXXXXXXXXXGNKQMSL 111
            S+ K   L  L L + S V E         +EV   E               GNK M+ 
Sbjct: 57  NSEFKGQNLTDL-LNSTSRVSESTKKDDAQNVEVNIPEEDAEIKAKAEDLKMQGNKAMAN 115

Query: 112 KNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSR 171
           K+Y+ AI+KY++AI++ P+N  YY+NRAAA+  ++ +  AV DA +AI +DPTY + YSR
Sbjct: 116 KDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSR 175

Query: 172 LGAAKLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSGP 231
           LG AK A+G  E+A+ A+KKVL++EGD +TE MK DYE+AKK V+  + L K VP+ S  
Sbjct: 176 LGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQS-- 233

Query: 232 PPLNTTDVLTDIATVLGSSFGSLXXXXXXXXX----------XXXXXXXXXPEMMQQVEG 281
                 D   D +   G+S                                P  MQ ++ 
Sbjct: 234 ---RDADANADASQGAGTSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQK 290

Query: 282 LMQNPVVRQFAENVANGNGPGGLSDVLNNPSVKEVANGLMNGYNVASSVTVEEPESK 338
           +MQ+P ++Q AE   +G G   LSD++NNP+++ +A  L  G    S+    + E+K
Sbjct: 291 MMQDPNIKQMAEGFTSGGGAPNLSDLMNNPALRSMAGNLFGGAGAPSTEDTSDSENK 347

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score =  210 bits (535), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 128/357 (35%), Positives = 191/357 (53%), Gaps = 31/357 (8%)

Query: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60
           M  + ++  ALIVNY   I++ KE+SED A+SLNVA+DCIS+ F      E    + +  
Sbjct: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGF----ERDAASGILG 56

Query: 61  KSDLKTITLKGLGLQNVS---------DVVELEVKNEEISXXXXXXXXXXXXXGNKQMSL 111
           KS+ K  +L  + L + S         D   +EV   E               GNK M+ 
Sbjct: 57  KSEFKGKSLADV-LNSASKASESNEKDDAQNVEVNIPEEDAETKAKAEDLKMQGNKAMAN 115

Query: 112 KNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSR 171
           K+Y+ AI+KY++AI++ P+N  YY+NRAAA+  + ++  AV DA ++I +DP+Y + YSR
Sbjct: 116 KDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSR 175

Query: 172 LGAAKLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSGP 231
           LG AK A+G  E+A+ A+KKVL++EGD +TE MK DYE+AKK V+  + L K VP+ S  
Sbjct: 176 LGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQS-- 233

Query: 232 PPLNTTDVLTDIATVLGSSFGSLXXXXXXXXX----------XXXXXXXXXPEMMQQVEG 281
                 D   + +   GSS                                P  MQ ++ 
Sbjct: 234 -----RDADANASQGAGSSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQK 288

Query: 282 LMQNPVVRQFAENVANGNGPGGLSDVLNNPSVKEVANGLMNGYNVASSVTVEEPESK 338
           +MQ+P +RQ AE   +G G   LSD++NNP+++ +A  L  G +  SS    + E+K
Sbjct: 289 MMQDPSIRQMAEGFTSGGGAPNLSDLMNNPALRNMAGNLFGGADAPSSEGTPDSENK 345

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score =  209 bits (531), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 125/332 (37%), Positives = 192/332 (57%), Gaps = 23/332 (6%)

Query: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60
           M+ +NK+  ALIV++L   ++   VSED A+SLNVAIDCIS+ FE +  +  +I+ + F+
Sbjct: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60

Query: 61  KSDL-KTITLKGLGLQNVSDVVELEVKNEEISXXXXXXXXXXXXXGNKQMSLKNYKSAID 119
              L + +      L   S+ V++ +  E+ +             GNK M+ K++++AI 
Sbjct: 61  NRKLDELLKSAATALPTQSEPVKVNIPAEDANTKAKAEDLKLQ--GNKAMASKDFETAIK 118

Query: 120 KYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAE 179
           KY++AIE+ PSN  YY+NRAAAY  ++ +  +V DA +AIK++P+YSK YSRLG AK A 
Sbjct: 119 KYTEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYAL 178

Query: 180 GNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSGPPPLNTTDV 239
           G  E+A+ A+K VL++EGDK+T+VMK DYE AK+ V+  + L K+VP  +     +  + 
Sbjct: 179 GKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQT-----DEQES 233

Query: 240 LTDIATVLGSSFGSLXXXXXXXXXXXXXXXXXXPEMMQQVEGLMQ----------NPVVR 289
            TD A    S F  +                  P++M   + LMQ          NP VR
Sbjct: 234 STD-AGAGASGFPDM----ASLLGGGLGGLLNNPQVMSAAQKLMQNPGAMDEMMKNPAVR 288

Query: 290 QFAENVANGNGPGGLSDVLNNPSVKEVANGLM 321
           Q AEN ++G G   L D+++NP++K++A  L 
Sbjct: 289 QMAENFSSGGGTPNLGDLMSNPAIKDMAKNLF 320

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score =  209 bits (532), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 124/338 (36%), Positives = 182/338 (53%), Gaps = 24/338 (7%)

Query: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKII----- 55
           MS +NK+  +LIV+YL ++++ K VSE+  +SLNVAIDCI + FE+     + +      
Sbjct: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAVFGGKGL 60

Query: 56  -----NDVFNKSDLKTITLKGLGLQNVSDVVELEVKNEEISXXXXXXXXXXXXXGNKQMS 110
                N+  + S+  T   + + +   ++  E + K E +              GNK M+
Sbjct: 61  VELLQNESGSSSETATTQAESIKVNIPAEDAETKAKAETLKLE-----------GNKAMA 109

Query: 111 LKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYS 170
            K++  AI KYS AIE+ P+N  YY+NRAAA+  ++ +  A+ DA +AIK DPTYSK YS
Sbjct: 110 CKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYS 169

Query: 171 RLGAAKLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSG 230
           RLG AK A G  EDA+ A+KKVL++EGDK+++VMK DYE AKK V+  + L K     + 
Sbjct: 170 RLGYAKFALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQAR 229

Query: 231 PPPLNTTDVLTDIATVLGSSFGSLXXXXXX---XXXXXXXXXXXXPEMMQQVEGLMQNPV 287
                             +S                         P+ M Q+E +MQNP 
Sbjct: 230 GADAGAGGAGGSGGFGDFASMLGGGLGGLLNNPQLMQAAQQMMQNPQAMSQMESMMQNPG 289

Query: 288 VRQFAENVANGNGPGGLSDVLNNPSVKEVANGLMNGYN 325
           VRQ AEN A GNG   + D++NNP+++++A  L  G N
Sbjct: 290 VRQMAENFAQGNGMPNMGDLMNNPALRDMAGSLFGGAN 327

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score =  207 bits (527), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 126/335 (37%), Positives = 192/335 (57%), Gaps = 40/335 (11%)

Query: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60
           M+ +NKD  +LIV+YL  ++D K VSED+ +SLNVAI+CI++ F ++  S        F 
Sbjct: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSA----AFG 56

Query: 61  KSDLKTITLKGLGL-----QNV-----SDVVELEVKNEEISXXXXXXXXXXXXXGNKQMS 110
             +L  +   G G      +NV     ++  EL+ K E +              GNK M+
Sbjct: 57  GKNLAELLSAGAGAPSSQGENVKVNIPAEDAELKSKAESL-----------KLEGNKAMA 105

Query: 111 LKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYS 170
            K+Y+ AI KYS+AI + P+N  YY+NRAAA+  ++++  A+ DA +A+K+D +YSK YS
Sbjct: 106 GKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYS 165

Query: 171 RLGAAKLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNK------- 223
           RLG AK A+G +E+A+ A+KKVL++EGD +T+VMK DYE AK+ V+  + LNK       
Sbjct: 166 RLGYAKFAQGKSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETS 225

Query: 224 --NVPDPSGPPPLNTTDVLTDIATVLGSSFGSLXXXXXXXXXXXXXXXXXXPEMMQQVEG 281
                +P+G  P    D+ + +   LG    +                   P+ M Q+E 
Sbjct: 226 DRGTGEPAGANPGGGFDLSSMLGGGLGGLLNN------PQVMQAAQQMMQNPQAMSQMET 279

Query: 282 LMQNPVVRQFAENVANGNGPGGLSDVLNNPSVKEV 316
           +MQNP VRQ AE  A GNG   L+D++NNP+++++
Sbjct: 280 MMQNPNVRQMAEKFAGGNGTPNLNDIMNNPALRDM 314

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score =  204 bits (519), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 129/351 (36%), Positives = 191/351 (54%), Gaps = 40/351 (11%)

Query: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60
           MSLNNKD GALIV++L  II+  EVSEDNA+SLNVA+DCIS+  E D     + I + FN
Sbjct: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60

Query: 61  KSDLKTITLKGLGLQNVSDV-------VELEVKNEEISXXXXXXXXXXXXXGNKQMSLKN 113
              L  I          + +       V + V++ EI              GNK M++K+
Sbjct: 61  GKTLVDILNTTSTATANTTIEKEESVEVNIPVEDAEIKANAEAFKLE----GNKAMAMKD 116

Query: 114 YKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLG 173
           +  A++KY++AI+I P+N  YY+NRAAA+  +++F  A+ DA +AIK+DP+YSK YSRL 
Sbjct: 117 FHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLA 176

Query: 174 AAKLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNK---------- 223
            AK   G +E+A+ ++KKVL++EGD +T  MK DYE AKK V+  + + K          
Sbjct: 177 FAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQ 236

Query: 224 ---------NVPDP--SGPPPLNTTDVLTDIATVLGSSFGSLXXXXXXXXXXXXXXXXXX 272
                    N P+P   G P +++      +   LGS   +                   
Sbjct: 237 QQTNESAQGNAPNPFAGGMPDMSSLFGGAGMGGGLGSLLSN------PDFMSTAQKLMSD 290

Query: 273 PEMMQQVEGLMQNPVVRQFAENVANGNGPGGLSDVLNNPSVKEVANGLMNG 323
           P  MQQV+ +M +P +R  A N  NGN    ++D++NNP+++ +A+ L  G
Sbjct: 291 PNAMQQVQSMMSDPSMRDLANNFKNGN--TDMNDIMNNPAIRNMASNLFKG 339

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score =  201 bits (512), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 119/330 (36%), Positives = 184/330 (55%), Gaps = 12/330 (3%)

Query: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60
           M+ +NK+  +LI++YL+K++   EVS D+ +SLNVAIDC+++VF ++  +    I   FN
Sbjct: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60

Query: 61  KSDLKTITLKGLGLQNVSDVVELEVKNEEIS-----XXXXXXXXXXXXXGNKQMSLKNYK 115
              L    L     QN  +  E + +  +I+                  GNK ++ K+Y 
Sbjct: 61  GKSL--TELLDAASQNAGNTDECKTETVKINIPQEDAETKAKAEALKLEGNKAVASKDYD 118

Query: 116 SAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAA 175
            A++KY++AI+I P+N  Y++NRAAAY   +++  AV DA  AIKLDP YSK YSRL  A
Sbjct: 119 LAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYA 178

Query: 176 KLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSGPPPLN 235
           K  + N E+++ A+KKVLE+EGD +TEV K  YE AKK V+  + L K+VP  S     N
Sbjct: 179 KYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGGQTN 238

Query: 236 --TTDVLTDIATVLGSSFGSLXXXXXXXXXXXXXXXXXXPEMMQQVEGLMQNPVVRQFAE 293
                   D ++++      L                  P  M++++ +MQNP ++Q AE
Sbjct: 239 PAAGGGFPDFSSLMSGGLEGL--MNNPQMMQAAQSMMSNPGAMEKIQSMMQNPAIQQMAE 296

Query: 294 NVANGNGPGGLSDVLNNPSVKEVANGLMNG 323
               GN P   S+++NNP+V+ +A+ L +G
Sbjct: 297 QFKGGNTP-DFSEMMNNPAVRNMASSLFSG 325

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score =  200 bits (509), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 121/355 (34%), Positives = 189/355 (53%), Gaps = 27/355 (7%)

Query: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60
           MS + ++  +LIVNY   I++ KEVSED+A+SLNVA+DCIS+ F      E   ++ + +
Sbjct: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGF----ERDAVSSILD 56

Query: 61  KSDLK----------TITLKGLGLQNVSDVVELEVKNEEISXXXXXXXXXXXXXGNKQMS 110
           KS  K          +  L   G ++ +  VE+ +  E+               GNK M+
Sbjct: 57  KSTFKGQSLNNLLSSSSKLPESGKKDDAQNVEVNIPEED--AETKAKAEELKIQGNKAMA 114

Query: 111 LKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYS 170
            K Y+ AI KY++AI++ P+N  YY+NRAAA+  ++++  A+ DA +AI +DP+Y + YS
Sbjct: 115 NKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYS 174

Query: 171 RLGAAKLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSG 230
           RLG AK A+G  E+A+ A+KKVL++EGD +T+ MK DYE+AKK V+  + L K  P+   
Sbjct: 175 RLGFAKYAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPE--- 231

Query: 231 PPPLNTTDVLTDIATVLGSSFGSLXXXXXXXX-------XXXXXXXXXXPEMMQQVEGLM 283
             P +        A   G                               P  MQ ++ +M
Sbjct: 232 -QPRDAGANAGQGAGAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQNMM 290

Query: 284 QNPVVRQFAENVANGNGPGGLSDVLNNPSVKEVANGLMNGYNVASSVTVEEPESK 338
           Q+P +RQ AE   +G G   LSD++ NP+++ +A  L  G +  S+    + E+K
Sbjct: 291 QDPSIRQMAEGFTSGGGTPNLSDLMKNPALRNMAGSLFGGADAPSTEDTPDSETK 345

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score =  199 bits (507), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 117/331 (35%), Positives = 183/331 (55%), Gaps = 23/331 (6%)

Query: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60
           MS +NKD  ALIV++L      K V ED  +SL VAIDCI++ FEL P   + ++++   
Sbjct: 1   MSPSNKDIAALIVDFL--TTSAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCG 58

Query: 61  KSDLKTITLKGLGLQNVSDVVELEVKNEEISXXXXXXXXXXXXXGNKQMSLKNYKSAIDK 120
              L  +   G+   + SD  E +V  EE+              GN+ M+ K+Y++AI K
Sbjct: 59  GRSLSQLLTTGMA--HTSDAGEPKVAAEELKKEAEALKLE----GNRAMAAKDYETAIQK 112

Query: 121 YSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEG 180
           Y+ AIE+ P++  YY+NRAAAY  ++ +  AV DA  A K+D +YSK +SRLG AK A G
Sbjct: 113 YTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALG 172

Query: 181 NNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNV---PDPSGPPPLNTT 237
            +E+A+ A+K+VL++EGD +TE M+ DYE+AK+ V+  + +++N                
Sbjct: 173 RHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTESGDSAAGSAGG 232

Query: 238 DVLTDIATVLGSSFGSLXXXXXXXXXXXXXXXXXXPEMMQQVEGLMQ----------NPV 287
             L D+A++ G     L                  P++MQ  + +MQ          NP 
Sbjct: 233 SGLPDLASMFGGG--GLGGGLGGGLGGGLGGLLNNPQVMQAAQKMMQNPSAIQEMMSNPA 290

Query: 288 VRQFAENVANGNGPGGLSDVLNNPSVKEVAN 318
           +++ AEN A+GNG  GL D++ +P+V+ +A+
Sbjct: 291 IKKMAENFASGNGSSGLGDLMADPAVRNMAS 321

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score =  191 bits (484), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 114/330 (34%), Positives = 183/330 (55%), Gaps = 27/330 (8%)

Query: 5   NKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFNKSDL 64
           +K+  A+I+ YL  ++  K V ED  +S+NVAIDCI++ FE+    E   ++ V  +S +
Sbjct: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEV----ERGDVDSVLKQSGI 57

Query: 65  KTITLKGLGLQNVSDVVEL-EVKNEEIS-------XXXXXXXXXXXXXGNKQMSLKNYKS 116
                   GL+   + ++   VK+E++                     GNK M+ K+++ 
Sbjct: 58  SK------GLEECLECMKGGAVKSEDVKVNIPAEDAETKAKAEALKLEGNKAMAGKDFEL 111

Query: 117 AIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAK 176
           AI KYS+AIE+ P+N  YY+NRAAA+  ++ +  AV+DA  AI++DP YSK YSRLG AK
Sbjct: 112 AIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAK 171

Query: 177 LAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSGPPPLNT 236
            A+   E+A+ A+KKV++LEGDK+T++MK DYE AKK V+  + L K  PD  G      
Sbjct: 172 YAQNKPEEALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEK-TPDARGADSGAG 230

Query: 237 TDVLT------DIATVLGSSFGSLXXXXXXXXXXXXXXXXXXPEMMQQVEGLMQNPVVRQ 290
                      D +++L      L                  P+ +QQ++ +MQ+P +RQ
Sbjct: 231 AGAGAGGAGGFDFSSMLSGGLSGL--MNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQ 288

Query: 291 FAENVANGNGPGGLSDVLNNPSVKEVANGL 320
            AE   +GNG   + D+++NP+++ +A+ +
Sbjct: 289 MAEQFTSGNGTPNMDDLMSNPALRNMASSM 318

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score =  190 bits (482), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 117/336 (34%), Positives = 184/336 (54%), Gaps = 30/336 (8%)

Query: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60
           MS +NKD   LIV++L   ++ KEVSED  +SLNVAIDCI++ FE D  S    +   F 
Sbjct: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60

Query: 61  KSDLKTIT-LKGLGLQNVSDVVELEVKNEEISXXXXXXXXXXXXXGNKQMSLKNYKSAID 119
              LK +     +G  +  + V++ +  E+               GNK M+ K+++ A+ 
Sbjct: 61  GRSLKQVVEAASVGSSSPQESVKVNIPVED--AETKAKAESLKLEGNKAMAAKDFEQAVL 118

Query: 120 KYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAE 179
           KYS+AI++ P+N  YY+NRAAA+  ++ +  AV DA  AIK++P+YSK YSRLG A+ A 
Sbjct: 119 KYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYAL 178

Query: 180 GNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPS--GPPPLNTT 237
           G  E+A+ A+KKVL++EG+ +T+ MK DY+ A K V   + + K+ P  +  G      +
Sbjct: 179 GKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDGAGSATGS 238

Query: 238 DVLTDIATVLGSSFGSLXXXXXXXXXXXXXXXXXXPEMMQQVEGLMQ----------NPV 287
             L DI+++LG                        P++MQ  + +MQ          NP 
Sbjct: 239 GGLPDISSMLGGG---------------LGGLLNNPQLMQAAQQMMQNPNAMQEVMNNPA 283

Query: 288 VRQFAENVANGNGPGGLSDVLNNPSVKEVANGLMNG 323
           V+Q AE   +G G   ++D++NNP++ ++A  +  G
Sbjct: 284 VKQMAEKFQSGGGTPSMADLMNNPALMDMAKNMFGG 319

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score =  187 bits (475), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 124/341 (36%), Positives = 182/341 (53%), Gaps = 26/341 (7%)

Query: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60
           MSL+NK+  ALIV++L        V+ED  +SLNVAIDCI++ F+ +    + +I+  FN
Sbjct: 1   MSLSNKEIAALIVDFLSSSS--SSVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFN 58

Query: 61  KSDLKTITLKGLGLQNVS-DVVELEVKNEEISXXXXXXXXXXXXXGNKQMSLKNYKSAID 119
              L  +         VS + V++ +  E+ +             GNK M+ K +  AI+
Sbjct: 59  GKKLPELLASAPSSGGVSGEPVKVHIPVEDAAAKAKAEELKLQ--GNKAMAAKKFDEAIE 116

Query: 120 KYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAE 179
           KY+ AIE+ PSN  YYSNRAAAY  ++ +  AV DA  AI++DPTYSK +SRLG AK A 
Sbjct: 117 KYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYAL 176

Query: 180 GNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSGPPPLNTTDV 239
              E+A+ A+KKVL++EG+K+T+VMK DYE AKK V+T + L K+    S      + DV
Sbjct: 177 NKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLEKSSTSAS------SEDV 230

Query: 240 LTDIAT-----VLGSSFGSLXXXXXXXXXXXXXXXXXXPEMMQQVEGLMQ---------- 284
               AT       G                        P++MQ  E +MQ          
Sbjct: 231 SDKSATEGPGAGAGGLPDLSSLLGGGGLGGGLGALLNNPQVMQAAEKMMQNPGLMQDMMS 290

Query: 285 NPVVRQFAENVANGNGPGGLSDVLNNPSVKEVANGLMNGYN 325
           NP ++Q A   ++G G   LS ++N+PS++++A  +  G N
Sbjct: 291 NPAMKQMANQFSSGGGMPDLSQMMNDPSIRDMAKNMFGGGN 331

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score =  182 bits (462), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 113/337 (33%), Positives = 179/337 (53%), Gaps = 27/337 (8%)

Query: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60
           M+   K+  +LI++YL +  +GKE+ ED  +SLNVAIDC+++ FE++  S   +I   F 
Sbjct: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60

Query: 61  KSDLKTI---TLKG-LGLQNVSDVVELEVKNEEISXXXXXXXXXXXXXGNKQMSLKNYKS 116
              L+ I   + KG    Q     V + V++ EI              GNK M+ K+++ 
Sbjct: 61  GQSLEQIVGASSKGPTATQQEPVKVNIPVEDAEIKAKAEALKLE----GNKAMATKDFEH 116

Query: 117 AIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAK 176
           AI KYS+AI   PSN  Y++NRAAAY  ++ +  AV DA  AIK++P+YSK YSRLG A+
Sbjct: 117 AISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQ 176

Query: 177 LAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSGPPPLNT 236
            A G  E+A+ A+KKVL++EG  +T+ MK DY+ A K V+  + + ++ P  S     + 
Sbjct: 177 YALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAESPDA 236

Query: 237 TDVLTDIATVLGSSFGSLXXXXXXXXXXXXXXXXXXPEMMQQVEGLMQ----------NP 286
                      GS F  +                  P++MQ  + +MQ          NP
Sbjct: 237 AG---------GSGFPDIASMLGGGLGGGLGGLLKNPQVMQAAQQMMQNPNAMQEMMSNP 287

Query: 287 VVRQFAENVANGNGPGGLSDVLNNPSVKEVANGLMNG 323
            ++Q A+   +G G   ++D++NNP++ ++A  +  G
Sbjct: 288 AIKQMADKFQSGGGTPSMADLMNNPALMDMAKNMFGG 324

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score =  179 bits (454), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 111/327 (33%), Positives = 172/327 (52%), Gaps = 26/327 (7%)

Query: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60
           M  +NK+  ALIV +L      K+V E+  +SLNVAIDCI++ FE++     +I++  +N
Sbjct: 1   MPGSNKEIAALIVQFLS--TSTKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYN 58

Query: 61  KSDLKTITLKGLGLQNVSDVVELEVKNEEISXXXXXXXXXXXXXGNKQMSLKNYKSAIDK 120
              L  +   G     +S         +  +             GNK  + K+++ A+ K
Sbjct: 59  GRGLVDLVKSGASEPTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKK 118

Query: 121 YSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEG 180
           Y++AIE+ P+N  +Y NRAAAY   + F  AV DA +A++++P+YS+ YSRLG AK A G
Sbjct: 119 YTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALG 178

Query: 181 NNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSGPPPLNTTDVL 240
             E+A+ A+KKVL++EGD +TE MK DYE+AKK V+  + L      P G          
Sbjct: 179 KPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLE---ALPKG---------- 225

Query: 241 TDIATVLGSSFGSLXXXXXXXXXXXXXXXXXXPEMMQQVEGLMQ----------NPVVRQ 290
            +  T  GSS G                    P++MQ  + +MQ          NP ++Q
Sbjct: 226 EEQQTSEGSSAGGF-PDLSSMLGGGLGGLLNNPQVMQAAQKMMQNPSAMQEMMNNPAIKQ 284

Query: 291 FAENVANGNGPGGLSDVLNNPSVKEVA 317
            A+N A+G G   L D++ +P++K++A
Sbjct: 285 MAQNFASGGGTPNLGDMMKDPNIKDMA 311

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score =  143 bits (361), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 93/229 (40%), Positives = 134/229 (58%), Gaps = 26/229 (11%)

Query: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60
           MSL+NK+  + IV+YL  +I   +V+ED AES++VAI+CI D F+L    +E++  D   
Sbjct: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDL----QEEVSAD--- 53

Query: 61  KSDLKTITLKGLGLQNVSDVVE--LEVKNEEISXXXXXXXXXXXXXGNKQMSLKNYKSAI 118
            SDL T+ L  L L+    + E   E+ NE+               GNK +  +NYK AI
Sbjct: 54  -SDLATVLLANLNLEPEPKLSEKERELVNEQ--------AIKLKLEGNKAVERENYKDAI 104

Query: 119 DKYSKAIEIYPSNPF-----YYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLG 173
           DKY++AI++   N       Y SN++ A      +  A  DA   IK+DPT+SK YSRL 
Sbjct: 105 DKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLA 164

Query: 174 AAKLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLN 222
            AK+ +   EDA++A+K+VL+LEG+K+T+ MK D+E  K   Q F TLN
Sbjct: 165 EAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITK---QKFETLN 210

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score =  139 bits (350), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 116/374 (31%), Positives = 181/374 (48%), Gaps = 61/374 (16%)

Query: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60
           M+  +++  ++IV+Y +K I   ++++DN +SLNVAIDCI+DVF++D      I+   + 
Sbjct: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60

Query: 61  KSDLKTITLKG----LGLQ------NVS------------------------DVVE--LE 84
            +DL T    G    L L       NVS                         V+E   E
Sbjct: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120

Query: 85  VKNEEISXXXXXXXXXXXXXGNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQM 144
            K  ++S             GN++M  K Y  AI  YS AI++YP+N  YY+NRA AY  
Sbjct: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180

Query: 145 IEDFTNAVLDANTAIKLD----PTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLEL----- 195
             +F +A++DAN +I++D    PT  KAY RLG AK   G+ E ++ AFK+++E+     
Sbjct: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240

Query: 196 EGDKSTEVMKNDYENAKKLVQT--FVTLNKNVPDPSGPPPLN----TTDVLTDIATVLGS 249
           +GD+ T+ M  DYE AK+ VQ   F+ + K+         +N        L DI  + G+
Sbjct: 241 KGDEITKQMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMAGN 300

Query: 250 SFGSLXXXXXXXXXXXXXXXXXXPEMMQQVEGLMQNPVVRQFAENVANGNGPGGLSDVLN 309
           +  ++                  P+  QQ + +M +P VRQ  ENV         SD ++
Sbjct: 301 NL-NIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENVN--------SDSMS 351

Query: 310 N-PSVKEVANGLMN 322
           N P +K++   L+N
Sbjct: 352 NIPILKDLFYSLLN 365

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score =  134 bits (338), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 107/362 (29%), Positives = 161/362 (44%), Gaps = 68/362 (18%)

Query: 3   LNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFNKS 62
           +N+KD   LIVN+L  +I  KE+S+DN +SLNVAIDCI   + L+       +   F+KS
Sbjct: 6   INDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYISSSLILKFSKS 65

Query: 63  DLKTITLKGLGLQNVSDVVELE---------------VK----------NEEISX----- 92
           DL +I L      N  ++   +               VK          NE+IS      
Sbjct: 66  DLTSI-LNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDT 124

Query: 93  -------XXXXXXXXXXXXGNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMI 145
                              GN+ M  ++YK AI+ Y+ AI  YP +P YYSNR+ AY  +
Sbjct: 125 SKNNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKV 184

Query: 146 EDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGDKSTEVMK 205
            D+ +A+ DAN  I +D  +SKAY RL   K+ +    DA+  +KK +EL  D   E + 
Sbjct: 185 NDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKIT 244

Query: 206 NDYENAKKLVQTFVTLNKNVPDPSGPPPLNTTDVLT----DIATVLGSSFGSLXXXXXXX 261
            ++E+ K  VQT ++L +   D S       +   T    DI ++LG  F +L       
Sbjct: 245 REFEDLKLKVQTDISLREISNDHSNNNYNENSYNSTKNSPDIGSILGDGFAAL------- 297

Query: 262 XXXXXXXXXXXPEMMQQVEGLMQNPVVRQFAENVANGNGPGGLSDVLNNPSVKEVANGLM 321
                      P + Q +  ++QN           N +    +  VL NP++K +     
Sbjct: 298 --------LSNPMLQQMIFKIIQN-----------NPDAAKNIGYVLANPAMKNLLQNFK 338

Query: 322 NG 323
           NG
Sbjct: 339 NG 340

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score =  127 bits (318), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 110/370 (29%), Positives = 161/370 (43%), Gaps = 101/370 (27%)

Query: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELD----PTSEEKIIN 56
           MSL  +   +LI++YL  + +   + ED  ESL VAI CI + F LD    PTS      
Sbjct: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTS------ 54

Query: 57  DVFNKSDLKTITLKGLGLQNVSDV-VELEVKNEEISXXXXXXXXXXXXXGNKQMSLKNYK 115
                  LK  TLK +  +N++ +    ++ NEE               GN+ M    Y+
Sbjct: 55  -------LKERTLKTILQENLNTLEATQKIHNEE--------AEALKKEGNEAMIEGQYE 99

Query: 116 SAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAA 175
            AI KY++AI+ +  N  YYSNR+ AY  +  + +AV DA  AI +DP++SKAYSRLG A
Sbjct: 100 EAIKKYTEAIQ-FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYA 158

Query: 176 KLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKN----------- 224
           K  +   ED + A+K+ ++LEG  +++ + +DYE+A+     +  L KN           
Sbjct: 159 KCCQDKLEDGMTAYKRAIDLEGTNASKTLYDDYEDARF---KYEQLKKNDDSEERKSIKE 215

Query: 225 VPDPSGPPPLNTTDV------------------------------LTDIATVLGSSFGSL 254
           V     P   N  D                               L++IA +LGS  G  
Sbjct: 216 VTSEECPEKNNNQDEGFTAVNHYAQNNDNKSKEETKEENRSQAADLSNIARLLGSGVG-- 273

Query: 255 XXXXXXXXXXXXXXXXXXPEMMQQVEGLMQNPVVRQFAENVANGN--GPGGLSDVLNNPS 312
                                     GLM NP ++Q      N N      + DVLNNP 
Sbjct: 274 --------------------------GLMNNPQLKQMVFQAINDNPDASRQVKDVLNNPL 307

Query: 313 VKEVANGLMN 322
           ++   + LMN
Sbjct: 308 LRTTLSELMN 317

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 86.7 bits (213), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 48/110 (43%), Positives = 70/110 (63%), Gaps = 3/110 (2%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS-NPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDP 163
           GN   S K Y+ A+D +SKAIE+ P  N   YSNR+A Y  ++ FT+A+ DAN   K++P
Sbjct: 12  GNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDANECTKINP 71

Query: 164 TYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKK 213
           T+SK Y+R+GAA    G+ ++A  ++KK LEL  D S +V +   E  K+
Sbjct: 72  TWSKGYNRVGAAHYGLGDLDEAEKSYKKALEL--DASNKVAQEGLEQVKR 119

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 56/117 (47%), Gaps = 6/117 (5%)

Query: 114 YKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLG 173
           +  A+  Y++ I   P +   YSNRAAA   +  F  A+ D   A++ DP + KAY R  
Sbjct: 408 WPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEKALEKDPNFVKAYIRKA 467

Query: 174 AAKLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSG 230
            A++A      A+      L++   K TE+  N+  N +++ Q +    +   +P+ 
Sbjct: 468 TAQIAIKEYSSALE----TLDIARSKDTEL--NNGSNIREINQLYAKATQQRFEPAS 518

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 84.3 bits (207), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/94 (45%), Positives = 64/94 (68%), Gaps = 1/94 (1%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS-NPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDP 163
           GN     K+Y+ AID +SKAIE+  + N  +YSNR+A Y  ++ F  A+ DA   +K++P
Sbjct: 11  GNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDAEECVKINP 70

Query: 164 TYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEG 197
           T+SK Y+RLGAA L  G+ ++A  ++KK LEL+G
Sbjct: 71  TWSKGYNRLGAAHLGLGDLDEAEGSYKKALELDG 104

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 61/119 (51%), Gaps = 8/119 (6%)

Query: 113 NYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRL 172
           ++ +A+  Y++ I+  P +   YSNRAAA   +  F  A+ D N AI+ DP + +AY R 
Sbjct: 405 DWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCNKAIEKDPNFIRAYIRK 464

Query: 173 GAAKLAEGNNEDAVHAFKKVLE-LEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSG 230
             A++       AV  F   +E L+  ++ +   N+  N +++ Q +V  ++    P+ 
Sbjct: 465 ATAQI-------AVKEFAAAIETLDAARTKDAEVNNSANVREIDQLYVKASQQRFQPAS 516

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/94 (44%), Positives = 63/94 (67%), Gaps = 1/94 (1%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS-NPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDP 163
           GN   + K+Y  AID ++KAIE+  + N   YSNR+A Y  ++ FT+A+ DA   +K++P
Sbjct: 12  GNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDATECVKINP 71

Query: 164 TYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEG 197
           ++SK Y+RLGAA L  G+ +DA   +KK LEL+ 
Sbjct: 72  SWSKGYNRLGAAHLGLGDLDDAESNYKKALELDA 105

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 60/115 (52%), Gaps = 8/115 (6%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           G +  +  ++ +A+  Y++ I+  P +   YSNRAAA   +  F  A+ D N AI+ DP 
Sbjct: 400 GKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 459

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLE-LEGDKSTEVMKNDYENAKKLVQTF 218
           + +AY R   A++       AV  F   LE L+  ++ +   N+  +AK++ Q +
Sbjct: 460 FVRAYIRKATAQI-------AVQEFAGALETLDAARTKDAEVNNGASAKEIDQLY 507

 Score = 33.5 bits (75), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 50/96 (52%), Gaps = 8/96 (8%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAI----K 160
           GNK    + ++ AI+ Y+KA E++  +  Y +NRAAA     D+  A+     A+    +
Sbjct: 266 GNKFYKARQFEEAIEHYNKAWELH-RDITYLNNRAAAEYEKGDYETAIATLTDAVEQGRE 324

Query: 161 LDPTY---SKAYSRLGAAKLAEGNNEDAVHAFKKVL 193
           +   Y   SK+++R+G A    G+ +  +  ++K L
Sbjct: 325 MRADYKVISKSFARIGNAYHKLGDLKKTIDNYQKSL 360

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 80.1 bits (196), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 60/94 (63%), Gaps = 1/94 (1%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS-NPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDP 163
           GN     KNY  AI+K++KAIE+  + N   YSNR+A Y   + F   + DAN  +K++P
Sbjct: 12  GNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDANECVKINP 71

Query: 164 TYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEG 197
           T+SK Y+R+GAA    G+ ++A  A+KK LEL+ 
Sbjct: 72  TWSKGYNRVGAAHFGMGDLDEAEKAYKKALELDS 105

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 66/126 (52%), Gaps = 8/126 (6%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           G +  +  ++ +A+  Y++ I   PS+   YSNRAAA   +  F  A+ D NTAI+ DP 
Sbjct: 396 GKEYFTKGDWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDCNTAIEKDPN 455

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLE-LEGDKSTEVMKNDYENAKKLVQTFVTLNK 223
           + +AY R   A++       A+  F   +E L+  ++ +   N+  N++++ Q ++  N+
Sbjct: 456 FIRAYIRKATAQI-------AIKDFVPAIETLDAARTKDAELNNGANSREIDQLYLKANQ 508

Query: 224 NVPDPS 229
               PS
Sbjct: 509 QRFQPS 514

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 64/94 (68%), Gaps = 1/94 (1%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS-NPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDP 163
           GN   + K+Y  AI+ ++KAIE+  + N   YSNR+A Y  ++ F++A+ DAN  +K++P
Sbjct: 12  GNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDANECVKINP 71

Query: 164 TYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEG 197
           ++SK Y+RLGAA L  G+ ++A   +KK LEL+ 
Sbjct: 72  SWSKGYNRLGAAHLGLGDLDEAESNYKKALELDA 105

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 42/74 (56%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           G +  +  ++ +A+  Y++ I+  P +   YSNRAAA   +  F  A+ D N AI+ DP 
Sbjct: 403 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 165 YSKAYSRLGAAKLA 178
           + +AY R   A++A
Sbjct: 463 FVRAYIRKATAQIA 476

 Score = 33.5 bits (75), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 50/96 (52%), Gaps = 8/96 (8%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAI----K 160
           GNK    + +  AI+ Y+KA E++  +  Y +NRAAA     ++  A+   N A+    +
Sbjct: 269 GNKFYKARQFDEAIEHYNKAWELH-KDITYLNNRAAAEYEKGEYETAISTLNDAVEQGRE 327

Query: 161 LDPTY---SKAYSRLGAAKLAEGNNEDAVHAFKKVL 193
           +   Y   SK+++R+G A    G+ +  +  ++K L
Sbjct: 328 MRADYKVISKSFARIGNAYHKLGDLKKTIEYYQKSL 363

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 78.6 bits (192), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 66/96 (68%), Gaps = 3/96 (3%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEI--YPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLD 162
           GN   + KNY  AI+ ++KAIE+   PS+   +SNR+A Y  ++ F++A+ DAN  +K++
Sbjct: 12  GNAAFTAKNYDGAIELFTKAIEVSETPSH-VLFSNRSACYTSLKKFSDALNDANECVKIN 70

Query: 163 PTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198
           P++SK Y+RLGAA L  G+ ++A   +KK LEL+ +
Sbjct: 71  PSWSKGYNRLGAAHLGLGDLDEAESDYKKALELDAN 106

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 87/212 (41%), Gaps = 45/212 (21%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           G +  +  ++ +A+  Y++ I+  P +   YSNRAAA   +  F  A+ D N AI+ DP 
Sbjct: 403 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLE-LEGDKSTEVMKNDYENAKKLVQTF--VTL 221
           + +AY R+ AA++       AV  F   LE L+  ++ +   N   +AK++ Q +   + 
Sbjct: 463 FVRAYIRMAAAQI-------AVKEFAAALETLDVARTKDAEVNKGASAKEIDQLYYKASQ 515

Query: 222 NKNVPDPSGPPPLNTTDVLTDIATVLGSSFGSLXXXXXXXXXXXXXXXXXXPEMMQQVEG 281
            +  PD     P  T                                    PE    V  
Sbjct: 516 QRFQPDTGSETPEET-----------------------------YQRAMKDPE----VAA 542

Query: 282 LMQNPVVRQFAENVANGNGPGGLSDVLNNPSV 313
           +MQ+PV++   +       P  L + + NP+V
Sbjct: 543 IMQDPVMQSILQQA--QQNPAALQEHMKNPAV 572

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 48/96 (50%), Gaps = 8/96 (8%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIK---- 160
           GNK      +  AI+ Y++A E++  +  Y +NRAAA     D+   +   N A++    
Sbjct: 269 GNKFYKAHQFDEAIEHYNRAWELH-KDITYLNNRAAAEYEKGDYETVIATLNDAVEKGRD 327

Query: 161 LDPTY---SKAYSRLGAAKLAEGNNEDAVHAFKKVL 193
           +   Y   SK+++R+G A    G+ +  +  ++K L
Sbjct: 328 MRADYKVISKSFARIGNAYHKLGDLKKTIEYYQKSL 363

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 78.2 bits (191), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 62/93 (66%), Gaps = 1/93 (1%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS-NPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDP 163
           GN   + K++  AI+ ++KAIE+ P+ N   YSNR+AAY   + F  A+ DA   +K++P
Sbjct: 12  GNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDATECVKINP 71

Query: 164 TYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELE 196
           T+SK Y+RLGAA+   GN E+A   +K+ L+L+
Sbjct: 72  TWSKGYNRLGAAEFGLGNLEEAEKNYKEALKLD 104

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 73/160 (45%), Gaps = 13/160 (8%)

Query: 32  SLNVAIDCISDV---FELDPTSEEKIINDVFNKSDLKT---ITLKGLGLQNVSDVV---- 81
           +LN A+D   ++   +++   S  +I N    K DLK       K L     +D++    
Sbjct: 310 TLNEAVDQGRELRADYKIIAKSFARIGNAYHKKGDLKKSIDYYQKSLTEHRTADILTKLR 369

Query: 82  --ELEVKNEEISXXXXXXXXXXXXXGNKQMSLK-NYKSAIDKYSKAIEIYPSNPFYYSNR 138
             E E+K +E                 K+   K ++ +A+  YS+ I+  P +   YSNR
Sbjct: 370 NCEKELKKQEAEQYIDPEKAEEARLEGKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNR 429

Query: 139 AAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLA 178
           AAA   +  F  A+ D + AIK DP + +AY R   A++A
Sbjct: 430 AAALSKLMSFPEAIKDCDNAIKKDPNFVRAYIRKATAQIA 469

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 50/96 (52%), Gaps = 8/96 (8%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAI----K 160
           GNK      +  AI++Y+KA  +   +  Y +NR+AA     DF  A+   N A+    +
Sbjct: 262 GNKLYKAHKFDEAIEQYNKAWALN-KDITYLNNRSAAEFEKGDFETAIATLNEAVDQGRE 320

Query: 161 LDPTY---SKAYSRLGAAKLAEGNNEDAVHAFKKVL 193
           L   Y   +K+++R+G A   +G+ + ++  ++K L
Sbjct: 321 LRADYKIIAKSFARIGNAYHKKGDLKKSIDYYQKSL 356

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 77.0 bits (188), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 59/94 (62%), Gaps = 1/94 (1%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS-NPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDP 163
           GN     K+Y  AID +SKAI++    N   YSNR+A Y  ++ F NA+ DA   +K++P
Sbjct: 12  GNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAEECVKINP 71

Query: 164 TYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEG 197
           ++SK Y+R+GAA    G+ ++A   +KK LEL+ 
Sbjct: 72  SWSKGYNRVGAAHFGMGDLDEAEAGYKKALELDA 105

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 81/183 (44%), Gaps = 13/183 (7%)

Query: 113 NYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRL 172
           ++ +A+  Y++ I+  P +   YSNRAA    +  F  A+ D N AI+ DP + +AY R 
Sbjct: 412 DWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDCNKAIEKDPNFVRAYIRK 471

Query: 173 GAAKLAEGNNEDAVHAFKKVLE-LEGDKSTEVMKNDYENAKKLVQTFVTLNKNV--PDPS 229
             A++       AV  F   LE L+  +S +   N   N +++ Q ++  ++    P+ S
Sbjct: 472 ATAQI-------AVREFSSALETLDAARSKDAEVNKSANTREIDQLYIKASQQRFQPNDS 524

Query: 230 GPPPLNTTDVLT---DIATVLGSSFGSLXXXXXXXXXXXXXXXXXXPEMMQQVEGLMQNP 286
              P  T +      ++A ++                         PE+ ++++ L+ + 
Sbjct: 525 NESPEQTYERAMKDPEVAAIMQDPVMQSILQQAQQNPAALQEHMKNPEIFKKIQTLIASG 584

Query: 287 VVR 289
           ++R
Sbjct: 585 IIR 587

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 63/94 (67%), Gaps = 1/94 (1%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS-NPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDP 163
           GN   + K+Y  AI+ ++KAIE+  + N   YSNR+A Y  ++ F++A+ DA   I ++P
Sbjct: 12  GNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAKECININP 71

Query: 164 TYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEG 197
           ++SK Y+RLGAA L  G+ ++A + +KK LEL+ 
Sbjct: 72  SWSKGYNRLGAAHLGLGDLDEAENNYKKALELDA 105

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 41/74 (55%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           G    +  ++ +A+  Y++ I+  P +   YSNRAAA   +  F  A+ D N AI+ DP 
Sbjct: 403 GKDYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 165 YSKAYSRLGAAKLA 178
           + +AY R   A++A
Sbjct: 463 FVRAYIRKATAQIA 476

 Score = 33.5 bits (75), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 50/96 (52%), Gaps = 8/96 (8%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAI----K 160
           GNK    + +  AI+ Y+KA E++  +  Y +NRAAA     ++  A+   N A+    +
Sbjct: 269 GNKFYKARQFDEAIEHYNKAWELH-RDITYLNNRAAAEYEKGEYKTAIATLNDAVEQGRE 327

Query: 161 LDPTY---SKAYSRLGAAKLAEGNNEDAVHAFKKVL 193
           +   Y   S++++R+G A    G+ +  +  ++K L
Sbjct: 328 MRADYKVISRSFARIGNAYHKLGDLKKTIEYYQKSL 363

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 75.1 bits (183), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 62/94 (65%), Gaps = 1/94 (1%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS-NPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDP 163
           GN+  + K+Y  AI+ ++KAIE+    N   +SNR+A Y   +DF  A+ DAN  +K++P
Sbjct: 10  GNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDANECVKINP 69

Query: 164 TYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEG 197
           +++K Y+RLGAA    G+ ++A  ++KK LEL+ 
Sbjct: 70  SWAKGYNRLGAAHYGLGDLDEAEQSYKKALELDS 103

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 43/74 (58%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           G +  +  ++  A++ Y++ I+  P++   YSNRAAA   +  F +A+ D + AI+ DP 
Sbjct: 396 GKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDKAIEKDPN 455

Query: 165 YSKAYSRLGAAKLA 178
           + +AY R    ++A
Sbjct: 456 FVRAYIRKATGQIA 469

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 51/96 (53%), Gaps = 8/96 (8%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAI----K 160
           GNK    + +  AI+KY++A E + ++  Y +NRAAA     D+  A+     A+    +
Sbjct: 262 GNKLYKQRKFDEAIEKYNEAWETH-NDITYLNNRAAAEYEKGDYEAAIETLTKAVEQGRE 320

Query: 161 LDPTY---SKAYSRLGAAKLAEGNNEDAVHAFKKVL 193
           L   Y   SK+++R+G +    G+ + A+  ++K L
Sbjct: 321 LRADYKVISKSFARMGNSYHKLGDLKKAIDYYEKSL 356

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 59/95 (62%), Gaps = 1/95 (1%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS-NPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDP 163
           GN   + K Y  A+D ++KAIE+  + N   YSNR+A+Y   + F  A+ DA    K++P
Sbjct: 12  GNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDALECTKINP 71

Query: 164 TYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198
           +++K Y+R GAA    GN +DA  ++KK LEL+ +
Sbjct: 72  SWAKGYTREGAAHFGMGNLDDAEASYKKALELDAN 106

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 61/116 (52%), Gaps = 8/116 (6%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           G +  +  ++ SA+  Y++ I+  P +   YSNRAAA   +  F +A+ D N AI+ DP 
Sbjct: 392 GKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCNKAIEKDPN 451

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLE-LEGDKSTEVMKNDYENAKKLVQTFV 219
           + +AY R   A++       AV  F   +E L+  ++ +   N   NA+++ Q ++
Sbjct: 452 FVRAYIRKATAQI-------AVKDFSYAIETLDAARTKDAEVNGGANAREIDQLYM 500

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 54/96 (56%), Gaps = 8/96 (8%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAI----K 160
           GNK    +N+  AI  Y+KA E+  +N  Y +NR+AA     ++  A+   N AI    +
Sbjct: 258 GNKAYKARNFDEAIACYNKAWEL-DNNITYLNNRSAAEFEKGEYDTAINTLNEAIEKGRE 316

Query: 161 LDPTY---SKAYSRLGAAKLAEGNNEDAVHAFKKVL 193
           +   Y   +K+++R+G A +  GN ++A++ ++K L
Sbjct: 317 MRADYKIIAKSFARIGNAYVKMGNLKEAINHYQKSL 352

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 59/94 (62%), Gaps = 1/94 (1%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS-NPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDP 163
           GN     K+++ A + +SKAIE   + N   YSNR+A Y  ++ F  A+ DA   +K++P
Sbjct: 10  GNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAEECVKINP 69

Query: 164 TYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEG 197
           T+SK Y+R+GAA+   GN +DA   +KK LE++ 
Sbjct: 70  TWSKGYNRVGAAQYGLGNLDDAEKEYKKALEIDS 103

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 84/205 (40%), Gaps = 47/205 (22%)

Query: 113 NYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRL 172
           ++ SA+  Y++ I+  P +   YSNRAA    +  F +A+ D + AI  DP + +AY R 
Sbjct: 416 DWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCDVAISKDPNFVRAYIRK 475

Query: 173 GAAKLAEGNNEDAVHAFKKVLE-LEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSGP 231
            +A++       AV  F   +E L+  ++ ++  N   NA+++ Q +V  ++    P  P
Sbjct: 476 ASAQI-------AVREFAPAMETLDAARAKDLEINKGANAREIEQLYVKASQQRFKPEDP 528

Query: 232 ---PPLNTTDVLTDIATVLGSSFGSLXXXXXXXXXXXXXXXXXXPEMMQQVEGLMQNPVV 288
              P       L D                              PE    V  +MQ+PV+
Sbjct: 529 NETPEQAYARALKD------------------------------PE----VAAIMQDPVM 554

Query: 289 RQFAENVANGNGPGGLSDVLNNPSV 313
           +           P  L + + NP+V
Sbjct: 555 QSILSQA--QQNPAALQEHMKNPAV 577

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 58/124 (46%), Gaps = 10/124 (8%)

Query: 78  SDVVELEVKNEEISXXXXXXXXXXXXXGNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSN 137
           +D  ++EV   E               GNK    + +  AI+ Y+KA +++  +  Y +N
Sbjct: 247 ADADKMEVDEPEPEQDSKAKADAEKAEGNKYYKARKFDEAIEHYNKAWDLH-RDVTYLNN 305

Query: 138 RAAA-------YQMIEDFTNAVLDANTAIKLD-PTYSKAYSRLGAAKLAEGNNEDAVHAF 189
           R+AA        Q I+  T AV D    ++ D    SK+++R+G A L   + + A+  +
Sbjct: 306 RSAAEYEKGDYEQAIKTLTEAV-DQGREMRADYKLISKSFARIGNAYLKMDDLKKAIEFY 364

Query: 190 KKVL 193
           ++ L
Sbjct: 365 QRSL 368

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 65/114 (57%), Gaps = 3/114 (2%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS-NPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDP 163
           GN   + K+++ AI+ ++KAIE+    N   YSNR+A Y   + F  A+ DA   + ++P
Sbjct: 10  GNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAKQCVNINP 69

Query: 164 TYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQT 217
            +SK Y+R+GAA    G+ ++A   +KK LEL  D + +  ++  E   K  Q+
Sbjct: 70  AWSKGYNRVGAAHFGLGDLDEAEQGYKKALEL--DSANKAAQDGLEQVHKTQQS 121

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 64/125 (51%), Gaps = 8/125 (6%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           G +  +  ++ +A+  Y++ I+  P +   YSNRAAA   +  F  A+ D N AI  DP 
Sbjct: 400 GKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCNVAISKDPN 459

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLE-LEGDKSTEVMKNDYENAKKLVQTFVTLNK 223
           + +AY R   A++       AV  F  V+E L+  ++ +   N+  NA+++ Q ++  ++
Sbjct: 460 FIRAYIRKATAQI-------AVREFVSVIETLDEARTKDSQINNGANAREIDQLYIKASQ 512

Query: 224 NVPDP 228
               P
Sbjct: 513 QRFQP 517

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 50/105 (47%), Gaps = 15/105 (14%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAI----K 160
           GNK    + +  AI+ YSKA E++  +  Y +NRAAA     ++  A+     A+    +
Sbjct: 266 GNKFYKARKFDEAIEHYSKAWELH-KDITYLNNRAAAEYEKGEYETAIKTLTEAVEQGRE 324

Query: 161 LDPTY---SKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGDKSTE 202
           L   Y   SK+++R+       GN+   ++  KK +E      TE
Sbjct: 325 LRADYKVISKSFARI-------GNSYHKLNELKKAIEFYQKSLTE 362

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 57/94 (60%), Gaps = 1/94 (1%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS-NPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDP 163
           GN   + K+++ AI+ + KAIE+    N   YSNR+A Y  +  F  A+ DA   +++ P
Sbjct: 11  GNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQECVRIKP 70

Query: 164 TYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEG 197
            +SK ++RLGAA    G+ ++A  ++KK LEL+ 
Sbjct: 71  DWSKGHNRLGAAHYGLGDLDEAEESYKKALELDS 104

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 61/117 (52%), Gaps = 6/117 (5%)

Query: 113 NYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRL 172
           ++ +A+  Y++ I+  P +   YSNRAAA   +  F +A+ D + AI+ DP + +AY R 
Sbjct: 403 DWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCDMAIQKDPNFVRAYIRK 462

Query: 173 GAAKLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPS 229
             A++A      A+    + L+   +K  EV  N+  N +++ Q ++   +    P+
Sbjct: 463 ATAQIAVQEYAAAI----ETLDTAREKDAEV--NNGSNTREIDQLYIKATQQRFQPA 513

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 59/95 (62%), Gaps = 1/95 (1%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS-NPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDP 163
           GN   + K++  AI+ +++AI    + N   YSNR+A Y  ++ F  A+ DA   +K++P
Sbjct: 11  GNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALNDAQQCVKINP 70

Query: 164 TYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198
            +SK Y+R+GAA L  G+ +DA   +KK LEL+ +
Sbjct: 71  DWSKGYNRMGAAHLGLGDLDDAESNYKKALELDSN 105

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 46/90 (51%), Gaps = 7/90 (7%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           G +  +  ++ +A+  Y++ I+  P +   YSNRAAA   +  F  A+ D   AI+ DP 
Sbjct: 397 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCEKAIEKDPN 456

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLE 194
           + +AY R   A++       A+  F K LE
Sbjct: 457 FVRAYLRKATAQI-------AIKDFVKALE 479

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 50/96 (52%), Gaps = 8/96 (8%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAI----K 160
           GNK      +  AI +Y+KA +++  +  Y +NR+AA     DF  A+   N A+    +
Sbjct: 263 GNKLYKSHKFDEAIAEYNKAWDLH-KDITYLNNRSAAEFEKGDFETAMNTLNEAVEQGRE 321

Query: 161 LDPTY---SKAYSRLGAAKLAEGNNEDAVHAFKKVL 193
           L   Y   +K+++R+G A   + N + A+  ++K L
Sbjct: 322 LRADYKLIAKSFARMGNAYSKQKNLKKAIEYYQKSL 357

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 63/107 (58%), Gaps = 3/107 (2%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS-NPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDP 163
           GN     K+Y  AID ++KAIE+  + N   YSNR+A Y   + F  A+ DA   +K+ P
Sbjct: 10  GNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAEECVKISP 69

Query: 164 TYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYEN 210
           ++SK Y+R+GAA+      ++A  ++K+ LEL  D S +  K+  E+
Sbjct: 70  SWSKGYNRVGAAQFGLSQLDEAEKSYKRALEL--DSSNKAAKDGLEH 114

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 39/66 (59%)

Query: 113 NYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRL 172
           ++ +A+  Y++ ++  P +   +SNRAAA   +  F  A+ D N A+ +DP + +AY R 
Sbjct: 395 DWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCNKAVSIDPNFVRAYIRK 454

Query: 173 GAAKLA 178
             A++A
Sbjct: 455 ATAQIA 460

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 8/78 (10%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLD-- 162
           GNK    + ++ AI+ Y+KA E++  +  Y +NR+AA     D+  A+   N A++    
Sbjct: 253 GNKLYKARQFEEAIEHYNKAWELH-KDITYLNNRSAAEFEKGDYDTAIKTLNDAVEQGRE 311

Query: 163 -----PTYSKAYSRLGAA 175
                 T +K+++R+G A
Sbjct: 312 LRADYKTIAKSFARIGNA 329

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 67.8 bits (164), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 56/93 (60%), Gaps = 1/93 (1%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS-NPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDP 163
           GN     K+Y+ A + + KAI++    N   YSNR+A Y  ++ F   + DA   +K++P
Sbjct: 11  GNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDAEECVKINP 70

Query: 164 TYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELE 196
            +SK Y+R+GAA+    N EDA  +++K LEL+
Sbjct: 71  GWSKGYNRVGAAQFGLNNLEDAEKSYQKALELD 103

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 63/119 (52%), Gaps = 8/119 (6%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           G +  S  ++ +A+  Y++ I+  P +   YSNRAAA   +  F  A+ D + AI+ DP 
Sbjct: 389 GKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCDRAIEKDPN 448

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLE-LEGDKSTEVMKNDYENAKKLVQTFVTLN 222
           + +AY R  +A++       AV  F   +E L+  ++ +   N+  NA+++ Q ++  N
Sbjct: 449 FIRAYIRKASAQI-------AVKEFAAAVETLDTVRTKDSELNNGANAREIDQLYIKAN 500

 Score = 33.9 bits (76), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 63/117 (53%), Gaps = 13/117 (11%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAA------YQM-IEDFTNAVLDANT 157
           GNK    + +  AI+ Y+KA E++  +  Y +NRAAA      Y+  I   TNAV D   
Sbjct: 255 GNKFYKARKFDEAIEHYNKAWELH-KDITYLNNRAAAEYEKGDYETAIATLTNAV-DEGR 312

Query: 158 AIKLD-PTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKK 213
            ++ D    +K+++R+G A    G+ + +++ ++K   L   +S +V+ N   NA+K
Sbjct: 313 EMRADYKVIAKSFARIGNAYHKLGDLKKSINFYQK--SLTEHRSADVL-NKLRNAEK 366

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 64/110 (58%), Gaps = 3/110 (2%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS-NPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDP 163
           GN     K+Y+ A + ++KAIE   + N   YSNR+A +  ++ F  A+ DAN  +K++P
Sbjct: 10  GNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDANECVKINP 69

Query: 164 TYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKK 213
            +SK Y+R+GAA    G  ++A   +KK LE+  D S +  ++  E  +K
Sbjct: 70  AWSKGYNRVGAAYFGLGKLDEAEQGYKKALEI--DTSNKAAQDGLEQVQK 117

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 62/128 (48%), Gaps = 8/128 (6%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           G +  +  ++ +A+  Y++  +  P +   YSNRAAA   +  F  A+ D + AI  DP 
Sbjct: 408 GKEYFTKGDWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDCDMAISKDPN 467

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLE-LEGDKSTEVMKNDYENAKKLVQTFVTLNK 223
           + +AY R   A++       AV  F   +E L+  ++ +   N+  N +++ Q ++  ++
Sbjct: 468 FIRAYIRKATAQI-------AVREFASAIETLDAARAKDTELNNGANVREIDQLYIKASQ 520

Query: 224 NVPDPSGP 231
               P  P
Sbjct: 521 QRFQPQDP 528

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 50/96 (52%), Gaps = 8/96 (8%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAI----K 160
           GNK    + +  AI+ Y+KA +++  +  Y +NR+AA     D+  A+     A+    +
Sbjct: 274 GNKFYKARKFDEAIEHYNKAWDLH-KDVTYLNNRSAAEYEKGDYEQAIKTLTEAVEQGRE 332

Query: 161 LDPTY---SKAYSRLGAAKLAEGNNEDAVHAFKKVL 193
           +   Y   SK+++R+G A L   + + A+  ++K L
Sbjct: 333 MRADYKLISKSFARIGNAYLKLEDFKKAIEFYQKSL 368

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 64.7 bits (156), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 57/93 (61%), Gaps = 1/93 (1%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS-NPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDP 163
           GN     K+Y+ AID ++KAIE+  + N   YSNR+AAY   + +  A+ DA+  IK++P
Sbjct: 12  GNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSDADECIKINP 71

Query: 164 TYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELE 196
           +++K Y+R GAA       E+A   + + L+++
Sbjct: 72  SWAKGYTRKGAALQGLHKYEEAEQCYNETLKID 104

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 43/74 (58%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           G +  +  ++ +A+  Y++ I+  P +   YSNRAAA   +  F +A+ D N AI+ DP+
Sbjct: 392 GKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCNKAIEKDPS 451

Query: 165 YSKAYSRLGAAKLA 178
           + +AY R    ++A
Sbjct: 452 FIRAYLRKATCQIA 465

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 55/94 (58%), Gaps = 1/94 (1%)

Query: 105 GNKQMSLKNYKSAIDKYSKAI-EIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDP 163
           GN     K++K A++ ++ AI E    N   YSNR+ AY  ++ F  A+ DA   +K+  
Sbjct: 11  GNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDATECVKIKA 70

Query: 164 TYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEG 197
            +SK ++RLGAA    GN ++A  ++KK LEL+ 
Sbjct: 71  DWSKGHNRLGAAHFGLGNLDEAEESYKKALELDA 104

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 44/74 (59%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           G +  +  ++ SA+  YS+ I   P +   YSNRAAA   +  F +A+ D + AI++DP+
Sbjct: 399 GKEYFTKGDWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCDKAIEIDPS 458

Query: 165 YSKAYSRLGAAKLA 178
           + +AY R   A++A
Sbjct: 459 FVRAYIRKATAQIA 472

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 66/112 (58%), Gaps = 2/112 (1%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GNK +  ++++ A + Y+KAIE  P+   +YSNRA A   +++F NA+ D   AI+L+ +
Sbjct: 16  GNKFLKQQDFQRANELYTKAIETDPTQSIFYSNRALANLKLDNFMNALNDCTNAIELNSS 75

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQ 216
             KAY R G A +   N + A + F  VL+ + +    + KN ++  +K+++
Sbjct: 76  NLKAYHRRGLANIGLLNFKSARNDFNIVLKYKPNDI--IAKNGFDTCEKVIR 125

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 47/74 (63%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GNK +  K Y  A++ Y+KAIE+  +   ++SNRA A   +++F + + D N+A++LDP 
Sbjct: 20  GNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNSALELDPK 79

Query: 165 YSKAYSRLGAAKLA 178
             KAY R G ++L 
Sbjct: 80  NIKAYHRRGLSQLG 93

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 31/65 (47%)

Query: 108 QMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSK 167
           Q+ L N++S +D  + A+E+ P N   Y  R  +   +  F  A  D +  +K  P+ + 
Sbjct: 57  QLKLDNFQSCLDDCNSALELDPKNIKAYHRRGLSQLGLLHFKKAKNDLSIVLKAKPSDAT 116

Query: 168 AYSRL 172
           A   L
Sbjct: 117 AKRAL 121

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 61.6 bits (148), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 46/74 (62%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN  +  +NY  AI+ YS+AIE+ P+   ++SNRA A   +++F + + D + A++LDP 
Sbjct: 19  GNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQSCMNDCDVALRLDPK 78

Query: 165 YSKAYSRLGAAKLA 178
             KAY R G + L 
Sbjct: 79  NIKAYHRRGLSHLG 92

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 45/69 (65%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN+ +   +Y SAI+ YSKAI +  +   Y+SNRA A+   ++F +AV+D + A+KLDP 
Sbjct: 19  GNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYSAVVDCDNALKLDPK 78

Query: 165 YSKAYSRLG 173
             KAY R G
Sbjct: 79  NIKAYHRRG 87

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 47/71 (66%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN  +  ++Y+ AI+ Y+KAIE+  ++  +YSNRA A+  +++F +A+ D N AIKLD  
Sbjct: 19  GNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDCNDAIKLDNN 78

Query: 165 YSKAYSRLGAA 175
             KAY R G A
Sbjct: 79  NIKAYHRRGLA 89

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 45/74 (60%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN  +  KN+  A + YSKAIE+  +   Y+SNRA A+  +++F  A+ D N AI+LDP 
Sbjct: 19  GNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDCNKAIELDPK 78

Query: 165 YSKAYSRLGAAKLA 178
             KAY R G + + 
Sbjct: 79  NVKAYHRRGLSYIG 92

 Score = 33.5 bits (75), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 29/56 (51%)

Query: 108 QMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDP 163
            + L N+++A++  +KAIE+ P N   Y  R  +Y  + +F  A  D    ++  P
Sbjct: 56  HLKLDNFQTALNDCNKAIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIVLRAKP 111

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN  + +++Y  AI+KY KAIE+  +   Y+SNRA  +  +++F  A  D + A+ LDP 
Sbjct: 16  GNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDKALALDPK 75

Query: 165 YSKAYSRLGAA 175
             KAY R G A
Sbjct: 76  NVKAYHRRGLA 86

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 44/74 (59%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN  +  +NY  AI+ Y+KAIE+ P+   +YSNRA A   +++F +A  D N A+ LD  
Sbjct: 19  GNVFIKEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDNFQSAYNDCNEALTLDSK 78

Query: 165 YSKAYSRLGAAKLA 178
             KAY R G A + 
Sbjct: 79  NVKAYHRRGLANVG 92

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 48/74 (64%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN  +  K++  AI+KY++AI++  +   Y+SNRA A+  +++F +A+ D + AIKLDP 
Sbjct: 19  GNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPK 78

Query: 165 YSKAYSRLGAAKLA 178
             KAY R   + +A
Sbjct: 79  NIKAYHRRALSCMA 92

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 30/61 (49%)

Query: 108 QMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSK 167
              + N++SA++   +AI++ P N   Y  RA +   + +F  A  D N  +K  P  S 
Sbjct: 56  HFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMALLEFKKAKKDLNVLLKAKPKDSA 115

Query: 168 A 168
           A
Sbjct: 116 A 116

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 48/74 (64%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN  +  K++  AI+KY++AI++  +   Y+SNRA A+  +++F +A+ D + A+KLDP 
Sbjct: 19  GNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEALKLDPK 78

Query: 165 YSKAYSRLGAAKLA 178
             KAY R   + +A
Sbjct: 79  NIKAYHRRALSCMA 92

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN+    K+++ AI+ Y+ AI +   +P +YSNR+AAY  I +F   V D   A+KL P 
Sbjct: 111 GNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPD 169

Query: 165 YSKAYSRLGAAKLAEGNNEDAV 186
           YSK + R  +A    G   DA+
Sbjct: 170 YSKCWLRRASAYENLGQFSDAM 191

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 48/74 (64%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN  +  K++  AI+KY++AI++  +   Y+SNRA A+  +++F +A+ D + AIKLDP 
Sbjct: 19  GNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPK 78

Query: 165 YSKAYSRLGAAKLA 178
             KAY R   + +A
Sbjct: 79  NIKAYHRRALSCMA 92

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 3/64 (4%)

Query: 108 QMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKL---DPT 164
              + N++SA++   +AI++ P N   Y  RA +   + +F  A  D N  +K    DP 
Sbjct: 56  HFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMALLEFKKARKDLNVLLKAKPNDPA 115

Query: 165 YSKA 168
            +KA
Sbjct: 116 ATKA 119

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 47/74 (63%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN  +  +++  AID Y+KAI +  +   Y+SNRA A+  +++F +++ D + A+KLDP 
Sbjct: 19  GNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSLNDCDEALKLDPK 78

Query: 165 YSKAYSRLGAAKLA 178
            +KAY R G + + 
Sbjct: 79  NAKAYHRRGLSYIG 92

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 48/74 (64%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN  +  K++  AI+KY++AI++  +   Y+SNRA ++  +++F +A+ D + AIKLDP 
Sbjct: 19  GNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDEAIKLDPK 78

Query: 165 YSKAYSRLGAAKLA 178
             KAY R   + +A
Sbjct: 79  NIKAYHRRALSCMA 92

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 29/56 (51%)

Query: 108 QMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDP 163
              + N++SA++   +AI++ P N   Y  RA +   + +F  A  D N  +K+ P
Sbjct: 56  HFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMALLEFKKAKRDLNVLLKVKP 111

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 45/71 (63%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GNK ++ K+Y  AI+ Y+KAIE+      ++SNRA A   ++ F +A+ D++ AI+LD +
Sbjct: 16  GNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSKAIELDSS 75

Query: 165 YSKAYSRLGAA 175
             K Y R G A
Sbjct: 76  NVKGYHRRGMA 86

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%)

Query: 109 MSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKA 168
           + L  ++SA++  SKAIE+  SN   Y  R  AY  ++DF +A  D    +++ P  + A
Sbjct: 54  LKLDRFQSALEDSSKAIELDSSNVKGYHRRGMAYAGLQDFISAKRDLEVVLRVKPGEATA 113

Query: 169 YSRLGAAK 176
              L A +
Sbjct: 114 KRTLLACE 121

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 49/94 (52%), Gaps = 1/94 (1%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN   + KN+  AI  Y  AIE+ P++P +YSN +A Y    D    V     A+++ P 
Sbjct: 132 GNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPD 191

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198
           +SKA  R  +A  + GN  DA+     VL L GD
Sbjct: 192 HSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 224

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 2/70 (2%)

Query: 121 YSKAIEIYPS-NPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAE 179
           + KAI++ P  +P YY +R   Y +++D+ NA +D   A  L+P     Y +L      +
Sbjct: 400 FQKAIDLDPEYSPTYY-HRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQ 458

Query: 180 GNNEDAVHAF 189
           G   ++   F
Sbjct: 459 GKFSESEKLF 468

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 50/92 (54%), Gaps = 1/92 (1%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNP-FYYSNRAAAYQMIEDFTNAVLDANTAIKLDP 163
           GNK    K Y+ A+  ++ A+    +N    YSNRAAA+  ++ +  A+ D    ++L P
Sbjct: 15  GNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGKNCVELAP 74

Query: 164 TYSKAYSRLGAAKLAEGNNEDAVHAFKKVLEL 195
            + K YSR+G A L     ++A   FKK L+L
Sbjct: 75  NWDKGYSRVGVAYLGLQKLDEAEENFKKALQL 106

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 48/85 (56%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           G +    + Y  A+  Y++ I+  P++P  + NRAA ++ +      + D + AI +DP+
Sbjct: 436 GKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKAISVDPS 495

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAF 189
           Y KAY R G A++ E + ++A+  +
Sbjct: 496 YIKAYVRKGFAQITERDLDEALETW 520

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 53/95 (55%), Gaps = 3/95 (3%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANT-AIKLDP 163
           GN   + KN+  AI  Y  AIE+ P++P +YSN +A Y    D  N VL+  T A+++ P
Sbjct: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDL-NKVLEYTTKALEIKP 189

Query: 164 TYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198
            +SKA  R  +A  + GN  DA+     VL L GD
Sbjct: 190 DHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 223

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 34/70 (48%)

Query: 137 NRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELE 196
           N+   +   ++FT A+     AI+LDP     YS + A  ++ G+    +    K LE++
Sbjct: 129 NKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIK 188

Query: 197 GDKSTEVMKN 206
            D S  +++ 
Sbjct: 189 PDHSKALLRR 198

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 48/94 (51%), Gaps = 1/94 (1%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN   + KN+  AI  Y  AIE+ P+ P +YSN +A Y    D    +     A+++ P 
Sbjct: 134 GNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPD 193

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198
           +SKA  R  +A  + GN  DA+     VL L GD
Sbjct: 194 HSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 226

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 34/70 (48%)

Query: 137 NRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELE 196
           NR   +   ++F  A+     AI+LDP     YS + A  ++ G+ E  +    K LE++
Sbjct: 132 NRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIK 191

Query: 197 GDKSTEVMKN 206
            D S  +++ 
Sbjct: 192 PDHSKALLRR 201

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 29/60 (48%)

Query: 121 YSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEG 180
           + KA+++ P  P  Y +R   Y +++D+ NA  D   A  L+P     Y +L      +G
Sbjct: 401 FQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQG 460

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 48/96 (50%), Gaps = 2/96 (2%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN+    K Y  AI  YS AIE+   +P +YSNR+A Y  +      V D   A+KL P 
Sbjct: 102 GNEFFKNKKYDEAIQYYSWAIEV-KEDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPD 160

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGDKS 200
           YSK   R  +A  + GN  DA+     V  L GD S
Sbjct: 161 YSKCLLRRASANESLGNFADAMFDLSAV-SLYGDFS 195

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 40/69 (57%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN  +  K Y+ A++ YSKAIE+  +   Y+SNRA +   +++F  A  D + AI LDP 
Sbjct: 17  GNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCDKAIALDPK 76

Query: 165 YSKAYSRLG 173
             KA  R G
Sbjct: 77  NIKAIHRRG 85

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 41/69 (59%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN  +  K Y  A++ YSKAIE+  +   ++SNRA +   +++F  A+ D N +I+LDP 
Sbjct: 19  GNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNKSIELDPK 78

Query: 165 YSKAYSRLG 173
             KA  R G
Sbjct: 79  NIKAIHRRG 87

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 47/93 (50%), Gaps = 5/93 (5%)

Query: 108 QMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSK 167
           ++ L N+ +A++  +K+IE+ P N      R  +Y  + +F+ A  D  T +++ P    
Sbjct: 56  RLKLDNFLTALEDCNKSIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTILQVKPNEQS 115

Query: 168 AYSRLGAAKLAEGNNEDAVHAFKKVLELEGDKS 200
           A   L A ++ E    +    FKK +  +G++S
Sbjct: 116 A---LKALEVCERFIRE--ERFKKAISGDGEES 143

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 49/94 (52%), Gaps = 1/94 (1%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN   + K++  AI  Y  AIE+ P++P +YSN +A Y    D    V     A+++ P 
Sbjct: 138 GNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPD 197

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198
           +SKA  R  +A  + GN  DA+     VL L GD
Sbjct: 198 HSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 230

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN+ +  K+Y  A++ Y++AIE   +   ++SNRA A   ++ F +A+ D+  AI+LD  
Sbjct: 45  GNEWVKAKDYARAVEAYTRAIEADGTQSIFFSNRALANLKLDRFQSALEDSARAIELDAG 104

Query: 165 YSKAYSRLGAAKLA 178
             KAY R G A   
Sbjct: 105 NVKAYHRRGLAHCG 118

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 45/74 (60%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN  +  ++Y  AI+ Y++AI++  +   Y+SNRA  +  +++F + + D + A+++DP 
Sbjct: 19  GNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDKALEIDPK 78

Query: 165 YSKAYSRLGAAKLA 178
             KAY R G + + 
Sbjct: 79  NIKAYHRRGMSYIG 92

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 27/56 (48%)

Query: 108 QMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDP 163
            + + N++S I+   KA+EI P N   Y  R  +Y  + +F NA  D    +   P
Sbjct: 56  HLKMDNFQSGINDCDKALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIVLASKP 111

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 56/101 (55%), Gaps = 2/101 (1%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN+    K+ ++AI  Y  A+ +   +P +YSN +A Y  +      +  +N A++L P 
Sbjct: 165 GNQYFKSKDNENAIKYYEYALRL-DQDPVFYSNISACYFAMNQLDKVIESSNKALELKPD 223

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGDKSTEVMK 205
           YSKA  R   A  A GNN++A++ F  +L L G+ S + ++
Sbjct: 224 YSKALLRRANAYEALGNNKEALYDF-SILSLFGEYSGQYLE 263

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN+    K Y+ AI  YS A+ +   +P +YSNR+A +  +      V D   A++L P 
Sbjct: 105 GNECFKEKKYEEAIKYYSCALRL-KKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPD 163

Query: 165 YSKAYSRLGAAKLAEGNNEDAV 186
           YSK   R   A  + GN  DA+
Sbjct: 164 YSKCLLRRATANESLGNFADAM 185

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 47/94 (50%), Gaps = 2/94 (2%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN+    K Y  AI  Y+ A+E+   +P +YSN +A Y  + D    V  +  A++L P 
Sbjct: 106 GNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198
           YSK   R  +A    GN  DA+     VL L GD
Sbjct: 165 YSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 47/94 (50%), Gaps = 2/94 (2%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN+    K ++ A+  YS AIE+   +P +YSNR+A Y  +      V D   A+KL P 
Sbjct: 103 GNEFFKNKQFEDALKYYSLAIEV-KEDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPD 161

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198
           YSK   R  +A  + G   DA+     V  L GD
Sbjct: 162 YSKCLLRRASANESLGKFADAMFDLSAV-SLYGD 194

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 47/94 (50%), Gaps = 2/94 (2%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN+    K Y  AI  Y+ A+E+   +P +YSN +A Y  + D    V  +  A++L P 
Sbjct: 106 GNQFFRNKKYDDAIKYYNWALEL-KDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198
           YSK   R  +A    GN  DA+     VL L GD
Sbjct: 165 YSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN+    + Y+ AI  Y  A+++   +P +YSNR+A Y  +      V D   A+KL P 
Sbjct: 102 GNECFKDQRYEEAIKFYDCALKL-KEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPD 160

Query: 165 YSKAYSRLGAAKLAEGNNEDAV 186
           YSK   R   A  + GN  DA+
Sbjct: 161 YSKCLLRRATANESLGNYADAM 182

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 51/96 (53%), Gaps = 2/96 (2%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GNK    K+Y +AI  Y+ A+++   +P +YSN +A Y  +      +  +  A++L+P 
Sbjct: 129 GNKYFKAKDYTNAIKYYNLALDL-NKDPIFYSNISACYVSLGQLDKVIESSTKALELNPN 187

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGDKS 200
           YSKA  R  +A  +  N  DA+     VL L GD S
Sbjct: 188 YSKALLRRASANESLENYSDALFDL-SVLSLNGDYS 222

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 73/149 (48%), Gaps = 7/149 (4%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN     K ++ AI+ Y+ AI+++  +P ++SN +A Y  + D    V  +  A++L P 
Sbjct: 100 GNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNISACYVSLGDLDKVVESSTRALELKPD 158

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD---KSTEVM--KNDYENAKKLVQTFV 219
           YSKA  R  +A    G  +DA+     VL L GD    S E M  +N  + A ++++  +
Sbjct: 159 YSKALLRRASAYENMGRYQDAMFDI-SVLSLNGDFNGSSIEPMLERNLNKQALRVLKEDM 217

Query: 220 TLNKNVPDPSGPPPLNTTDVLTDIATVLG 248
            ++ +VP    P         T +++  G
Sbjct: 218 GIDASVPQAEQPRERQELPSNTSLSSFFG 246

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 39/67 (58%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GNK +  K Y  A + Y+KAIE  P N   YSNRA     +++F +++ DA  AI+LD  
Sbjct: 20  GNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLDNFQSSLDDAKRAIELDNN 79

Query: 165 YSKAYSR 171
             KAY R
Sbjct: 80  NLKAYHR 86

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 47/94 (50%), Gaps = 2/94 (2%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN+    K Y  AI  Y+ A+E+   +P +YSN +A Y  + D    V  +  A+++ P 
Sbjct: 106 GNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPD 164

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198
           YSK   R  +A    GN  DA+     VL L GD
Sbjct: 165 YSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 46/94 (48%), Gaps = 2/94 (2%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN+    K +  AI  Y+ A+E+   +P +YSNR+A Y  +      V D   A+KL   
Sbjct: 109 GNEFFKEKKFDDAIKYYNLALEL-KKDPVFYSNRSACYVSMGQLEKVVEDTTAALKLKSD 167

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198
           YSK   R  +A  + GN  DA+      L L GD
Sbjct: 168 YSKCLLRRASANESLGNYADAMFDL-SALSLYGD 200

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 49/98 (50%), Gaps = 4/98 (4%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS----NPFYYSNRAAAYQMIEDFTNAVLDANTAIK 160
           GN+   +K YK A + Y+K IEI       N   +SNRAA    ++++   V D   A++
Sbjct: 85  GNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELKNYRRCVNDCRQALQ 144

Query: 161 LDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198
            +PT  K + R+  A       EDA  A +  L+L+ +
Sbjct: 145 FNPTNIKCFYRIARAFFLLDKCEDAKEAIEFGLKLDSE 182

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 63/144 (43%), Gaps = 26/144 (18%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS----NPFYYSNRAAAYQMIEDFTNAVLDANTAIK 160
           GN    +K ++ A + Y+K IE+       N   Y+NRAA    +++F + + D  TA+ 
Sbjct: 85  GNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRSCISDCKTALT 144

Query: 161 LDPTYSKAYSRLGAAKLAEGNNEDAVH-------------AFKKVLELEGDKSTEVMK-- 205
            +P   K Y R+G A  A    E A               +F+ +L +  +K  E+ K  
Sbjct: 145 YNPKNIKCYFRMGKAFTAINKFESARESIEFGQKIDNDNKSFENLLNIIKNKEEEIRKYE 204

Query: 206 -------NDYENAKKLVQTFVTLN 222
                   D EN K ++Q  +TL 
Sbjct: 205 EKKLKAQQDRENKKIMLQDALTLR 228

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 53/116 (45%), Gaps = 11/116 (9%)

Query: 73  GLQNVSDVVEL--EVKNEEISXXXXXXXXXXXXXGNKQMSLKNYKSAIDKYSKAIEIYPS 130
           G  N+SD+  L  E KNE                GN+      ++ AI  Y  A+++   
Sbjct: 91  GEPNLSDIDSLTEETKNE--------WAMALKDKGNELFKTSKFEDAIKYYHYALKL-KD 141

Query: 131 NPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAV 186
           +P YYSN +A Y  +  +   +  A  A+KL PT+SK   R   A  A GN  DA+
Sbjct: 142 DPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAM 197

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 32/69 (46%)

Query: 121 YSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEG 180
           + KA+E+ P+NP  Y +R  +Y + + +  A  D +   +LD     AY +L      E 
Sbjct: 377 FDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRES 436

Query: 181 NNEDAVHAF 189
             +D    F
Sbjct: 437 KFDDCETLF 445

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 46/94 (48%), Gaps = 2/94 (2%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN+    K Y  AI  Y+ A+E+   +P +YSN +A Y  + D    V  +  A++L P 
Sbjct: 106 GNQFFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198
           YSK   R  +A    G   DA+     VL L GD
Sbjct: 165 YSKVLLRRASANEGLGKFADAMFDL-SVLSLNGD 197

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 40/78 (51%), Gaps = 4/78 (5%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS----NPFYYSNRAAAYQMIEDFTNAVLDANTAIK 160
           GN     K +K A + Y+K IEI       N   Y+NRAA    I+++   + D  TA++
Sbjct: 85  GNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNYRRCLNDCKTALQ 144

Query: 161 LDPTYSKAYSRLGAAKLA 178
            +P   K Y R+G A LA
Sbjct: 145 YNPKNLKCYYRMGKAFLA 162

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 44/85 (51%), Gaps = 4/85 (4%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSN----PFYYSNRAAAYQMIEDFTNAVLDANTAIK 160
           GN   ++K ++ A D Y+K IEI   N       ++NRAA    ++++ + + D   A+ 
Sbjct: 87  GNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELKNYRSCINDCKHALT 146

Query: 161 LDPTYSKAYSRLGAAKLAEGNNEDA 185
           L+P   K Y R+G A     N E+A
Sbjct: 147 LNPKNIKCYYRMGKAFYLLNNIEEA 171

>NDAI0C03350 Chr3 complement(769764..771713) [1950 bp, 649 aa] {ON}
           Anc_5.72
          Length = 649

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 47/94 (50%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           G++ + LKN  +AI+ Y +A++I P +   +     AY+++E    ++     A  L P 
Sbjct: 461 GHEFVELKNSHAAIECYRRAVDINPKDFKAWYGLGQAYEVLEMHLYSLFYFQKACSLQPL 520

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198
             + +  LG   +  G   DA+  F++ L+  G+
Sbjct: 521 DRRMWQALGTCYIKIGYKSDALKCFERALQHSGN 554

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN    +K+Y++AI+ Y  A+++  ++P +YSN AA Y  +E    A+   + A++L+P 
Sbjct: 93  GNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151

Query: 165 YSKAYSRLGAAKLAEGNNEDAV 186
           YSK   +  A     G   DA+
Sbjct: 152 YSKVLLKRAAVYENIGKFADAL 173

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 52/104 (50%), Gaps = 12/104 (11%)

Query: 138 RAAAYQMIEDFTNAVLDANTAIKL--DPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLEL 195
           R  AY  ++D+ NA+     A++L  DP +   YS + A  ++  +N++A+ A  K LEL
Sbjct: 92  RGNAYFKVKDYENAINYYKFALQLKNDPVF---YSNMAACYISLEHNKEAIEACSKALEL 148

Query: 196 EGDKSTEVMKND--YENAKKLVQ-----TFVTLNKNVPDPSGPP 232
             D S  ++K    YEN  K        T V+LN +  D +  P
Sbjct: 149 NPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDYNDATIQP 192

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 1/60 (1%)

Query: 109 MSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKA 168
           +SL++ K AI+  SKA+E+ P        RAA Y+ I  F +A+LD  TA+ L+  Y+ A
Sbjct: 130 ISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDL-TAVSLNGDYNDA 188

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 47/88 (53%), Gaps = 4/88 (4%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS----NPFYYSNRAAAYQMIEDFTNAVLDANTAIK 160
            N    +K ++ A + Y+K I+++      N   ++NRAA    ++++ + V D   A++
Sbjct: 92  ANDLYKVKRFRDARELYTKGIKVFCEDKSINESLFANRAACELELKNYRSCVADCQKAME 151

Query: 161 LDPTYSKAYSRLGAAKLAEGNNEDAVHA 188
           ++P   K + R+G A LA G  ++A  A
Sbjct: 152 INPMNLKCFYRMGKAFLALGKFKEAHDA 179

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 43/94 (45%), Gaps = 2/94 (2%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN       ++ AI  Y+ AIE+   NP +YSN +A Y  +      +   N A++L P 
Sbjct: 118 GNSLFKADKFEEAIKYYNWAIEL-KENPIFYSNLSACYVSLNKLEEIIKYCNKALELKPD 176

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198
           YSK   R   A     N  DA+     VL L GD
Sbjct: 177 YSKVLLRRANANEKLENYADAMFDL-SVLSLNGD 209

>NCAS0D01390 Chr4 (251721..253616) [1896 bp, 631 aa] {ON} Anc_5.72
          Length = 631

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 52/104 (50%), Gaps = 2/104 (1%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           G++ + LKN  +AI+ Y +A++I   +   +     AY++++    ++     A  L P 
Sbjct: 443 GHEFVELKNSHAAIECYRRAVDINVRDFKAWYGLGQAYEVLDMHLYSLYYFQKACTLKPL 502

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEG--DKSTEVMKN 206
             + +  LG      GN  +A+  F++ ++L G  D+ T +M N
Sbjct: 503 DRRMWQALGTCYTKIGNKTEAIKCFERAIQLSGNADQDTTLMYN 546

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 22/37 (59%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAA 141
           GN+     NY SAI  Y K IEI P NP  YSN+A A
Sbjct: 10  GNQYFKEGNYASAIKSYEKCIEINPENPIGYSNKAMA 46

>TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa]
           {ON} Anc_3.367 YBR112C
          Length = 1043

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 50/98 (51%), Gaps = 7/98 (7%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANT-AIKLDP 163
           G   M   +Y +A D + +A+     NP ++ +    Y  I  + +A LDA T AI+L+P
Sbjct: 312 GRVHMIRADYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA-LDAYTRAIRLNP 370

Query: 164 TYSKAYSRLGAAKLAEGNNE---DAVHAFKKVLELEGD 198
             S+ +  LG   L E  N+   DA+ A+K+   L+ D
Sbjct: 371 YISEVWYDLGT--LYETCNKQLNDALDAYKQAARLDPD 406

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 62/143 (43%), Gaps = 9/143 (6%)

Query: 114 YKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKL--DPTYSKAYSR 171
           ++ A + Y +A+ + P     ++     Y M++D   A      A+    +P   K +  
Sbjct: 105 FQRAAELYERALSVNPELSDVWATLGHCYLMLDDLQRAYNSYQQALYYLSNPNVPKLWHG 164

Query: 172 LGAAKLAEGNNEDAVHAFKKVLELEG--DKSTEV---MKNDYENAKKLVQTFVTLNKNVP 226
           +G      G+ E A  AF KVLEL+   DK+ E+   +   Y++  K  Q        +P
Sbjct: 165 IGILYDRYGSLEYAEEAFAKVLELDPNFDKANEIYFRLGIIYKHQGKWTQALECFRYILP 224

Query: 227 DPSGPPPLNTTDVLTDIATVLGS 249
            P  P PL   D+   + +VL S
Sbjct: 225 QP--PSPLQEWDIWFQLGSVLES 245

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 44/90 (48%), Gaps = 4/90 (4%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS----NPFYYSNRAAAYQMIEDFTNAVLDANTAIK 160
           GN    +K ++ A + Y+KAI++       N   Y+NRAA    ++++   + D   A+ 
Sbjct: 81  GNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELELKNYRRCINDCKMALS 140

Query: 161 LDPTYSKAYSRLGAAKLAEGNNEDAVHAFK 190
           L+P   K Y R+  A LA    +D   A +
Sbjct: 141 LNPKNIKCYFRMAKAFLAIEKFDDCKEAIQ 170

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 41/69 (59%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN  +  +++  A + Y+KAIE+  +   ++SNRA A+   ++F  ++ D + A++LD  
Sbjct: 19  GNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCDKALELDSK 78

Query: 165 YSKAYSRLG 173
             KAY R G
Sbjct: 79  NIKAYHRRG 87

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 49/94 (52%), Gaps = 2/94 (2%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN+    K+Y +A+  Y+ A+ +   +P +YSN +A Y  +      V ++  A++L P 
Sbjct: 108 GNEFFKKKDYDNALKYYNYAL-VVKKDPVFYSNISACYVSLGQLDKVVENSTKALELKPD 166

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198
           YSKA  R  +A  +  N  DA+     VL L GD
Sbjct: 167 YSKALLRRASANESLENYADAMFDL-SVLSLNGD 199

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS----NPFYYSNRAAAYQMIEDFTNAVLDANTAIK 160
           GN+   LK Y+ A + Y+K I++       N   Y+NRAA    +++F   + D   A+ 
Sbjct: 81  GNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNFRKCIEDCKKALS 140

Query: 161 LDPTYSKAYSRLGAAKLA 178
            +    K Y R+G A L+
Sbjct: 141 FNVKNIKCYYRMGKAFLS 158

>CAGL0I02288g Chr9 complement(203605..205524) [1920 bp, 639 aa] {ON}
           similar to uniprot|P16522 Saccharomyces cerevisiae
           YHR166c CDC23
          Length = 639

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 48/91 (52%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           G++ + LKN  +AI+ Y +A++I P +   +     AY++++    ++     A  L P 
Sbjct: 451 GHEFVELKNSNAAIESYRRAVDIDPRDFRAWYGLGQAYEVLDMHLYSLYYFQRACILKPL 510

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLEL 195
             + +  LG+     GN+ +A+  +++ L+L
Sbjct: 511 DKRMWQALGSCYAKVGNHAEAIKCYERALQL 541

>TPHA0A05290 Chr1 complement(1198497..1200497) [2001 bp, 666 aa]
           {ON} Anc_5.72 YHR166C
          Length = 666

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 60/122 (49%), Gaps = 11/122 (9%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           G++ + LKN ++AI+ Y  A++I P +   +     AY++++    ++     A  L P 
Sbjct: 478 GHEFVELKNSQAAIECYRHAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQKACTLKPL 537

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLELE--GDKSTEVM---------KNDYENAKK 213
             + +  L +  +  GN  DA+ +F++ L+L    D+ + ++          ND EN K+
Sbjct: 538 DKRMWQALASCYVKIGNFNDAIKSFERALQLSINTDQDSSLLYKLAEVYEKSNDLENCKE 597

Query: 214 LV 215
            +
Sbjct: 598 YM 599

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 38/75 (50%), Gaps = 4/75 (5%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS----NPFYYSNRAAAYQMIEDFTNAVLDANTAIK 160
           GN    +K ++ A + YSK I++       N   Y+NRAA    I+++   + D   A++
Sbjct: 88  GNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCINDCKQALQ 147

Query: 161 LDPTYSKAYSRLGAA 175
           L+P   K Y R+  A
Sbjct: 148 LNPKNIKCYYRIAKA 162

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 48/94 (51%), Gaps = 2/94 (2%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN+    K+Y +A+  Y  A+ +   +P +YSN +A Y  +      V ++  A++L P 
Sbjct: 113 GNEFFKQKDYDNALKYYDYALTL-KKDPVFYSNISACYVSMNQLDKVVENSTKALELKPD 171

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198
           YSKA  R  +A  +  N  DA+     VL L GD
Sbjct: 172 YSKALLRRASANESLENYPDAMFDL-SVLSLNGD 204

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN     K++++AI  Y+ A+ +   +P YYSN +A Y  + ++   +  A  A+ L P 
Sbjct: 102 GNALFKKKDFENAIKYYTFALSL-KEDPVYYSNISACYSSLLNYEKVIEMATKALALRPD 160

Query: 165 YSKAYSRLGAAKLAEGNNEDAV 186
           YSK   R   A    GN  DA+
Sbjct: 161 YSKVLVRRANAYEKLGNFGDAM 182

>Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON}
           complement(17836..20034) [2199 nt, 733 aa]
          Length = 732

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 50/99 (50%), Gaps = 5/99 (5%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANT-AIKLDP 163
           G   M   +Y +A + + +A+     NP ++ +    Y  I  + +A LDA T AI+L+P
Sbjct: 293 GRIHMIRSDYNAAYEAFQQAVNRDARNPIFWCSIGVLYYQIYQYRDA-LDAYTRAIRLNP 351

Query: 164 TYSKAYSRLGAAKLAEGNNE--DAVHAFKKVLELEGDKS 200
             S+ +  LG       NN+  DA+ A+K+   LE D +
Sbjct: 352 YISEVWYDLGTL-YETCNNQLTDALDAYKQAARLEPDNT 389

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 65/153 (42%), Gaps = 16/153 (10%)

Query: 109 MSLKNYKSAIDKYSKAIEIY-------PSNPFYYSNRAAAYQMIEDFTNAVLDANTAIK- 160
           +SL N+  + D + KA+  Y        +    +S    +Y M+++   A      A+  
Sbjct: 73  VSLANFYRSTDAFDKAVHYYEKAVALDSTLAEVWSLLGHSYLMLDELQKAYNAYQQALYH 132

Query: 161 -LDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEG--DKSTEV---MKNDYENAKKL 214
             DP   + +  +G      G+ E A  AF KVLEL+   DK+ E+   +   Y++  K 
Sbjct: 133 LADPNVPRLWHGIGILYDRYGSLEYAEEAFAKVLELDPKFDKANEIYFRLGIIYKHQGKF 192

Query: 215 VQTFVTLNKNVPDPSGPPPLNTTDVLTDIATVL 247
            Q     N  + +P  P PL   D+   I  VL
Sbjct: 193 NQALDCFNYILTNP--PQPLKQWDIWFQIGNVL 223

>TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.367
           YBR112C
          Length = 689

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 66/145 (45%), Gaps = 9/145 (6%)

Query: 114 YKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIK--LDPTYSKAYSR 171
           +  A   Y +A+ I PS    ++     Y M++D   A      A+    DP   K +  
Sbjct: 214 FHKASQLYERALAIDPSLSDIWATLGHCYLMLDDLQKAYNAYQQALNNLSDPNVPKLWHG 273

Query: 172 LGAAKLAEGNNEDAVHAFKKVLELEG--DKSTEV---MKNDYENAKKLVQTFVTLNKNVP 226
           +G      G+ + A  AFKKVL+L+   +K+ E+   +   Y++  +  +   +LN  + 
Sbjct: 274 IGILYDRYGSLDFAEEAFKKVLDLDPNFEKANEIYFRLGIIYKHKGRWNEAIESLNCILK 333

Query: 227 DPSGPPPLNTTDVLTDIATVLGSSF 251
            P  PPPL  +D+   I  +L + F
Sbjct: 334 RP--PPPLTESDIWFQIGNILENKF 356

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 50/96 (52%), Gaps = 7/96 (7%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANT-AIKLDP 163
           G   M+ K++ +A +   +A+     NP ++ +    Y  I    +A LDA T AI+L+P
Sbjct: 421 GRIHMAKKDFTAAYESLQQAVNRDSRNPIFWCSIGVLYYQIGQNHDA-LDAYTRAIRLNP 479

Query: 164 TYSKAYSRLGAAKLAEGNNE---DAVHAFKKVLELE 196
             S+ +  LG   L E  N+   DA+ ++++ L L+
Sbjct: 480 YISEVWYNLGT--LYETCNDQITDALDSYERALSLD 513

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN+    K  + AI  Y  A+E +  +P +Y+N +A Y  + DF   + + N A++L P 
Sbjct: 113 GNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFEKVLENCNKALELKPD 171

Query: 165 YSKAYSR 171
           YSK   R
Sbjct: 172 YSKVLLR 178

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 2/70 (2%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIK--LD 162
           GN       Y+ A+D Y + I   P NP  YSN+A A   + ++T+A+      ++  L 
Sbjct: 15  GNALFKQGLYREAVDSYDQLITAQPQNPVGYSNKAMALIKLAEYTHAIQTCQEGLRYALG 74

Query: 163 PTYSKAYSRL 172
           P ++   S+L
Sbjct: 75  PEHAAIRSKL 84

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 46/94 (48%), Gaps = 2/94 (2%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN+    K+Y++A+  Y  A+ I   +P +YSN +A Y  + +    +  +  A++L P 
Sbjct: 115 GNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTKALELKPD 173

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198
           YSKA  R   A     N  DA+     VL L  D
Sbjct: 174 YSKALLRRATANEQLENYSDAMFDL-SVLSLNND 206

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%), Gaps = 5/76 (6%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDP- 163
           GN+     +YK A + Y K ++I P NP  YSN+A A   +  +T  V      +   P 
Sbjct: 10  GNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKGLTFTPN 69

Query: 164 ----TYSKAYSRLGAA 175
                Y K   RL  A
Sbjct: 70  TTDTVYKKLNYRLEMA 85

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 42/93 (45%), Gaps = 12/93 (12%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKL--- 161
           GN      NY  A++ Y K IE+ P NP  YSN A +   +  +T A+    T +K    
Sbjct: 10  GNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTGLKYVND 69

Query: 162 --DPTYSKAYSRLGAA-----KLAEGNNEDAVH 187
                Y K   R   A     KL+  NN++++H
Sbjct: 70  ADSQVYKKLQYRYNLADTELRKLS--NNDESLH 100

>KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.367
           YBR112C
          Length = 887

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 49/98 (50%), Gaps = 7/98 (7%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANT-AIKLDP 163
           G   M   +Y +A D + +A+     NP ++ +    Y  I  + +A LDA T AI+L+P
Sbjct: 311 GRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA-LDAYTRAIRLNP 369

Query: 164 TYSKAYSRLGAAKLAEGNN---EDAVHAFKKVLELEGD 198
             S+ +  LG   L E  N    DA+ A+++   L+ D
Sbjct: 370 YISEVWYDLGT--LYETCNNQLTDALDAYRQASRLDPD 405

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 62/143 (43%), Gaps = 9/143 (6%)

Query: 114 YKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKL--DPTYSKAYSR 171
           ++ A + Y +A+ I P     ++     Y M++D   A      A+    +P   K +  
Sbjct: 104 FQRAAELYERAVTINPELSDVWATLGHCYLMLDDLQRAYNSYQQALYHLSNPNVPKLWHG 163

Query: 172 LGAAKLAEGNNEDAVHAFKKVLELEG--DKSTEV---MKNDYENAKKLVQTFVTLNKNVP 226
           +G      G+ + A  AF KVLEL+   +K+ E+   +   Y++  K  Q        +P
Sbjct: 164 IGILYDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWNQALECFRYILP 223

Query: 227 DPSGPPPLNTTDVLTDIATVLGS 249
            P  P PL   D+   + +VL S
Sbjct: 224 QP--PAPLQEWDIWFQLGSVLES 244

>KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.367
           YBR112C
          Length = 973

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 48/96 (50%), Gaps = 7/96 (7%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANT-AIKLDP 163
           G   M   +Y +A D + +A+     NP ++ +    Y  I  + +A LDA T AI+L+P
Sbjct: 322 GRVHMVRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA-LDAYTRAIRLNP 380

Query: 164 TYSKAYSRLGAAKLAEGNN---EDAVHAFKKVLELE 196
             S+ +  LG   L E  N    DA+ A+K+   L+
Sbjct: 381 YISEVWYDLGT--LYETCNNQLTDALDAYKQAARLD 414

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 62/143 (43%), Gaps = 9/143 (6%)

Query: 114 YKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKL--DPTYSKAYSR 171
           ++ A + Y +A+++ P     ++     Y M++D   A      A+    +P   K +  
Sbjct: 115 FQRAAELYERALQVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLSNPNVPKLWHG 174

Query: 172 LGAAKLAEGNNEDAVHAFKKVLELEG--DKSTEV---MKNDYENAKKLVQTFVTLNKNVP 226
           +G      G+ + A  AF KVLEL+   +K+ E+   +   Y++  K  Q        + 
Sbjct: 175 IGILYDRYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQNKWQQALECFRYILQ 234

Query: 227 DPSGPPPLNTTDVLTDIATVLGS 249
            P  P PL   D+   + +VL S
Sbjct: 235 QP--PSPLQEWDIWFQLGSVLES 255

>TBLA0B07970 Chr2 (1887119..1889182) [2064 bp, 687 aa] {ON} Anc_5.72
           YHR166C
          Length = 687

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 45/91 (49%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           G++ + LKN  +AI+ Y +A++I P +   +     AY++++    ++     A  L P 
Sbjct: 494 GHEFVELKNSHAAIECYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQKACALKPL 553

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLEL 195
             + +  LG       N + A+  +K+ L+L
Sbjct: 554 DKRMWQALGECYFIVDNTDSALKCYKRALQL 584

>NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa]
           {ON} Anc_3.367
          Length = 907

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 48/96 (50%), Gaps = 7/96 (7%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANT-AIKLDP 163
           G   M   +Y +A D + +A+     NP ++ +    Y  I  + +A LDA T AI+L+P
Sbjct: 313 GRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA-LDAYTRAIRLNP 371

Query: 164 TYSKAYSRLGAAKLAEGNN---EDAVHAFKKVLELE 196
             S+ +  LG   L E  N    DA+ A+K+   L+
Sbjct: 372 YISEVWYDLGT--LYETCNNQLNDALDAYKQAARLD 405

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 61/143 (42%), Gaps = 9/143 (6%)

Query: 114 YKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKL--DPTYSKAYSR 171
           ++ A + Y +A+ I P     ++     Y M++D   A      A+    +P   K +  
Sbjct: 106 FQRAAELYERALSINPELSDVWATLGHCYLMLDDLQRAYNSYQQALYHLSNPNVPKLWHG 165

Query: 172 LGAAKLAEGNNEDAVHAFKKVLEL--EGDKSTEV---MKNDYENAKKLVQTFVTLNKNVP 226
           +G      G+ + A  AF KVLEL  + +K+ E+   +   Y++  K  Q        + 
Sbjct: 166 IGILYDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWTQALECFRYILN 225

Query: 227 DPSGPPPLNTTDVLTDIATVLGS 249
            P  P PL   D+   + +VL S
Sbjct: 226 QP--PAPLQEWDIWFQLGSVLES 246

>Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {ON}
           YBR112C (REAL)
          Length = 1020

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 48/96 (50%), Gaps = 7/96 (7%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANT-AIKLDP 163
           G   M   +Y +A D + +A+     NP ++ +    Y  I  + +A LDA T AI+L+P
Sbjct: 305 GRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA-LDAYTRAIRLNP 363

Query: 164 TYSKAYSRLGAAKLAEGNN---EDAVHAFKKVLELE 196
             S+ +  LG   L E  N    DA+ A+K+   L+
Sbjct: 364 YISEVWYDLGT--LYETCNNQLSDALDAYKQAARLD 397

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 62/143 (43%), Gaps = 9/143 (6%)

Query: 114 YKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKL--DPTYSKAYSR 171
           ++ A + Y +A+ + P     ++     Y M++D   A      A+    +P   K +  
Sbjct: 98  FQRAAELYERALLVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLSNPNVPKLWHG 157

Query: 172 LGAAKLAEGNNEDAVHAFKKVLELEG--DKSTEV---MKNDYENAKKLVQTFVTLNKNVP 226
           +G      G+ + A  AF KVLEL+   +K+ E+   +   Y++  K  Q        +P
Sbjct: 158 IGILYDRYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQGKWSQALECFRYILP 217

Query: 227 DPSGPPPLNTTDVLTDIATVLGS 249
            P  P PL   D+   + +VL S
Sbjct: 218 QP--PAPLQEWDIWFQLGSVLES 238

>KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 941

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 48/96 (50%), Gaps = 7/96 (7%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANT-AIKLDP 163
           G   M   +Y SA D + +A+     NP ++ +    Y  I  + +A LDA T AI+L+P
Sbjct: 365 GRIHMIRNDYTSAYDAFQQAVNRDSRNPTFWCSIGVLYYQIAQYRDA-LDAYTRAIRLNP 423

Query: 164 TYSKAYSRLGAAKLAEGNN---EDAVHAFKKVLELE 196
             S+ +  LG   L E  N    DA+ A+K+   L+
Sbjct: 424 YISEVWYDLGT--LYETCNNQVNDALDAYKQAARLD 457

 Score = 37.4 bits (85), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 62/143 (43%), Gaps = 9/143 (6%)

Query: 114 YKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKL--DPTYSKAYSR 171
           ++ A + Y +A+   P     ++     Y M+++  NA      A+    +P   K +  
Sbjct: 158 FQRAAELYQRALSANPELGDIWATLGHCYLMLDELQNAYAAYQQALYHLSNPNIPKLWHG 217

Query: 172 LGAAKLAEGNNEDAVHAFKKVLEL--EGDKSTEV---MKNDYENAKKLVQTFVTLNKNVP 226
           +G      G+ + A  AF KVLEL  + +K+ E+   +   Y++  K  Q        +P
Sbjct: 218 IGILYDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWNQALECFRYILP 277

Query: 227 DPSGPPPLNTTDVLTDIATVLGS 249
            P  P PL   DV   + +VL S
Sbjct: 278 QP--PAPLQEWDVWFQLGSVLES 298

>NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON}
           Anc_3.367
          Length = 1007

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 48/96 (50%), Gaps = 7/96 (7%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANT-AIKLDP 163
           G   M   +Y +A D + +A+     NP ++ +    Y  I  + +A LDA T AI+L+P
Sbjct: 318 GRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA-LDAYTRAIRLNP 376

Query: 164 TYSKAYSRLGAAKLAEGNN---EDAVHAFKKVLELE 196
             S+ +  LG   L E  N    DA+ A+K+   L+
Sbjct: 377 YISEVWYDLGT--LYETCNNQLNDALDAYKQAARLD 410

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 62/143 (43%), Gaps = 9/143 (6%)

Query: 114 YKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIK--LDPTYSKAYSR 171
           ++ A + Y +A++  P     ++     Y M++D T A      A+    +P   K +  
Sbjct: 111 FQRAAELYERALQYNPDLSDVWATLGHCYLMLDDLTRAYNSYQQALYHLTNPNVPKLWHG 170

Query: 172 LGAAKLAEGNNEDAVHAFKKVLELEG--DKSTEV---MKNDYENAKKLVQTFVTLNKNVP 226
           +G      G+ + A  AF KVLEL+   +K+ E+   +   Y++  K  Q        + 
Sbjct: 171 IGILYDRYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQGKWNQALECFRYILN 230

Query: 227 DPSGPPPLNTTDVLTDIATVLGS 249
            P  P PL   D+   + +VL S
Sbjct: 231 QP--PAPLQEWDIWFQLGSVLES 251

>Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)
           [1254 nt, 418 aa]
          Length = 418

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 62/143 (43%), Gaps = 9/143 (6%)

Query: 114 YKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKL--DPTYSKAYSR 171
           ++ A + Y +A+ + P     ++     Y M++D   A      A+    +P   K +  
Sbjct: 113 FQRAAELYERALSVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLSNPNVPKLWHG 172

Query: 172 LGAAKLAEGNNEDAVHAFKKVLELE--GDKSTEV---MKNDYENAKKLVQTFVTLNKNVP 226
           +G      G+ E A  AF KVLEL+   +K+ E+   +   Y++  K  Q        +P
Sbjct: 173 IGILYDRYGSLEYAEEAFAKVLELDPNFEKANEIYFRLGIIYKHQGKWTQALECFRYILP 232

Query: 227 DPSGPPPLNTTDVLTDIATVLGS 249
            P  P PL   D+   + +VL S
Sbjct: 233 QP--PAPLQEWDIWFQLGSVLES 253

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 47/95 (49%), Gaps = 7/95 (7%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANT-AIKLDP 163
           G   M   +Y +A D + +A+     NP ++ +    Y  I  + +A LDA T AI+L+P
Sbjct: 320 GRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA-LDAYTRAIRLNP 378

Query: 164 TYSKAYSRLGAAKLAEGNN---EDAVHAFKKVLEL 195
             S+ +  LG   L E  N    DA+ A+K+   L
Sbjct: 379 YISEVWYDLGT--LYETCNNQLSDALDAYKQAARL 411

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 55/130 (42%)

Query: 62  SDLKTITLKGLGLQNVSDVVELEVKNEEISXXXXXXXXXXXXXGNKQMSLKNYKSAIDKY 121
           S +K + +    L +++D  +L + + E+              GN     KN+  AI  +
Sbjct: 492 SRVKDLEIYSTLLWHLNDKSKLSILSSELITSNPRIPETWCCLGNFLSLQKNHHEAIKAF 551

Query: 122 SKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGN 181
            KA ++ P   + Y+ +   Y   + F  A      AI  DP +  AY  LG   +  G 
Sbjct: 552 EKATQVDPKFAYAYTLQGHEYTSSDSFDVAKRCYRKAIACDPGHYNAYYGLGMVSMKLGQ 611

Query: 182 NEDAVHAFKK 191
            E+A+  F+K
Sbjct: 612 YEEALLFFEK 621

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 38/85 (44%), Gaps = 4/85 (4%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS----NPFYYSNRAAAYQMIEDFTNAVLDANTAIK 160
           GN    +K YK A   YSK IE+       N   Y NRAA    + +F + + D   A+ 
Sbjct: 86  GNDLYKVKRYKDARTMYSKGIEVKCEDDSINGSLYLNRAACELELRNFRSCINDCKKALN 145

Query: 161 LDPTYSKAYSRLGAAKLAEGNNEDA 185
            +    KA+ R+G A       E+A
Sbjct: 146 FNAKCVKAFYRMGQAYFKLKKLEEA 170

>Suva_4.361 Chr4
           complement(631697..632812,632933..633154,633188..634741)
           [2892 bp, 963 aa] {ON} YBR112C (REAL)
          Length = 963

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 48/96 (50%), Gaps = 7/96 (7%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANT-AIKLDP 163
           G   M   +Y +A D + +A+     NP ++ +    Y  I  + +A LDA T AI+L+P
Sbjct: 307 GRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA-LDAYTRAIRLNP 365

Query: 164 TYSKAYSRLGAAKLAEGNN---EDAVHAFKKVLELE 196
             S+ +  LG   L E  N    DA+ A+K+   L+
Sbjct: 366 YISEVWYDLGT--LYETCNNQLSDALDAYKQAARLD 399

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 62/143 (43%), Gaps = 9/143 (6%)

Query: 114 YKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKL--DPTYSKAYSR 171
           ++ A + Y +A+ + P     ++     Y M++D   A      A+    +P   K +  
Sbjct: 100 FQRAAELYERALLVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLSNPNVPKLWHG 159

Query: 172 LGAAKLAEGNNEDAVHAFKKVLELEG--DKSTEV---MKNDYENAKKLVQTFVTLNKNVP 226
           +G      G+ + A  AF KVLEL+   +K+ E+   +   Y++  K  Q        +P
Sbjct: 160 IGILYDRYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQGKWSQALECFRYILP 219

Query: 227 DPSGPPPLNTTDVLTDIATVLGS 249
            P  P PL   D+   + +VL S
Sbjct: 220 QP--PAPLQEWDIWFQLGSVLES 240

>TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {ON}
           Anc_3.367 YBR112C
          Length = 759

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 49/98 (50%), Gaps = 7/98 (7%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANT-AIKLDP 163
           G   M   +Y +A D + +A+     NP ++ +    Y  I  + +A LDA T AI+L+P
Sbjct: 283 GRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA-LDAYTRAIRLNP 341

Query: 164 TYSKAYSRLGAAKLAEGNN---EDAVHAFKKVLELEGD 198
             S+ +  LG   L E  N    DA+ A+K+   L+ +
Sbjct: 342 YISEVWYDLGT--LYETCNNQLTDALDAYKQAARLDPE 377

 Score = 34.3 bits (77), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 61/141 (43%), Gaps = 9/141 (6%)

Query: 114 YKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKL--DPTYSKAYSR 171
           ++ A + Y KA+ + P     ++     Y M++D   A      A+    +P   K +  
Sbjct: 76  FQKAAELYEKALAVNPELSDVWATLGHCYLMLDDLQKAYNAYQQALYHLSNPNVPKLWHG 135

Query: 172 LGAAKLAEGNNEDAVHAFKKVLELEG--DKSTEV---MKNDYENAKKLVQTFVTLNKNVP 226
           +G      G+ + A  AF KVLEL+   +K+ E+   +   Y++  K  Q        +P
Sbjct: 136 IGILYDRYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQGKWNQALECFRYILP 195

Query: 227 DPSGPPPLNTTDVLTDIATVL 247
            P  P PL   D+   + +VL
Sbjct: 196 QP--PAPLQEWDIWFQLGSVL 214

>YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}
           CYC8General transcriptional co-repressor, acts together
           with Tup1p; also acts as part of a transcriptional
           co-activator complex that recruits the SWI/SNF and SAGA
           complexes to promoters; can form the prion [OCT+]
          Length = 966

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 48/96 (50%), Gaps = 7/96 (7%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANT-AIKLDP 163
           G   M   +Y +A D + +A+     NP ++ +    Y  I  + +A LDA T AI+L+P
Sbjct: 303 GRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA-LDAYTRAIRLNP 361

Query: 164 TYSKAYSRLGAAKLAEGNN---EDAVHAFKKVLELE 196
             S+ +  LG   L E  N    DA+ A+K+   L+
Sbjct: 362 YISEVWYDLGT--LYETCNNQLSDALDAYKQAARLD 395

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 62/143 (43%), Gaps = 9/143 (6%)

Query: 114 YKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKL--DPTYSKAYSR 171
           ++ A + Y +A+ + P     ++     Y M++D   A      A+    +P   K +  
Sbjct: 96  FQRAAELYERALLVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLSNPNVPKLWHG 155

Query: 172 LGAAKLAEGNNEDAVHAFKKVLELEG--DKSTEV---MKNDYENAKKLVQTFVTLNKNVP 226
           +G      G+ + A  AF KVLEL+   +K+ E+   +   Y++  K  Q        +P
Sbjct: 156 IGILYDRYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQGKWSQALECFRYILP 215

Query: 227 DPSGPPPLNTTDVLTDIATVLGS 249
            P  P PL   D+   + +VL S
Sbjct: 216 QP--PAPLQEWDIWFQLGSVLES 236

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 42/88 (47%), Gaps = 4/88 (4%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNP----FYYSNRAAAYQMIEDFTNAVLDANTAIK 160
           GN    +K ++ A   Y+K IE+   +         NRAA    ++++   + D   A+K
Sbjct: 84  GNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELELKNYRRCINDCREALK 143

Query: 161 LDPTYSKAYSRLGAAKLAEGNNEDAVHA 188
           L+P   KA+ R+G A L     E+A  A
Sbjct: 144 LNPKNPKAFFRIGKAFLQLDKLEEAAEA 171

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 26/120 (21%), Positives = 50/120 (41%), Gaps = 5/120 (4%)

Query: 108 QMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSK 167
           ++ LKNY+  I+   +A+++ P NP  +     A+  ++    A    +  +++D     
Sbjct: 125 ELELKNYRRCINDCREALKLNPKNPKAFFRIGKAFLQLDKLEEAAEAVDFGLRVDTENEA 184

Query: 168 AYSRLGAAKLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPD 227
             S L A        + A H  ++ LE    K  E + +  E A  +    +  +K  PD
Sbjct: 185 LLSLLSAI----SKKQKARHEHEQKLE-SRRKEMERLASILEAAMAIRNIHMIASKQRPD 239

>Kpol_1050.82 s1050 complement(185867..187786) [1920 bp, 639 aa]
           {ON} complement(185867..187786) [1920 nt, 640 aa]
          Length = 639

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 48/91 (52%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           G++ + LKN ++AI+ Y +A++I P +   +     AY++++    ++     A  L P 
Sbjct: 450 GHEFVELKNSQAAIECYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQKACTLKPL 509

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLEL 195
             + +  L +     GN  D++ ++++ L+L
Sbjct: 510 DKRMWQALASCYAKVGNIRDSIKSYERALQL 540

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 34/79 (43%), Gaps = 7/79 (8%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAI----- 159
           GN      N+ SA + Y K I + P NP  YSNRA A   ++ F+  +      +     
Sbjct: 11  GNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQRGLGKLED 70

Query: 160 --KLDPTYSKAYSRLGAAK 176
             K +P   K   RL  A+
Sbjct: 71  NEKDEPIRKKLLYRLHLAQ 89

>Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON}
           YBR112C (REAL)
          Length = 984

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 48/96 (50%), Gaps = 7/96 (7%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANT-AIKLDP 163
           G   M   +Y +A D + +A+     NP ++ +    Y  I  + +A LDA T AI+L+P
Sbjct: 297 GRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA-LDAYTRAIRLNP 355

Query: 164 TYSKAYSRLGAAKLAEGNN---EDAVHAFKKVLELE 196
             S+ +  LG   L E  N    DA+ A+K+   L+
Sbjct: 356 YISEVWYDLGT--LYETCNNQLSDALDAYKQAARLD 389

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 62/143 (43%), Gaps = 9/143 (6%)

Query: 114 YKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKL--DPTYSKAYSR 171
           ++ A + Y +A+ + P     ++     Y M++D   A      A+    +P   K +  
Sbjct: 90  FQRAAELYERALLVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLSNPNVPKLWHG 149

Query: 172 LGAAKLAEGNNEDAVHAFKKVLELEG--DKSTEV---MKNDYENAKKLVQTFVTLNKNVP 226
           +G      G+ + A  AF KVLEL+   +K+ E+   +   Y++  K  Q        +P
Sbjct: 150 IGILYDRYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQGKWSQALECFRYILP 209

Query: 227 DPSGPPPLNTTDVLTDIATVLGS 249
            P  P PL   D+   + +VL S
Sbjct: 210 QP--PAPLQEWDIWFQLGSVLES 230

>ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]
           {ON} highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 974

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 48/96 (50%), Gaps = 7/96 (7%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANT-AIKLDP 163
           G   M   +Y +A D + +A+     NP ++ +    Y  I  + +A LDA T AI+L+P
Sbjct: 311 GRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA-LDAYTRAIRLNP 369

Query: 164 TYSKAYSRLGAAKLAEGNN---EDAVHAFKKVLELE 196
             S+ +  LG   L E  N    DA+ A+K+   L+
Sbjct: 370 YISEVWYDLGT--LYETCNNQLTDALDAYKQAARLD 403

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 61/141 (43%), Gaps = 9/141 (6%)

Query: 114 YKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKL--DPTYSKAYSR 171
           ++ A + Y +A+ + P     ++     Y M++D   A      A+    +P   K +  
Sbjct: 104 FQRAAELYERALAVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLSNPNVPKLWHG 163

Query: 172 LGAAKLAEGNNEDAVHAFKKVLELEG--DKSTEV---MKNDYENAKKLVQTFVTLNKNVP 226
           +G      G+ + A  AF KVLEL+   +K+ E+   +   Y++  K  Q        +P
Sbjct: 164 IGILYDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWNQALECFRYILP 223

Query: 227 DPSGPPPLNTTDVLTDIATVL 247
            P  P PL   D+   + +VL
Sbjct: 224 QP--PAPLQEWDIWFQLGSVL 242

>CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} similar
           to uniprot|P14922 Saccharomyces cerevisiae YBR112c CYC8
           general repressor of transcription
          Length = 1148

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 48/96 (50%), Gaps = 7/96 (7%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANT-AIKLDP 163
           G   M   +Y +A D + +A+     NP ++ +    Y  I  + +A LDA T AI+L+P
Sbjct: 305 GRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA-LDAYTRAIRLNP 363

Query: 164 TYSKAYSRLGAAKLAEGNN---EDAVHAFKKVLELE 196
             S+ +  LG   L E  N    DA+ A+K+   L+
Sbjct: 364 YISEVWYDLGT--LYETCNNQLSDALDAYKQAARLD 397

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 37.4 bits (85), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 109 MSLKN--YKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKL 161
           +S KN  Y  AI  Y++ I I PSNP  YSN+A A    + F  A+      ++L
Sbjct: 12  ISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKGLQL 66

>TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {ON}
           Anc_3.367 YBR112C
          Length = 1189

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 49/98 (50%), Gaps = 7/98 (7%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANT-AIKLDP 163
           G   M   +Y +A D + +A+     NP ++ +    Y  I  + +A LDA T AI+L+P
Sbjct: 292 GRIHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA-LDAYTRAIRLNP 350

Query: 164 TYSKAYSRLGAAKLAEGNN---EDAVHAFKKVLELEGD 198
             S+ +  LG   L E  N    DA+ A+K+   L+ +
Sbjct: 351 YISEVWYDLG--TLYETCNNQLTDALDAYKQAARLDPE 386

>ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR112C (CYC8)
          Length = 910

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 49/96 (51%), Gaps = 7/96 (7%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANT-AIKLDP 163
           G   M   +Y +A D + +A+     NP ++ +    Y  I  + +A LDA T AI+L+P
Sbjct: 319 GRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDA-LDAYTRAIRLNP 377

Query: 164 TYSKAYSRLGAAKLAEGNN---EDAVHAFKKVLELE 196
             S+ +  LG   L E  N    DA+ A+K+ + L+
Sbjct: 378 YISEVWYDLGT--LYETCNNQLSDALDAYKQAVRLD 411

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 61/143 (42%), Gaps = 9/143 (6%)

Query: 114 YKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKL--DPTYSKAYSR 171
           ++ A + Y +A+ + P     ++     Y M++D   A      A+    +P   K +  
Sbjct: 112 FQRAAELYQRALAVNPELGDVWATLGHCYLMLDDLQRAYAAYQQALYHLSNPNVPKLWHG 171

Query: 172 LGAAKLAEGNNEDAVHAFKKVLELEG--DKSTEV---MKNDYENAKKLVQTFVTLNKNVP 226
           +G      G+ + A  AF KVLEL+   +K  E+   +   Y++  K  Q        +P
Sbjct: 172 IGILYDRYGSLDYAEEAFAKVLELDPHFEKVNEIYFRLGIIYKHQGKWNQALECFRYILP 231

Query: 227 DPSGPPPLNTTDVLTDIATVLGS 249
            P  P PL   DV   + +VL S
Sbjct: 232 QP--PAPLQEWDVWFQLGSVLES 252

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 48/94 (51%), Gaps = 2/94 (2%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN+    + Y+ A+  Y+ A+++   +P +YSN +A Y  + +    V  +  A++L P 
Sbjct: 106 GNQFFKEQKYEDALKYYNYALDL-KQDPVFYSNISACYVSLGNLEKVVESSTKALELKPD 164

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198
           YSKA  R  +A     N  +A+     VL L GD
Sbjct: 165 YSKALLRRASANENLENFAEAMFDL-SVLSLNGD 197

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKL 161
           GN      +Y++A+  Y KAI   PSNP  YSN A     +E ++ AV   N  +K+
Sbjct: 11  GNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACNKGLKM 67

>SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {ON}
           highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 880

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 67/149 (44%), Gaps = 13/149 (8%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANT-AIKLDP 163
           G   M   +Y +A D + +A+     NP ++ +    Y  I  + +A LDA T AI+L+P
Sbjct: 315 GRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDA-LDAYTRAIRLNP 373

Query: 164 TYSKAYSRLGAAKLAEGNN---EDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVT 220
             S+ +  LG   L E  N    DA+ A+K+   L+ +      + D   A+   Q   T
Sbjct: 374 YISEVWYDLGT--LYETCNNQLTDALDAYKQAARLDPNNVHIRERLDALTAQLASQANGT 431

Query: 221 L------NKNVPDPSGPPPLNTTDVLTDI 243
                   ++V +P+ PPP+     L  +
Sbjct: 432 APGDNQQEQSVSNPNAPPPVMLQPTLQSV 460

 Score = 37.0 bits (84), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 61/143 (42%), Gaps = 9/143 (6%)

Query: 114 YKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKL--DPTYSKAYSR 171
           ++ A + Y +A+   P     ++     Y M++D   A      A+    +P   K +  
Sbjct: 108 FQRAAELYQRALSFNPELGDIWATLGHCYLMLDDLQRAYAAYQQALYHLSNPNVPKLWHG 167

Query: 172 LGAAKLAEGNNEDAVHAFKKVLELEG--DKSTEV---MKNDYENAKKLVQTFVTLNKNVP 226
           +G      G+ + A  AF KVLEL+   +K+ E+   +   Y++  K  Q        +P
Sbjct: 168 IGILYDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWTQALECFRYILP 227

Query: 227 DPSGPPPLNTTDVLTDIATVLGS 249
            P  P PL   DV   + +VL S
Sbjct: 228 QP--PAPLQEWDVWFQLGSVLES 248

>ZYRO0C11594g Chr3 complement(907459..909345) [1887 bp, 628 aa] {ON}
           similar to uniprot|P16522 Saccharomyces cerevisiae
           YHR166C CDC23 Subunit of the anaphase-promoting
           complex/cyclosome (APC/C) which is a ubiquitin-protein
           ligase required for degradation of anaphase inhibitors
           including mitotic cyclins during the metaphase/anaphase
           transition
          Length = 628

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 46/91 (50%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           G++ + LKN  +AI+ Y +A++I   +   +     AY++++    ++     A  L P 
Sbjct: 439 GHEFVELKNSHAAIECYRRAVDINARDFKAWYGLGQAYEVLDMHLYSLYYFQKACTLKPL 498

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLEL 195
             + +  L A     GN ++A+  +++ L+L
Sbjct: 499 DRRMWQALAACYAKVGNRQEAIKCYERALQL 529

>Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar to
           Ashbya gossypii ADL344W
          Length = 1115

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 48/96 (50%), Gaps = 7/96 (7%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANT-AIKLDP 163
           G   M   +Y +A D + +A+     NP ++ +    Y  I  + +A LDA T AI+L+P
Sbjct: 385 GRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDA-LDAYTRAIRLNP 443

Query: 164 TYSKAYSRLGAAKLAEGNN---EDAVHAFKKVLELE 196
             S+ +  LG   L E  N    DA+ A+K+   L+
Sbjct: 444 YISEVWYDLGT--LYETCNNQLNDALDAYKQAARLD 477

 Score = 33.9 bits (76), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 62/143 (43%), Gaps = 9/143 (6%)

Query: 114 YKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKL--DPTYSKAYSR 171
           ++ A + Y +A+ + P     ++     Y M+++   A      A+    +P   K +  
Sbjct: 178 FQRAAELYQRALAVNPELGDIWATLGHCYLMLDNLQRAYAAYQQALYHLSNPNVPKLWHG 237

Query: 172 LGAAKLAEGNNEDAVHAFKKVLELEG--DKSTEV---MKNDYENAKKLVQTFVTLNKNVP 226
           +G      G+ + A  AF KVLEL+   +K+ E+   +   Y++  K  Q        +P
Sbjct: 238 IGILYDRYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQGKWNQALECFRYILP 297

Query: 227 DPSGPPPLNTTDVLTDIATVLGS 249
            P  P PL   DV   + +VL S
Sbjct: 298 QP--PAPLQEWDVWFQLGSVLES 318

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 41/88 (46%), Gaps = 4/88 (4%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS----NPFYYSNRAAAYQMIEDFTNAVLDANTAIK 160
           GN     + YK A + Y+K +E++      N   + NRAA    +++    + D   A++
Sbjct: 87  GNDLYRARRYKDARELYNKGVEVHCDDDAINESLFLNRAACELELKNHRRCINDCKEALR 146

Query: 161 LDPTYSKAYSRLGAAKLAEGNNEDAVHA 188
            +P   K + R+G A  +    E+A  A
Sbjct: 147 YNPKNVKCFYRMGRAFFSLNKLEEAKEA 174

>KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 795

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 47/96 (48%), Gaps = 7/96 (7%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANT-AIKLDP 163
           G   M   +Y +A D +  A+     NP ++ +    Y  I  + +A LDA T AI+L+P
Sbjct: 319 GRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQISQYRDA-LDAYTRAIRLNP 377

Query: 164 TYSKAYSRLGAAKLAEGNN---EDAVHAFKKVLELE 196
             S+ +  LG   L E  N    DA+ A+K+   L+
Sbjct: 378 YISEVWYDLGT--LYETCNNQLTDALDAYKQAARLD 411

 Score = 33.9 bits (76), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 61/143 (42%), Gaps = 9/143 (6%)

Query: 114 YKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKL--DPTYSKAYSR 171
           ++ A + Y +A+ I P     ++     Y M++D   A      A+    +P   K +  
Sbjct: 112 FQRAAELYQRALSINPELGDIWATLGHCYLMLDDLQRAYAAYQQALYHLSNPNVPKLWHG 171

Query: 172 LGAAKLAEGNNEDAVHAFKKVLELEG--DKSTEV---MKNDYENAKKLVQTFVTLNKNVP 226
           +G      G+ + A  AF KVLEL+   +K+ E+   +   Y++  K  Q        + 
Sbjct: 172 IGILYDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWNQALECFRYILT 231

Query: 227 DPSGPPPLNTTDVLTDIATVLGS 249
            P  P PL   DV   + +VL S
Sbjct: 232 QP--PAPLQEWDVWFQLGSVLES 252

>Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C
           (CYC8) - 1:1 [contig 253] FULL
          Length = 802

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 47/96 (48%), Gaps = 7/96 (7%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANT-AIKLDP 163
           G   M   +Y +A D +  A+     NP ++ +    Y  I  + +A LDA T AI+L+P
Sbjct: 323 GRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQISQYRDA-LDAYTRAIRLNP 381

Query: 164 TYSKAYSRLGAAKLAEGNN---EDAVHAFKKVLELE 196
             S+ +  LG   L E  N    DA+ A+K+   L+
Sbjct: 382 YISEVWYDLGT--LYETCNNQLTDALDAYKQAARLD 415

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 61/143 (42%), Gaps = 9/143 (6%)

Query: 114 YKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKL--DPTYSKAYSR 171
           ++ A + Y +A+ + P     ++     Y M++D   A      A+    +P   K +  
Sbjct: 116 FQRAAELYQRALTVNPELGDIWATLGHCYLMLDDLQRAYAAYQQALYHLSNPNVPKLWHG 175

Query: 172 LGAAKLAEGNNEDAVHAFKKVLELEG--DKSTEV---MKNDYENAKKLVQTFVTLNKNVP 226
           +G      G+ + A  AF KVLEL+   +K+ E+   +   Y++  K  Q        + 
Sbjct: 176 IGILYDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWNQALECFRYILT 235

Query: 227 DPSGPPPLNTTDVLTDIATVLGS 249
            P  P PL   DV   + +VL S
Sbjct: 236 QP--PAPLQEWDVWFQLGSVLES 256

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 47/94 (50%), Gaps = 2/94 (2%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN     +++++A+  Y+ A+ +   +P +YSN +A Y  +      V  +  A+KL   
Sbjct: 112 GNDYFKKQDFENALKYYNYALTL-KQDPVFYSNISACYVSLGQLEKVVESSTEALKLKHD 170

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198
           YSKA  R  +A  +  N  DA+     VL L GD
Sbjct: 171 YSKALLRRASAYESLANYVDAMVDL-SVLSLNGD 203

>Kwal_55.21839 s55 (998426..1000498) [2073 bp, 690 aa] {ON} YOR080W
           (DIA2) - may be involved in regulation of invasive
           growth and budding pattern [contig 126] FULL
          Length = 690

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 40/91 (43%), Gaps = 30/91 (32%)

Query: 113 NYKSAIDKYSKAIEIYPS-----------------NPFYYS-------------NRAAAY 142
           +YK+A + ++KA+ +  S                  PFY +             NRAA +
Sbjct: 22  DYKNACNLFTKALRLALSYSQSKLEQIRESHGLSKRPFYETEKVVHPRFVKLLDNRAATW 81

Query: 143 QMIEDFTNAVLDANTAIKLDPTYSKAYSRLG 173
           + + D T A+ DAN A+K +P   K Y R G
Sbjct: 82  EKLGDLTKALKDANRAVKYEPYNLKCYLRKG 112

>Kpol_331.1 s331 (1620..2276) [657 bp, 218 aa] {ON} (1620..2276)
           [657 nt, 219 aa]
          Length = 218

 Score = 36.6 bits (83), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 37/77 (48%)

Query: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60
           +SL N DF   + +  ++ ID     +D  +   V ID I+++FE      + ++ND   
Sbjct: 98  ISLCNSDFFMTVADIFYEYIDRFPYHQDIVDRGLVQIDQITEMFEAGLKKSKYLVNDHIT 157

Query: 61  KSDLKTITLKGLGLQNV 77
            +DL  IT     LQ+ 
Sbjct: 158 LADLFCITEWAFCLQHC 174

>NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1403

 Score = 37.4 bits (85), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 47/91 (51%), Gaps = 6/91 (6%)

Query: 113 NYKSAID------KYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYS 166
           N+++A+       K  KA  I  S  + Y     AY   +  ++++    +AI++DP   
Sbjct: 644 NWEAAVQISERLVKAEKAKRILQSTSWPYRVLGIAYLQNQQESSSIEWFQSAIRVDPNDI 703

Query: 167 KAYSRLGAAKLAEGNNEDAVHAFKKVLELEG 197
           +++  LG A LA G  E ++  F+K +EL+G
Sbjct: 704 ESWVGLGQAYLACGRIEASMKVFEKAMELDG 734

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 37.0 bits (84), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 5/86 (5%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPF-----YYSNRAAAYQMIEDFTNAVLDANTAI 159
           GN     K +K A D Y K I+I  +         ++N+AA    +++F   + D   A+
Sbjct: 83  GNDLYKAKRFKDARDVYLKGIQIENNKDVKIKESLFANKAACELELKNFRRCINDCKNAL 142

Query: 160 KLDPTYSKAYSRLGAAKLAEGNNEDA 185
           +L+P   K Y R+  A  A    E+A
Sbjct: 143 QLNPKNVKCYFRMTRAFFALDKLEEA 168

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 37.0 bits (84), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 40/88 (45%), Gaps = 4/88 (4%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS----NPFYYSNRAAAYQMIEDFTNAVLDANTAIK 160
           GN     K YK A + Y++ I+I       N   +SNRAA    ++++   V D   A++
Sbjct: 85  GNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELELKNYRRCVNDCKRALQ 144

Query: 161 LDPTYSKAYSRLGAAKLAEGNNEDAVHA 188
            +    K Y R+  A L     EDA  A
Sbjct: 145 YNVKNIKCYYRIAKAFLLLNKLEDAKQA 172

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 36.6 bits (83), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 4/75 (5%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS----NPFYYSNRAAAYQMIEDFTNAVLDANTAIK 160
           GN+    K +K A + YSK + +       N   Y+NRAA    ++++   + D + A+ 
Sbjct: 90  GNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCIEDCSKALT 149

Query: 161 LDPTYSKAYSRLGAA 175
           ++P   K Y R   A
Sbjct: 150 INPKNVKCYYRTSKA 164

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 36.6 bits (83), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 33/59 (55%), Gaps = 5/59 (8%)

Query: 108 QMSLKNYKSAIDKYSKAIEIYPSN-PFYYSNRAAAYQM--IEDFTNAVLDANTAIKLDP 163
           ++ LKNY+  I+  SKA+ I P N   YY    A +Q+  +E+  +A L AN  I  DP
Sbjct: 131 ELELKNYRRCIEDCSKALSINPKNTKCYYRTSKAFFQLNKLEEAKSAALFANQRI--DP 187

 Score = 34.7 bits (78), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 37/75 (49%), Gaps = 4/75 (5%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPF----YYSNRAAAYQMIEDFTNAVLDANTAIK 160
           GN+    K +K A + Y K + +   + F     ++N+AA    ++++   + D + A+ 
Sbjct: 90  GNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNYRRCIEDCSKALS 149

Query: 161 LDPTYSKAYSRLGAA 175
           ++P  +K Y R   A
Sbjct: 150 INPKNTKCYYRTSKA 164

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 34.7 bits (78), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAI 159
           GN+   L +Y +A   Y   I   P+NP  YSN+A +    E F  A+   NT +
Sbjct: 10  GNRLFKLGDYTAANKFYDLCIMEEPTNPIGYSNKAMSLIKQEHFDQAIRTCNTGL 64

>Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON}
           similar to Ashbya gossypii ADR230W
          Length = 688

 Score = 36.6 bits (83), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 33/63 (52%)

Query: 128 YPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVH 187
           +P       NRAA+++ I +   A++DA+  IK+D    K Y R G        +++A++
Sbjct: 66  HPRYLILLDNRAASWERINNLGKALIDADRMIKVDAYNLKGYIRKGKILQKMAQDKEALY 125

Query: 188 AFK 190
            ++
Sbjct: 126 VYR 128

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 36.2 bits (82), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 4/88 (4%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS----NPFYYSNRAAAYQMIEDFTNAVLDANTAIK 160
           GN     K +K A   Y KA+++       N   Y N AA    I+++ + +     A+K
Sbjct: 77  GNDLYKGKRFKDARAMYLKALDVKCDVLSINESLYLNLAACELEIKNYRSCINYCREALK 136

Query: 161 LDPTYSKAYSRLGAAKLAEGNNEDAVHA 188
           L+    KA+ R+G A L  G  ED++ A
Sbjct: 137 LNAKNVKAFFRIGKAYLELGRFEDSLEA 164

>KNAG0E00680 Chr5 complement(122876..124795) [1920 bp, 639 aa] {ON}
           Anc_5.72 YHR166C
          Length = 639

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/100 (21%), Positives = 48/100 (48%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           G++ + LKN  +AI+ Y +A++I   +   +     AY++++    ++     A  L P 
Sbjct: 449 GHEFVELKNSHAAIECYRRAVDINERDYKAWFGLGQAYEVLDMHLYSLYYFQKACTLKPL 508

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGDKSTEVM 204
             + +  L        N+E A+  +++ L+L  +   +V+
Sbjct: 509 DRRMWQALAECYGLLKNSEQAIECYRRALQLSSNAGQDVL 548

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 31/64 (48%), Gaps = 6/64 (9%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLD-ANTAIKLDP 163
           GN+      Y  AI++Y K I + P+N   YSN A AY       N   D A TA ++  
Sbjct: 42  GNEHFKKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAY-----LKNRCPDEAKTACEMGL 96

Query: 164 TYSK 167
           +Y K
Sbjct: 97  SYCK 100

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 4/75 (5%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSN----PFYYSNRAAAYQMIEDFTNAVLDANTAIK 160
           GN+   LK Y++A   Y + IE+  +N       + N+AA    ++++ + + D   A+ 
Sbjct: 81  GNEAYKLKQYRNARVLYERGIEVNCNNDKINELLFVNKAACELEMKNYRSCINDCKKALS 140

Query: 161 LDPTYSKAYSRLGAA 175
            +P   K Y R+  A
Sbjct: 141 FNPLNVKCYFRMAKA 155

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 27/55 (49%)

Query: 108 QMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLD 162
           ++ +KNY+S I+   KA+   P N   Y   A A+  IE +  +       +K+D
Sbjct: 122 ELEMKNYRSCINDCKKALSFNPLNVKCYFRMAKAFSAIEKYDESRESIEFGLKVD 176

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 41/88 (46%), Gaps = 4/88 (4%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS----NPFYYSNRAAAYQMIEDFTNAVLDANTAIK 160
           GN+    K +K A + Y+K I +       N   ++NRAA    ++++   + D + A+ 
Sbjct: 90  GNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNYRRCIEDCSKALT 149

Query: 161 LDPTYSKAYSRLGAAKLAEGNNEDAVHA 188
           ++P   K Y R   A  +    E+A  A
Sbjct: 150 INPKNIKCYYRTSKAFFSLSKLEEAKSA 177

>Kwal_56.24750 s56 complement(1132221..1134080) [1860 bp, 619 aa]
           {ON} YHR166C (CDC23) - Cell division cycle protein
           [contig 160] FULL
          Length = 619

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 46/94 (48%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           G++ + LKN  +AI+ Y +A++I P +   +     AY++++    ++     +  L P 
Sbjct: 430 GHEFVELKNSHAAIECYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQKSCALKPL 489

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198
             + +  L +     GN  +++  + + L+L  D
Sbjct: 490 DKRMWQALASCYEKVGNAAESIKCYTRALQLSFD 523

>TDEL0G00960 Chr7 (191061..192929) [1869 bp, 622 aa] {ON} Anc_5.72
           YHR166C
          Length = 622

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/91 (19%), Positives = 46/91 (50%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           G++ + L+N  +AI+ Y +A+++   +   +     AY++++    ++     A  L P 
Sbjct: 433 GHEFVELRNSHAAIECYRRAVDMNTKDFKAWYGLGQAYEVLDMHLYSLYYFQKACTLKPL 492

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLEL 195
             + +  L +     GN ++A+  +++ L+L
Sbjct: 493 DKRMWQALASCYAKVGNRQEAIKCYERALQL 523

>KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7.412
           YBL084C
          Length = 712

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 52/125 (41%), Gaps = 15/125 (12%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN     K++  AI  ++KA E+ P   + Y+ +   Y   E F  A      A+  D  
Sbjct: 501 GNHFSLQKDHDEAIKAFNKATELDPRFAYAYTLQGHEYASNESFDTARTFYRKALACDSQ 560

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKV---------------LELEGDKSTEVMKNDYE 209
           +  AY  LG      GN++ ++  F+K                +ELE  ++ E+    Y+
Sbjct: 561 HYNAYYGLGTCDSQNGNHDRSLLFFEKARMINPVNIVLICCCGVELEKVRNYELALKYYD 620

Query: 210 NAKKL 214
            A KL
Sbjct: 621 FASKL 625

>KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 689

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%)

Query: 127 IYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLG 173
           ++P       NRAA ++ I D   A+ DAN A + +P   K Y R G
Sbjct: 66  VHPRLVKLLDNRAATWEKIGDLKKALKDANRATRFEPYNLKCYLRRG 112

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 34.3 bits (77), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 26/48 (54%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAV 152
           GN      +Y++AI  Y KA  +  SNP Y+SN A A   +E +  AV
Sbjct: 48  GNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAV 95

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 33.1 bits (74), Expect = 0.24,   Method: Composition-based stats.
 Identities = 24/83 (28%), Positives = 36/83 (43%), Gaps = 6/83 (7%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN       Y+ A+  Y + I   P NP  YSN+A A   + ++T A+      ++   T
Sbjct: 11  GNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTST 70

Query: 165 ------YSKAYSRLGAAKLAEGN 181
                  SK   RL  A+ A G+
Sbjct: 71  AEHVAIRSKLQYRLELAQGAVGS 93

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 52/118 (44%)

Query: 74  LQNVSDVVELEVKNEEISXXXXXXXXXXXXXGNKQMSLKNYKSAIDKYSKAIEIYPSNPF 133
           L ++ D V+L +   E+              GN     K+++ AI  + KA ++ P+  +
Sbjct: 511 LWHLHDKVKLSILANELVMNIPNAPQTWCCMGNFLSLQKDHEDAIKAFEKATQVDPNFAY 570

Query: 134 YYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKK 191
            Y+ +   +   + F  A      A+  DP +  AY  LG + +  G  ++A+  F+K
Sbjct: 571 AYTLQGHEHSSNDSFDTAKNCYRKALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEK 628

>ABR206W Chr2 (787387..789231) [1845 bp, 614 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR166C (CDC23)
          Length = 614

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 23/102 (22%), Positives = 48/102 (47%), Gaps = 4/102 (3%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           G++ + +KN  +AI+ Y +A++I P +   +     AY++++    A+     A  L P 
Sbjct: 425 GHEFVEMKNSHAAIECYRRAVDINPCDFKAWYGLGQAYEVLDRHLYALYYLQKACSLKPL 484

Query: 165 YSKAYSRLGAA--KLAEGNNEDAVHAFKKVLELEGDKSTEVM 204
             + +  L     KL   N   A+  F++  +L  D+   ++
Sbjct: 485 DKRMWQALANCYDKLDRPNQ--AIKCFQRASQLSNDQDITIL 524

>Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON}
           (123502..125622) [2121 nt, 707 aa]
          Length = 706

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 30/59 (50%)

Query: 135 YSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVL 193
           Y N +A Y+ +++   A   ++  I ++P   K Y R+G     +G + +A   +KK L
Sbjct: 74  YDNLSATYEKLQELDKAYESSSRMIHIEPYNMKGYIRMGKVLQRQGKDPEAYKCYKKGL 132

>KLTH0H00704g Chr8 (70712..72577) [1866 bp, 621 aa] {ON} similar to
           uniprot|P16522 Saccharomyces cerevisiae YHR166C CDC23
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 621

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 46/94 (48%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           G++ + LKN  +AI+ Y +A++I P +   +     AY++++    ++     +  L P 
Sbjct: 432 GHEFVELKNSHAAIECYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQKSCALKPL 491

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198
             + +  L +      N E+++  + + L+L  D
Sbjct: 492 DKRMWQALASCYEKVDNLEESIKCYTRALQLSLD 525

>SAKL0H02244g Chr8 (216327..218213) [1887 bp, 628 aa] {ON} similar
           to uniprot|P16522 Saccharomyces cerevisiae YHR166C CDC23
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 628

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 25/132 (18%), Positives = 57/132 (43%), Gaps = 11/132 (8%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           G++ + LKN  +AI+ Y +A++I P +   +     AY++++    ++     A  L P 
Sbjct: 439 GHEFVELKNSHAAIESYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQKACALKPL 498

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLEL--EGDKSTEVMKN---------DYENAKK 213
             + +  L +        ++++  +++ L+L    D  T ++           D  N +K
Sbjct: 499 DKRMWQALASCYEKLSKKDESIKCYERALQLSISSDHDTAILYRLALLYERIQDVRNCRK 558

Query: 214 LVQTFVTLNKNV 225
            +   V   +N 
Sbjct: 559 YMMKCVKAEQNT 570

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 33.9 bits (76), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 40/88 (45%), Gaps = 4/88 (4%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPS----NPFYYSNRAAAYQMIEDFTNAVLDANTAIK 160
           GN+    K +K A + Y+K + +       N   ++NRAA    ++++   V D   A+ 
Sbjct: 90  GNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNYRKCVEDCGKALT 149

Query: 161 LDPTYSKAYSRLGAAKLAEGNNEDAVHA 188
           ++P   K Y R+  +       E+A  A
Sbjct: 150 INPKNIKCYYRISKSFFQLRKLEEAKSA 177

>NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.412
           YBL084C
          Length = 783

 Score = 33.5 bits (75), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 54/130 (41%)

Query: 62  SDLKTITLKGLGLQNVSDVVELEVKNEEISXXXXXXXXXXXXXGNKQMSLKNYKSAIDKY 121
           + LK +      L ++ D ++L V + E+              GN     K++K AI  +
Sbjct: 529 TRLKDLETYSTLLWHLHDKIKLTVLSNELLKEFKNEPQTWCCLGNLFSLQKDHKEAIKAF 588

Query: 122 SKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGN 181
            K  ++ P+  + Y+ +A  Y   + F  A      A+  D  +  AY  +G   +  G 
Sbjct: 589 EKVTKLDPTFTYGYTLQAHEYLSDDSFDLAKNYFRKAVSTDSQHYNAYYGIGMCSMKLGE 648

Query: 182 NEDAVHAFKK 191
            E A+  F+K
Sbjct: 649 FEHALLYFEK 658

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 33.5 bits (75), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 49/122 (40%)

Query: 74  LQNVSDVVELEVKNEEISXXXXXXXXXXXXXGNKQMSLKNYKSAIDKYSKAIEIYPSNPF 133
           L ++ D   L     E+              GN     K++  AI  + KAI++ P   +
Sbjct: 468 LWHLQDKTHLSALCAELLTLDKYNPIAWCSMGNLHSLNKDHDEAITAFGKAIQLDPFFAY 527

Query: 134 YYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVL 193
            Y+ +   Y   + F NA      A+ ++ T+  A   LG   +  G  E+A+  F+K  
Sbjct: 528 AYTLQGHEYSNNDAFDNAKSCFRKALTIEKTHYNALYGLGMCCVKLGKFEEALLFFEKAR 587

Query: 194 EL 195
            L
Sbjct: 588 AL 589

 Score = 30.0 bits (66), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 37/83 (44%), Gaps = 17/83 (20%)

Query: 118 IDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKL 177
           +DKY         NP  + +    + + +D   A+     AI+LDP ++ AY+  G    
Sbjct: 487 LDKY---------NPIAWCSMGNLHSLNKDHDEAITAFGKAIQLDPFFAYAYTLQG---- 533

Query: 178 AEGNNEDAV----HAFKKVLELE 196
            E +N DA       F+K L +E
Sbjct: 534 HEYSNNDAFDNAKSCFRKALTIE 556

>CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {ON}
           similar to uniprot|P38042 Saccharomyces cerevisiae
           YBL084c CDC27 subunit of anaphase-promoting complex
          Length = 769

 Score = 33.5 bits (75), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 41/84 (48%)

Query: 112 KNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSR 171
           K+++ AI+ + KA +I P   + Y+ +       + F  A      AI  DP +  AY  
Sbjct: 565 KDHEDAIEAFEKATKIDPKFAYAYTLQGHECSSNDSFDAAKKCFRKAIACDPRHYNAYYG 624

Query: 172 LGAAKLAEGNNEDAVHAFKKVLEL 195
           +G   +  G+ ++A+  F+K  ++
Sbjct: 625 MGIYSMKLGHYDEALLYFEKARQI 648

>KLTH0C00572g Chr3 complement(57378..59540) [2163 bp, 720 aa] {ON}
           similar to uniprot|P09798 Saccharomyces cerevisiae
           YKL022C CDC16 Subunit of the anaphase-promoting
           complex/cyclosome (APC/C) which is a ubiquitin-protein
           ligase required for degradation of anaphase inhibitors
           including mitotic cyclins during the metaphase/anaphase
           transition required for sporulation
          Length = 720

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 30/67 (44%)

Query: 123 KAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNN 182
           K  E +P +P  +    A Y      + A    + A  LDP++S+A+         EG +
Sbjct: 428 KMAENFPKHPITWFGVGAYYMCTNKISEARKYFSKASILDPSFSQAWIGFAHTYAVEGEH 487

Query: 183 EDAVHAF 189
           E AV A+
Sbjct: 488 EQAVSAY 494

>Ecym_4229 Chr4 complement(477067..478215) [1149 bp, 382 aa] {ON}
           similar to Ashbya gossypii AGL170W
          Length = 382

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 12/78 (15%)

Query: 158 AIKL-DPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLE--------LEGDKSTEVMK--- 205
           AIK+ D    + +S LG+ ++++   E+AV AF+K  E        LE D   EV     
Sbjct: 154 AIKISDAKSPETWSMLGSIRISQQRFEEAVEAFEKSWEFFRLKKENLERDMRCEVDNANP 213

Query: 206 NDYENAKKLVQTFVTLNK 223
             Y    +L+Q F+ L+K
Sbjct: 214 RSYAEYIELIQPFLALSK 231

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNA 151
           GN      N+  A++ Y KAI   P+NP  YSN A A   + ++ +A
Sbjct: 11  GNTAYKQNNFTDAVNFYKKAITYDPTNPVGYSNCAMALIKLNNYADA 57

>Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 30/51 (58%)

Query: 146 EDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELE 196
           +DF   +    +A+K++P     ++RLGA+      +E+A+ A+ + L+L+
Sbjct: 471 DDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

>Suva_14.26 Chr14 complement(41582..44296) [2715 bp, 904 aa] {ON}
           YNL313C (REAL)
          Length = 904

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 57/118 (48%), Gaps = 7/118 (5%)

Query: 117 AIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYS-KAYS--RLG 173
           A + +S+ + + P +   +SN +AAY  ++    A      A+  D   + K +    L 
Sbjct: 656 AAEAFSRCVSLDPHHALSWSNLSAAYIELDKLKEAYSCLKRAVASDAQKNWKIWENYMLV 715

Query: 174 AAKLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSGP 231
           AAKL E   ED + A K+++ +  DKS E    D    +KLV+  VT ++   DP  P
Sbjct: 716 AAKLNEW--EDVLIACKQLVSIRRDKSGE-GSIDLPIIEKLVELLVT-SEYSEDPEKP 769

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 59/147 (40%), Gaps = 13/147 (8%)

Query: 45  ELDPTSEEKIINDVFNKSDLKTITLKGLGLQNVSDVVELEVKNEEISXXXXXXXXXXXXX 104
           ++ PT  E I  +VF+       TL    L ++ D + L   + E+              
Sbjct: 469 QMQPTRSEDI--EVFS-------TL----LWHIHDKINLSHLSNELLETQPDKPQTWCSL 515

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           GN     +++  AI  + KA E+ P   + Y+ +   +   +    A      AI  DP 
Sbjct: 516 GNLYSLQRDHDEAIRYFEKATEVDPHFAYGYTLQGHEHSSNDSIDMAKTCYRKAIASDPQ 575

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKK 191
           +  AY  LG   +  G  E+A+  F+K
Sbjct: 576 HYNAYYGLGMCCMKLGQYEEALLYFEK 602

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 40/80 (50%)

Query: 112 KNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSR 171
           K++ +AI  + KA ++ P+  + Y+ +   +   +   +A      A+  DP +  AY  
Sbjct: 559 KDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYG 618

Query: 172 LGAAKLAEGNNEDAVHAFKK 191
           LG + +  G  E+A+  F+K
Sbjct: 619 LGTSSMKLGQYEEALLYFEK 638

>Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 30/51 (58%)

Query: 146 EDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELE 196
           +DF   +    +A+K++P     ++RLGA+      +E+A+ A+ + L+L+
Sbjct: 471 DDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

>Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W
           (REAL)
          Length = 612

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 30/51 (58%)

Query: 146 EDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELE 196
           +DF   +    +A+K++P     ++RLGA+      +E+A+ A+ + L+L+
Sbjct: 472 DDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 522

>KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {ON}
           Anc_8.470 YDR244W
          Length = 602

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 30/51 (58%)

Query: 146 EDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELE 196
           +DF   +    TA++++P     ++RLGAA      +E+++ A+ + L+L+
Sbjct: 460 DDFNKTIDCFKTALQVNPNDELMWNRLGAALANSNRSEESIKAYHRALQLK 510

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 30.8 bits (68), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 22/48 (45%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAV 152
           GN       Y  A+D Y + I   P NP  YSN+A A   + +   A+
Sbjct: 15  GNALFKQGLYLEAVDSYDRLIAAQPQNPVGYSNKAMALIKLGEHAQAI 62

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 4/55 (7%)

Query: 113 NYKSAIDKYSKAIEIYP-SNPFY---YSNRAAAYQMIEDFTNAVLDANTAIKLDP 163
           +Y SA+++Y K++   P S+P     YSN  AA   I +++N V  A+ A+KL P
Sbjct: 372 DYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKALKLFP 426

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 40/80 (50%)

Query: 112 KNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSR 171
           K++ +AI  + KA ++ P+  + Y+ +   +   +   +A      A+  DP +  AY  
Sbjct: 554 KDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYG 613

Query: 172 LGAAKLAEGNNEDAVHAFKK 191
           LG + +  G  E+A+  F+K
Sbjct: 614 LGTSAMKLGQYEEALLYFEK 633

>TPHA0F01410 Chr6 complement(327058..328095) [1038 bp, 345 aa] {ON}
           Anc_2.227 YIL134W
          Length = 345

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%)

Query: 157 TAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGDKS 200
           T++  +P +      +  +K AEG+    +H FK +LE EG KS
Sbjct: 159 TSVVTNPIWVLKTRIMSTSKYAEGSYVSIIHGFKTLLEKEGLKS 202

>SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 690

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 5/59 (8%)

Query: 129 PSNPFYYS---NRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNED 184
           P +P Y     NRAA+++ +     A+ DA   I+++P   K Y R G  K+ +  N+D
Sbjct: 65  PWHPKYIKLLDNRAASWEKLGKLDKALKDAKNMIRVEPHNLKCYIRCG--KILQKLNKD 121

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 40/80 (50%)

Query: 112 KNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSR 171
           K++ +AI  + KA ++ P+  + Y+ +   +   +   +A      A+  DP +  AY  
Sbjct: 547 KDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYG 606

Query: 172 LGAAKLAEGNNEDAVHAFKK 191
           LG + +  G  E+A+  F+K
Sbjct: 607 LGTSSMKLGQYEEALLYFEK 626

>NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {ON}
           Anc_8.470
          Length = 578

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 29/59 (49%)

Query: 138 RAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELE 196
           R   Y   +DF   +     ++K++P     ++RLGA+       EDA+ A+ + L L+
Sbjct: 437 RGLLYYAEDDFDKTIECFKESLKINPNDEVMWNRLGASLANSNKPEDAIQAYHRALNLK 495

>YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}
           PEX5Peroxisomal membrane signal receptor for the
           C-terminal tripeptide signal sequence (PTS1) of
           peroxisomal matrix proteins, required for peroxisomal
           matrix protein import; also proposed to have
           PTS1-receptor independent functions
          Length = 612

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 13/51 (25%), Positives = 30/51 (58%)

Query: 146 EDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELE 196
           +DF   +    +A++++P     ++RLGA+      +E+A+ A+ + L+L+
Sbjct: 471 DDFDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

>TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8.470
           YDR244W
          Length = 588

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 42/84 (50%), Gaps = 10/84 (11%)

Query: 148 FTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVH---AFKKVLELEGDKSTEVM 204
            + A L    A++ DP++  A+ +LG   L +  NE  +H   A +K L+L+  K+ + M
Sbjct: 307 LSEAALSFEAALQDDPSHVDAWLKLG---LVQIQNEKEIHGISALEKCLQLDP-KNLDAM 362

Query: 205 KN---DYENAKKLVQTFVTLNKNV 225
           KN    Y N    V  F  LN+ +
Sbjct: 363 KNLAISYINEGFDVSAFTMLNRWI 386

>KAFR0E02820 Chr5 (570013..571701) [1689 bp, 562 aa] {ON} Anc_8.470
           YDR244W
          Length = 562

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 8/64 (12%)

Query: 133 FYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKV 192
            YY+N        +DF   +     A+  +PT    ++RLGAA      +ED++ A+ K 
Sbjct: 415 LYYAN--------DDFDKTIECFKAALNENPTDELMWNRLGAALANSNRSEDSIKAYYKA 466

Query: 193 LELE 196
           ++L+
Sbjct: 467 IQLK 470

>CAGL0E01573g Chr5 complement(149084..151798) [2715 bp, 904 aa] {ON}
           similar to uniprot|P42842 Saccharomyces cerevisiae
           YNL313c
          Length = 904

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 65/160 (40%), Gaps = 43/160 (26%)

Query: 106 NKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTY 165
           N  ++LK+   ++ +YS + E +    ++Y   A     +E    A         LDPT+
Sbjct: 614 NYGLALKHLNDSLRQYSLSFETW----YFYGCIALECNKMEIAAEAF---TRCTALDPTH 666

Query: 166 SKAYSRLGAA-----KLAEGNN------------------------------EDAVHAFK 190
           + ++S L AA     KL E ++                              ED + A K
Sbjct: 667 AMSWSNLSAAYVQQGKLKEAHSCLKQAISSDSQKNWRIWENFLLVSVKLDEWEDVLAACK 726

Query: 191 KVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSG 230
           +++E++ DKS E    D    +KLV+  VT +   P+  G
Sbjct: 727 QLIEIKKDKSGE-QAIDLPVVEKLVELLVTSDYPKPNEEG 765

>YNL313C Chr14 complement(45308..48022) [2715 bp, 904 aa] {ON}
           EMW1Essential conserved protein with a role in
           maintaining cell wall integrity; contains six TPR
           (tetratricopeptide repeat) domains clustered in the
           C-terminal region; conditional mutant is suppressed by
           overexpression of GFA1
          Length = 904

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 50/107 (46%), Gaps = 6/107 (5%)

Query: 117 AIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTY-SKAYS--RLG 173
           A + +++ + + P +   +SN +AAY  ++    A      AI  D     K +    L 
Sbjct: 656 AAEAFTRCVSLDPYHALSWSNLSAAYTKMDKLKEAYSCLKRAISCDAQKNWKIWENYMLV 715

Query: 174 AAKLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVT 220
           A KL E   ED + A K+++ +  DKS E    D    +KLV+  VT
Sbjct: 716 AVKLNEW--EDVLTACKQLVSIRRDKSGE-GSIDLPIIEKLVELLVT 759

>KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 566

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 29/51 (56%)

Query: 146 EDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELE 196
           E+F   +    TA++++P     ++RLGA+      +E+A+ A+ K L L+
Sbjct: 430 EEFGKTIDCFRTALEVNPNDELMWNRLGASLANSNRSEEAIQAYHKALALK 480

>Kwal_14.874 s14 complement(90148..92316) [2169 bp, 722 aa] {ON}
           YKL022C (CDC16) - putative metal-binding nucleic
           acid-binding protein, interacts with Cdc23p and Cdc27p
           to catalyze the conjugation of ubiquitin to cyclin B
           [contig 245] FULL
          Length = 722

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 29/67 (43%)

Query: 123 KAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNN 182
           K  E +P +P  +    A Y        A    + A  LDP++S+A+         EG +
Sbjct: 428 KMAENFPKHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGFAHTYAVEGEH 487

Query: 183 EDAVHAF 189
           E A+ A+
Sbjct: 488 EQAISAY 494

>ZYRO0C03564g Chr3 (281661..284951) [3291 bp, 1096 aa] {ON} similar
           to uniprot|P89105 Saccharomyces cerevisiae YOL145C CTR9
           Component of the Paf1p complex which is a large complex
           that binds to and modulates the activity of RNA
           polymerase II and is required for expression of a subset
           of genes including cyclin genes contains TPR repeats
          Length = 1096

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 42/100 (42%), Gaps = 7/100 (7%)

Query: 109 MSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKA 168
             LK+YK AI  + +A+E+ P N     N AA    + +F N++  +         YSKA
Sbjct: 228 WQLKDYKLAIAAWKRALELNPVN-----NNAAVLVTLGNFHNSLTASENDESFRENYSKA 282

Query: 169 YSRLGAAKLAEGNNEDAVHAFKKVLELEGD--KSTEVMKN 206
              L      +G N       +     +GD  K  EV +N
Sbjct: 283 LQDLDGLLRKDGQNPVLWTLLQSYFYFKGDFTKVIEVYEN 322

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 29.3 bits (64), Expect = 5.1,   Method: Composition-based stats.
 Identities = 18/70 (25%), Positives = 32/70 (45%), Gaps = 2/70 (2%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKL--D 162
           GN+      Y+ AI  Y + I   P NP  +SN+A A   + +   A+      ++L   
Sbjct: 11  GNELYKQGLYRDAIGCYDRLIAAQPQNPVGHSNKAMALIKLGEHAQAIEACQQGLQLAAS 70

Query: 163 PTYSKAYSRL 172
           P ++   ++L
Sbjct: 71  PQHAALRAKL 80

>KLLA0E07239g Chr5 complement(655635..658325) [2691 bp, 896 aa] {ON}
           similar to uniprot|P42842 Saccharomyces cerevisiae
           YNL313C Protein required for cell viability
          Length = 896

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 49/104 (47%), Gaps = 2/104 (1%)

Query: 117 AIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYS-KAYSRLGAA 175
           A + +S+ + +  ++   +SN +AAY  ++    A      AI  D   + + +      
Sbjct: 647 AAEAFSRCVALDETHSLSWSNLSAAYVQLDKLKEAHSCLKRAISSDARKNWRIWDNYMIV 706

Query: 176 KLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFV 219
            +  G  ED + AF+ +++L  DK+ E M  +    +KL++  V
Sbjct: 707 SMKLGEWEDVLLAFRNLVDLRKDKNGE-MSIELPILEKLIEILV 749

>Smik_4.774 Chr4 complement(1365084..1366838) [1755 bp, 584 aa] {ON}
           YDR497C (REAL)
          Length = 584

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 5/39 (12%)

Query: 198 DKSTEVMKNDY-----ENAKKLVQTFVTLNKNVPDPSGP 231
           +K+TEV+K  Y     E  K+ V+  VTLN+++P  S P
Sbjct: 280 EKATEVLKRSYTDTSEEIIKRKVEELVTLNQSIPGKSVP 318

>Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {ON}
           YBL084C (CDC27) - component of the anaphase-promoting
           complex [contig 33] FULL
          Length = 628

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 18/81 (22%), Positives = 38/81 (46%)

Query: 112 KNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSR 171
           K+++ +I  + ++ ++ PS  + Y+ +   Y   + F  A+     A+  +  +  AY  
Sbjct: 424 KDHEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKALASNSQHYNAYYG 483

Query: 172 LGAAKLAEGNNEDAVHAFKKV 192
           LG   L  G  E+ +  F+K 
Sbjct: 484 LGMCSLKLGQYEECLLHFEKA 504

 Score = 30.8 bits (68), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 43/97 (44%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           G   + L  Y+  +  + KA  I P N         A + +     A+ + + A +L P 
Sbjct: 485 GMCSLKLGQYEECLLHFEKARSINPVNVILICCCGVALEKLSHQERALQNYDLACELQPM 544

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGDKST 201
            S A  +     LA G    A+ +F+K++++  D++T
Sbjct: 545 SSLALFKRAQLLLAMGKYNYALESFEKLVKIAPDEAT 581

>CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q06677 Saccharomyces cerevisiae YDR320c SWA2
          Length = 661

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 4/55 (7%)

Query: 113 NYKSAIDKYSKAIEIYP-SNPFY---YSNRAAAYQMIEDFTNAVLDANTAIKLDP 163
           +Y SA+++Y K++   P  +P     YSN  A+   I   + +V+DA  A+KL P
Sbjct: 377 DYASAVEEYEKSLNTLPMKHPLRIIAYSNIIASRIKIGQHSQSVVDAQEAMKLLP 431

>ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR080W (DIA2)
          Length = 685

 Score = 30.8 bits (68), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 29/62 (46%)

Query: 137 NRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELE 196
           NRAA ++ +     A+ DA   I +D    K Y R G      G  E+A+  ++  L+  
Sbjct: 75  NRAATFEKLNKLDRALADAAYMITVDAYNLKGYIRRGKVLQKLGRYEEALQVYENGLKQA 134

Query: 197 GD 198
           G+
Sbjct: 135 GE 136

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 32/64 (50%), Gaps = 8/64 (12%)

Query: 133 FYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKV 192
            +YSN        +D+   V     A+ + P     ++RLGA+      +E+A+ A++K 
Sbjct: 435 LFYSN--------DDYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKA 486

Query: 193 LELE 196
           L+L+
Sbjct: 487 LQLK 490

>Kwal_55.22152 s55 (1134267..1137572) [3306 bp, 1101 aa] {ON}
           YOL145C (CTR9) - involved in mitosis and chromosome
           segregation [contig 124] FULL
          Length = 1101

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 39/90 (43%), Gaps = 5/90 (5%)

Query: 109 MSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKA 168
             LK+YK AI  + +++++ P N     +      ++ DF NA+ ++         Y+KA
Sbjct: 241 WQLKDYKMAIRSWKRSLDLNPQN-----DNVKILILLGDFHNALTNSEDDEAFKENYTKA 295

Query: 169 YSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198
              L        NN   +  F+    L+GD
Sbjct: 296 LRELDTLFAVNKNNSALLVLFQSYCYLKGD 325

>KLLA0A05258g Chr1 (466776..468674) [1899 bp, 632 aa] {ON} similar
           to uniprot|P16522 Saccharomyces cerevisiae YHR166C CDC23
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 632

 Score = 30.4 bits (67), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 18/100 (18%), Positives = 46/100 (46%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPT 164
           G++ + +KN  +AI+ Y +A ++ P +   +     AY++++  + A+     A  L P 
Sbjct: 444 GHEFIEMKNSHAAIECYRRASDVNPRDFQAWYGLGQAYEVLDKHSFALYYFQKACALKPL 503

Query: 165 YSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGDKSTEVM 204
             + +    +          A+  F++  +L G++   ++
Sbjct: 504 DKRMWFASASCYEKLDKTVQAIKCFQRSSQLSGEQDISIL 543

>KNAG0L02010 Chr12 (357972..360080) [2109 bp, 702 aa] {ON} Anc_5.689
           YOR080W
          Length = 702

 Score = 30.4 bits (67), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 4/80 (5%)

Query: 126 EIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDA 185
            ++P       N  A Y+ ++    A+  A+  I+ D    K Y R G      G++  A
Sbjct: 60  HLHPKYTKLLDNLCACYEKLDQCPKALRIADKMIQRDQFNMKCYIRRGKLLQKLGDDLAA 119

Query: 186 VHAFKKVLELEGDKSTEVMK 205
            H +K+ L    +KSTE  +
Sbjct: 120 YHNYKRAL----NKSTECSR 135

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 30.4 bits (67), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 32/64 (50%), Gaps = 8/64 (12%)

Query: 133 FYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKV 192
            +YSN        +D+   V     A+ + P     ++RLGA+      +E+A+ A++K 
Sbjct: 428 LFYSN--------DDYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKA 479

Query: 193 LELE 196
           L+L+
Sbjct: 480 LQLK 483

>Smik_14.18 Chr14 complement(29815..32529) [2715 bp, 904 aa] {ON}
           YNL313C (REAL)
          Length = 904

 Score = 30.4 bits (67), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 50/107 (46%), Gaps = 6/107 (5%)

Query: 117 AIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYS-KAYS--RLG 173
           A + +S+ + + P +   +SN +AAY  ++    A      AI  D   + K +    L 
Sbjct: 656 AAEAFSRCVSLDPYHALSWSNLSAAYMKMDKLKEAYSCLKRAIASDAQKNWKIWENFMLV 715

Query: 174 AAKLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVT 220
           A KL E   ED + A K+++ +  DK  E    D    +KLV+  VT
Sbjct: 716 AVKLNEW--EDVLMACKQLVNIRRDKCGE-GSIDLPIIEKLVELLVT 759

>ZYRO0D00572g Chr4 complement(42511..44830,45510..45547) [2358 bp,
           785 aa] {ON} similar to uniprot|P09798 Saccharomyces
           cerevisiae YKL022C CDC16 Subunit of the
           anaphase-promoting complex/cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition required for sporulation
          Length = 785

 Score = 30.4 bits (67), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 43/110 (39%), Gaps = 21/110 (19%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNA------VLDA--- 155
           G + M+L  +  A + ++ A +  P +P   +     Y    D   A       L+A   
Sbjct: 572 GMQYMALNTFSLAEEYFTLAYDTCPQDPLLLNEMGVMYFKRNDLHKAKRYLKRALEAVKE 631

Query: 156 -----NTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGDKS 200
                 T++ +    + AY RLG        NE A+  FK VLE+    S
Sbjct: 632 LNPTSRTSVSIQMNLAHAYRRLG-------ENERAIKCFKTVLEVSSKDS 674

>NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON}
           Anc_8.470
          Length = 590

 Score = 30.0 bits (66), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 32/64 (50%), Gaps = 8/64 (12%)

Query: 133 FYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKV 192
            +YSN        +DF   +     A+K++P     ++RLGA+      +E+A+ A+ K 
Sbjct: 450 LHYSN--------DDFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKA 501

Query: 193 LELE 196
           + L+
Sbjct: 502 INLK 505

>TDEL0B07600 Chr2 (1331773..1334031) [2259 bp, 752 aa] {ON}
           Anc_2.665 YKL022C
          Length = 752

 Score = 30.4 bits (67), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 44/110 (40%), Gaps = 21/110 (19%)

Query: 105 GNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAY------QMIEDFTNAVLDA--- 155
           G + M+L     A + ++ + +I P +P   +     Y      Q  + F    L+A   
Sbjct: 539 GMQYMALNTLSLAEEYFTLSYDICPQDPLLLNEMGVMYFKRNDLQKAKKFLKRALEAVEE 598

Query: 156 -----NTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGDKS 200
                 T++ +    + AY RLG        NE A+  FK VL++    S
Sbjct: 599 LDPTSKTSVSIQMNLAHAYRRLG-------ENERAIKCFKSVLKVSNKSS 641

>CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244w PAS10 peroxisomal targeting signal receptor
          Length = 590

 Score = 30.0 bits (66), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 13/51 (25%), Positives = 29/51 (56%)

Query: 146 EDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELE 196
           ++F   +     A+K++P     ++RLGA+      +E+A+ A+ + L+L+
Sbjct: 438 DEFDRTIDCFQAALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 488

>TPHA0B04720 Chr2 complement(1107735..1110488) [2754 bp, 917 aa]
           {ON} Anc_1.55 YDR505C
          Length = 917

 Score = 30.0 bits (66), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 12/82 (14%)

Query: 10  ALIVNYLHKI----------IDGKEVSEDNAESLNVAI-DCISDVFELDPTSEEKIINDV 58
           +L  NY+ KI           DG   + D A S NV+I +  ++V E DP S  K     
Sbjct: 70  SLFRNYISKIDNANTLKNSSFDGNNNTNDIASSNNVSIGNEFNEVSEEDPISGSKFNKST 129

Query: 59  FNKSDLKTITLKGLGLQNVSDV 80
           FN  DL + + +G+ L   S +
Sbjct: 130 FNDFDLSS-SFRGISLNGSSHI 150

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.128    0.347 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,675,952
Number of extensions: 1503296
Number of successful extensions: 5657
Number of sequences better than 10.0: 262
Number of HSP's gapped: 5539
Number of HSP's successfully gapped: 367
Length of query: 343
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 233
Effective length of database: 40,868,139
Effective search space: 9522276387
Effective search space used: 9522276387
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 66 (30.0 bits)