Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1032.66.16ON1004100447500.0
TDEL0G045306.16ON95868517760.0
TPHA0M002406.16ON93962017070.0
ZYRO0C07898g6.16ON97472117040.0
YEL061C (CIN8)6.16ON100064315850.0
NCAS0H008806.16ON100462415850.0
Skud_5.286.16ON99861415810.0
Smik_5.266.16ON100267415520.0
NDAI0D008706.16ON106962515530.0
SAKL0E01078g6.16ON94871215260.0
Suva_5.66.16ON99962115210.0
KAFR0L003706.16ON96362314760.0
KLTH0C11330g6.16ON94163914151e-180
Ecym_30206.16ON94461714071e-179
KLLA0D01045g6.16ON96561514081e-178
CAGL0B03641g6.16ON98860614091e-178
Kwal_56.224036.16ON94354913991e-177
ACR010C6.16ON94561013831e-175
TBLA0A072306.16ON109763913511e-168
KNAG0M011306.16ON95055712971e-162
Kpol_1045.736.16ON96261712391e-153
TPHA0J003006.16ON9826478841e-102
SAKL0F12298g7.387ON11122516181e-65
ACR228C7.387ON11292406127e-65
Suva_2.547.387ON11102156091e-64
Smik_2.537.387ON11132156073e-64
TPHA0E008907.387ON12322126093e-64
YBL063W (KIP1)7.387ON11112156064e-64
Skud_2.417.387ON11102156064e-64
Ecym_46887.387ON11342436012e-63
NDAI0E043007.387ON11862695994e-63
TDEL0C016007.387ON11052145922e-62
NCAS0E026407.387ON11023155904e-62
KAFR0L017107.387ON11512155906e-62
ZYRO0B03234g7.387ON11382415871e-61
TBLA0D006407.387ON11422674374e-43
KLTH0G03850g5.531ON4731933638e-36
SAKL0G05016g5.531ON5041823603e-35
SAKL0G18920g2.633ON6492183531e-33
KLLA0B00759g5.531ON4561813396e-33
Kwal_47.186085.531ON4791813311e-31
Ecym_34152.633ON6621713211e-29
ADR145C2.633ON6351703155e-29
Ecym_40665.531ON4781813097e-29
NDAI0I029603.528ON8681883104e-28
Skud_7.533.528ON8051783087e-28
Smik_7.483.528ON8051783087e-28
SAKL0F01760g3.528ON8091783078e-28
KAFR0F042103.528ON6721783051e-27
Suva_7.443.528ON8051783033e-27
TDEL0D059603.528ON7331793023e-27
KNAG0B005203.528ON7231833013e-27
CAGL0I07029g3.528ON7051803014e-27
YGL216W (KIP3)3.528ON8051783006e-27
NCAS0E005503.528ON7841853006e-27
Kwal_47.190933.528ON8191793007e-27
Kpol_1004.255.531ON5061882931e-26
ZYRO0E08668g3.528ON7781792971e-26
TBLA0C049603.528ON8011852952e-26
Kpol_423.83.528ON8061842943e-26
KLTH0G01606g3.528ON8191792934e-26
KNAG0A078803.479ON7641572925e-26
TPHA0D034803.528ON8471792918e-26
ZYRO0D12650g5.531ON4781792831e-25
AER441C3.528ON8181782846e-25
KLLA0A01606g3.528ON7692392828e-25
TBLA0C053103.479ON6761652792e-24
Ecym_12003.528ON8331712802e-24
CAGL0D04994g3.479ON6921662773e-24
NCAS0C013508.678ON6551832763e-24
TBLA0C039403.479ON7391822764e-24
AGR253W3.479ON7091692754e-24
KAFR0B065903.479ON7061522738e-24
TDEL0F036403.479ON7041652721e-23
SAKL0F03168g3.479ON7061492684e-23
KLTH0F14498g3.479ON7021672675e-23
Kpol_505.393.479ON6921592657e-23
NCAS0F034703.479ON6981672659e-23
Ecym_44073.479ON7111662632e-22
Kpol_1050.1033.479ON6971522612e-22
NDAI0B057703.479ON7631552603e-22
Kpol_1013.78.678ON6203192584e-22
KLLA0B10956g3.479ON6901522576e-22
TPHA0D032003.479ON7241502569e-22
YPR141C (KAR3)3.479ON7291482561e-21
Suva_16.4693.479ON7311482542e-21
Skud_16.4353.479ON7291482542e-21
Smik_16.3883.479ON7291482532e-21
KAFR0H024108.678ON6582282522e-21
ZYRO0B04290g3.479ON7311532532e-21
Kwal_26.88068.678ON7152502523e-21
KLLA0D05951g8.678ON6681762504e-21
TPHA0D012708.678ON6961872461e-20
ZYRO0F07414g8.678ON6541942452e-20
SAKL0H06490g8.678ON6572692433e-20
NDAI0E02090singletonON6851962416e-20
CAGL0M02189g8.678ON6721932391e-19
YPL155C (KIP2)8.678ON7061992362e-19
ACR145W8.678ON6852742327e-19
Skud_16.1278.678ON7061992327e-19
TBLA0C018808.678ON4681692297e-19
KLTH0D11286g8.678ON6781842292e-18
KNAG0J017208.678ON6253042272e-18
Smik_6.3528.678ON7152062273e-18
Ecym_23958.678ON6872102264e-18
TDEL0B072702.633ON6441812246e-18
TDEL0A062408.678ON6372702221e-17
Suva_16.1558.678ON7041992202e-17
TPHA0D041903.479ON6721512157e-17
Kwal_55.21164singletonOFF5881621809e-13
Kpol_1019.112.633ON6471681809e-13
Kwal_YGOB_55.211643.479ON6571621801e-12
YKL079W (SMY1)2.633ON6561091692e-11
TPHA0N016502.633ON6821821683e-11
Suva_11.1452.633ON6571091657e-11
KNAG0M025402.633ON5221571593e-10
Skud_11.1482.633ON6561091513e-09
NCAS0H031802.633ON6601761452e-08
Smik_11.1602.633ON6562391423e-08
TBLA0A008202.633ON8031671362e-07
TBLA0C008002.633ON6931301353e-07
CAGL0L05104g2.633ON6752131291e-06
ZYRO0E01078g2.633ON6681081272e-06
NDAI0C004802.633ON5983261237e-06
KAFR0C040202.633ON6672371182e-05
KNAG0H003602.633ON6811141084e-04
NCAS0C052002.633ON572901000.003
NCAS0C028308.401ON87472791.3
KNAG0I006302.315ON373174762.0
Ecym_10851.81ON70565752.9
Skud_6.338.27ON457137744.2
Smik_6.418.27ON457137744.3
YFL037W (TUB2)8.27ON457137744.3
Suva_6.208.27ON457137735.6
AFR352C1.474ON642242727.4
NCAS0F031605.402ON3732178728.0
CAGL0D02420g8.315ON185114698.2
KLLA0D05269g8.27ON449100719.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1032.6
         (1004 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..1...  1834   0.0  
TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {O...   688   0.0  
TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16...   662   0.0  
ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {...   660   0.0  
YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}  C...   615   0.0  
NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {...   615   0.0  
Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON} Y...   613   0.0  
Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON} ...   602   0.0  
NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {...   602   0.0  
SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar ...   592   0.0  
Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YE...   590   0.0  
KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16...   573   0.0  
KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {...   549   e-180
Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to ...   546   e-179
KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar ...   546   e-178
CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} simila...   547   e-178
Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061...   543   e-177
ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON} S...   537   e-175
TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_...   525   e-168
KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6....   504   e-162
Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] ...   481   e-153
TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16...   345   e-102
SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa] ...   242   1e-65
ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON} ...   240   7e-65
Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W (...   239   1e-64
Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (R...   238   3e-64
TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7....   239   3e-64
YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}  KIP1Kines...   238   4e-64
Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W (R...   238   4e-64
Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} simila...   236   2e-63
NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {...   235   4e-63
TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7....   232   2e-62
NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7....   231   4e-62
KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] ...   231   6e-62
ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa] ...   230   1e-61
TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7....   172   4e-43
KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some s...   144   8e-36
SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly...   143   3e-35
SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]...   140   1e-33
KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some sim...   135   6e-33
Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {...   132   1e-31
Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar t...   128   1e-29
ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON} S...   125   5e-29
Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar t...   123   7e-29
NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {O...   124   4e-28
Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)   123   7e-28
Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)   123   7e-28
SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} simila...   122   8e-28
KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {O...   122   1e-27
Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)   121   3e-27
TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa] ...   120   3e-27
KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528...   120   3e-27
CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} simila...   120   4e-27
YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}  KIP3Kinesin-...   120   6e-27
NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}...   120   6e-27
Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]...   120   7e-27
Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON} (54983....   117   1e-26
ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {...   119   1e-26
TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa] ...   118   2e-26
Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON} (11134..13...   117   3e-26
KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} simila...   117   4e-26
KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] ...   117   5e-26
TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {O...   116   8e-26
ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some...   113   1e-25
AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}...   114   6e-25
KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} simila...   113   8e-25
TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON} Anc_3...   112   2e-24
Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar t...   112   2e-24
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...   111   3e-24
NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {O...   110   3e-24
TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {O...   110   4e-24
AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic ...   110   4e-24
KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] ...   109   8e-24
TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {O...   109   1e-23
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...   107   4e-23
KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]...   107   5e-23
Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}...   106   7e-23
NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {O...   106   9e-23
Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar t...   105   2e-22
Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]...   105   2e-22
NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] ...   104   3e-22
Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON} (11880.....   103   4e-22
KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} simila...   103   6e-22
TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {O...   103   9e-22
YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON} ...   103   1e-21
Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {...   102   2e-21
Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {...   102   2e-21
Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {...   102   2e-21
KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {O...   101   2e-21
ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} simila...   102   2e-21
Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C...   101   3e-21
KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} simila...   100   4e-21
TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.6...    99   1e-20
ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} simila...    99   2e-20
SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {...    98   3e-20
NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {O...    97   6e-20
CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa] ...    97   1e-19
YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON} ...    96   2e-19
ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic ho...    94   7e-19
Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {...    94   7e-19
TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.6...    93   7e-19
KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} simila...    93   2e-18
KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8....    92   2e-18
Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C ...    92   3e-18
Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}...    92   4e-18
TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa] ...    91   6e-18
TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON} Anc_8...    90   1e-17
Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {...    89   2e-17
TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {O...    87   7e-17
Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa] {...    74   9e-13
Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {O...    74   9e-13
Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)...    74   1e-12
YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Prote...    70   2e-11
TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {...    69   3e-11
Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079...    68   7e-11
KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2....    66   3e-10
Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079...    63   3e-09
NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633     60   2e-08
Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079...    59   3e-08
TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.6...    57   2e-07
TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {O...    57   3e-07
CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa] ...    54   1e-06
ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar ...    54   2e-06
NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}...    52   7e-06
KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.6...    50   2e-05
KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633...    46   4e-04
NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON} Anc_2...    43   0.003
NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401     35   1.3  
KNAG0I00630 Chr9 (107952..109073) [1122 bp, 373 aa] {ON} Anc_2.3...    34   2.0  
Ecym_1085 Chr1 complement(170657..172774) [2118 bp, 705 aa] {ON}...    33   2.9  
Skud_6.33 Chr6 (59497..60870) [1374 bp, 457 aa] {ON} YFL037W (REAL)    33   4.2  
Smik_6.41 Chr6 (71718..73091) [1374 bp, 457 aa] {ON} YFL037W (REAL)    33   4.3  
YFL037W Chr6 (56336..57709) [1374 bp, 457 aa] {ON}  TUB2Beta-tub...    33   4.3  
Suva_6.20 Chr6 (29833..31206) [1374 bp, 457 aa] {ON} YFL037W (REAL)    33   5.6  
AFR352C Chr6 complement(1073984..1075912) [1929 bp, 642 aa] {ON}...    32   7.4  
NCAS0F03160 Chr6 (633224..644422) [11199 bp, 3732 aa] {ON} Anc_5...    32   8.0  
CAGL0D02420g Chr4 (247761..248318) [558 bp, 185 aa] {ON} weakly ...    31   8.2  
KLLA0D05269g Chr4 complement(455261..456610) [1350 bp, 449 aa] {...    32   9.2  

>Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..12123)
            [3015 nt, 1005 aa]
          Length = 1004

 Score = 1834 bits (4750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 923/1004 (91%), Positives = 923/1004 (91%)

Query: 1    MSLDPDKGNGDELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAG 60
            MSLDPDKGNGDELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAG
Sbjct: 1    MSLDPDKGNGDELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAG 60

Query: 61   QMNSKTYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDE 120
            QMNSKTYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDE
Sbjct: 61   QMNSKTYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDE 120

Query: 121  RLYNGELSDSAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTA 180
            RLYNGELSDSAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTA
Sbjct: 121  RLYNGELSDSAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTA 180

Query: 181  KKLRIFDSNASQIRKVSEYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
            KKLRIFDSNASQIRKVSEY                                         
Sbjct: 181  KKLRIFDSNASQIRKVSEYNKTNTSTNTGTNNNNNNNNNNNNNNTNGRSTSPSNSSKSRP 240

Query: 241  QPILGXXXXXXXXXXXXXAFLKPSSSNLNXXXXXXXXXXXXXXXXXXXXXXXXXXXPDKQ 300
            QPILG             AFLKPSSSNLN                           PDKQ
Sbjct: 241  QPILGNNRIRSRLSSSNNAFLKPSSSNLNTSNDTIASSSSSSSSSTSSAYTSSTVSPDKQ 300

Query: 301  TGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHDGKI 360
            TGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHDGKI
Sbjct: 301  TGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHDGKI 360

Query: 361  FRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFRESK 420
            FRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFRESK
Sbjct: 361  FRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFRESK 420

Query: 421  LTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKDILV 480
            LTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKDILV
Sbjct: 421  LTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKDILV 480

Query: 481  KNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQNGL 540
            KNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQNGL
Sbjct: 481  KNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQNGL 540

Query: 541  LLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEMQAT 600
            LLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEMQAT
Sbjct: 541  LLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEMQAT 600

Query: 601  IKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKDEVK 660
            IKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKDEVK
Sbjct: 601  IKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKDEVK 660

Query: 661  SIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQLSISISELNIE 720
            SIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQLSISISELNIE
Sbjct: 661  SIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQLSISISELNIE 720

Query: 721  HNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESRNIIID 780
            HNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESRNIIID
Sbjct: 721  HNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESRNIIID 780

Query: 781  SLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKTSVTSTS 840
            SLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKTSVTSTS
Sbjct: 781  SLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKTSVTSTS 840

Query: 841  DLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNESITMNESSIN 900
            DLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNESITMNESSIN
Sbjct: 841  DLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNESITMNESSIN 900

Query: 901  AFDKLSESIHSAFEKYNTANTISRLDESTNLMKQNKDGDISLDRVEMLPLSPIFFSENKN 960
            AFDKLSESIHSAFEKYNTANTISRLDESTNLMKQNKDGDISLDRVEMLPLSPIFFSENKN
Sbjct: 901  AFDKLSESIHSAFEKYNTANTISRLDESTNLMKQNKDGDISLDRVEMLPLSPIFFSENKN 960

Query: 961  NHVLSPSKVVVNSSAKKIQASKYQKRLNSTEDMDPIATKVQKIK 1004
            NHVLSPSKVVVNSSAKKIQASKYQKRLNSTEDMDPIATKVQKIK
Sbjct: 961  NHVLSPSKVVVNSSAKKIQASKYQKRLNSTEDMDPIATKVQKIK 1004

>TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {ON}
           Anc_6.16 YEL061C
          Length = 958

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/685 (51%), Positives = 504/685 (73%), Gaps = 8/685 (1%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357
           D+  GIYIQNL++FHIT+AKEGI+LLQ+GL++RQVA+TKMNDFSSRSHTIFTI LYKE++
Sbjct: 244 DQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYN 303

Query: 358 GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR 417
           G+IFR+SKMNLVDLAGSENISRSGAQ+QRAKEAGSINQSLLTLGRVINSL DK++H+PFR
Sbjct: 304 GEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFR 363

Query: 418 ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD 477
           ESKLTRLLQDSLGGNTKTALIATISPAK+NSEETCSTL+YAAKAK+IKNKPQLGS+I KD
Sbjct: 364 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKD 423

Query: 478 ILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQ 537
           ILVKNI  ELAK+KADLLSTKS++G+YMSQ +YKELTNDLESYKTEV+ECKR I+ LT+Q
Sbjct: 424 ILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEVKECKRAIETLTSQ 483

Query: 538 NGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEM 597
           N LLLKDKKASNEV++LQ+IKLQ+M+D++S L+   EKQ+++EQ LV     LK+    M
Sbjct: 484 NTLLLKDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTM 543

Query: 598 QATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKD 657
           Q+ IK H  RE+  ++KM  +FN E  R+K  ++ N+  I ++I   N  +  NI+ I+ 
Sbjct: 544 QSIIKEHERRERDIESKMGDLFNNEFARVKQTILSNIRDIEQQIDWENIGVQGNIDSIRG 603

Query: 658 EVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQLSISISEL 717
           E+  +++  Q + + +YKDC+E+++ E+P       + + +++K+    +  L+ ++S++
Sbjct: 604 EISKLLERAQQQTDDMYKDCVEKILDETPGHFQLAAEKVSEVEKLIATCHRDLTENLSDV 663

Query: 718 NIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESRNI 777
           + E N+L+QYLN  FFK++HEEIL  HI++TY +I+ ++  + +Q K  ++ +LE+++++
Sbjct: 664 SEEFNNLRQYLNDHFFKNNHEEILVSHIDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDL 723

Query: 778 IIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKTSVT 837
           +++SLK  T D+++ EM+LF P+KKKWEDSF+ INKCDS+N  +   + + L  +K+++ 
Sbjct: 724 MLESLKTATYDVIRKEMQLFEPQKKKWEDSFKYINKCDSINFAFQNGVKSPLLGIKSTLG 783

Query: 838 STSDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNESITMNES 897
           S+ + ++  ++++++  D       +  NS+   +QF+ ++ K S L   L +S+ +   
Sbjct: 784 SSQEAINKTITKVKEQMDEHESPASMLSNSRVFSEQFSGILNKQSLLHESLKKSVIITSD 843

Query: 898 SINAFDKLSESIHSAFEKYNTANTISRLDESTNLMKQNKDGD-ISLDRVEMLPLSPIFFS 956
             +A DKL E+I     +  ++    R++    ++++  + + + LDR    PL P  F 
Sbjct: 844 HADAVDKLKEAIDHVVSERGSSMEGERVEHVDGILRRMDEQNLLYLDRS---PLRPANFK 900

Query: 957 ENKNN----HVLSPSKVVVNSSAKK 977
            NK+     +  SP K V +S  K+
Sbjct: 901 MNKSERNSPNRSSPCKSVSHSPCKQ 925

 Score =  298 bits (762), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 139/179 (77%), Positives = 165/179 (92%), Gaps = 1/179 (0%)

Query: 11  DELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVD 70
           +ELNI VAVRCRGRNEREIKAKSSVVVSVPDV GS+E++INTT DVGI  Q+NSKTYTVD
Sbjct: 13  EELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVD 72

Query: 71  KVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDS 130
           +VFGPSANQ L+F+++AEPLF DFI+GYNCTVLVYGMTSTGKTYTMTGDE+LY+GELS+S
Sbjct: 73  EVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSES 132

Query: 131 AGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTAKKLRIFDSN 189
           AGIIPR+LFKLF+ +E Q +DY++KCSF+ELYNEELKDLL + Q I ++++KLRIFDSN
Sbjct: 133 AGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEI-ASSRKLRIFDSN 190

>TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16
           YEL061C
          Length = 939

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/620 (53%), Positives = 462/620 (74%)

Query: 301 TGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHDGKI 360
             IYIQNL+EFHI +A+EGI+LLQ+GL+YRQVASTKMND SSRSHTIFTINLYKEH G+I
Sbjct: 236 ASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEI 295

Query: 361 FRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFRESK 420
           F+ISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINS+ADKNIHIPFRESK
Sbjct: 296 FKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESK 355

Query: 421 LTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKDILV 480
           LTRLLQDSLGGNTKTALIATISPAKLN+EETCSTLEYA KAKSIKNKPQLGSII KD+ +
Sbjct: 356 LTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRL 415

Query: 481 KNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQNGL 540
           K++ +ELAK+K DL STK +DGVYM+Q HYK+LTNDLESYKTE+QEC R++  L  QN L
Sbjct: 416 KDLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNAL 475

Query: 541 LLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEMQAT 600
           LLKDKKASNEV+ LQ++ L  M +++S++  ++E QH+KEQ LV+ +   + KS++M+  
Sbjct: 476 LLKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLKMKTV 535

Query: 601 IKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKDEVK 660
           IK +SE+E+  Q+ MK IFN+EL++LK LLIENL  I K+ +I  T++  NI+ IKD+V 
Sbjct: 536 IKEYSEKEERIQSNMKSIFNDELIKLKELLIENLNGIAKENLIVQTNVKDNIKLIKDDVI 595

Query: 661 SIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQLSISISELNIE 720
           SI+  +Q  +  ++ +  +Q++KE+P++L   + D+ K Q++++ Y   L  ++  +  +
Sbjct: 596 SIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFENLESIKQQ 655

Query: 721 HNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESRNIIID 780
           ++ L +Y +  FFKS+H  I+N+H+  T   I ++ + I +Q +  +E + E++  +I++
Sbjct: 656 YSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKLILE 715

Query: 781 SLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKTSVTSTS 840
           +LK  +SD++++EM  F   K +W+ SF+ IN CD LNN Y   +   L NMK  + S+ 
Sbjct: 716 NLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGKLQSSD 775

Query: 841 DLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNESITMNESSIN 900
           +++  H++Q++   D+ + + KL    + IG  + +++ K  KL  HL  S+   ++S+ 
Sbjct: 776 EIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQISLNSTQNSLL 835

Query: 901 AFDKLSESIHSAFEKYNTAN 920
            FD++ +SI  AF  Y+  N
Sbjct: 836 VFDEICKSIQFAFANYSKTN 855

 Score =  317 bits (813), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 147/191 (76%), Positives = 171/191 (89%), Gaps = 6/191 (3%)

Query: 1   MSLDPDK--GNGDELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDV-- 56
           MS DP K   + DE+NI+VAVRCRGRN+REIK+KSSV+VSVPDV GS+EI+INT++D+  
Sbjct: 1   MSADPQKIEDDTDEMNIMVAVRCRGRNKREIKSKSSVIVSVPDVMGSNEISINTSDDIVS 60

Query: 57  GIAGQMNSKTYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTM 116
           G+  Q+NSKTYTVDKVFGPSANQRLIFEE+AEPLFNDF+RGYNCTVLVYGMTSTGKTYTM
Sbjct: 61  GLTAQLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTM 120

Query: 117 TGDERLYNGELSDSAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAI 176
           TGDE+LY G+LSDSAGIIPRVLFKLF+ +EFQ+D+Y+IKCSFIELYNEELKDLL +    
Sbjct: 121 TGDEKLYKGDLSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSN-- 178

Query: 177 NSTAKKLRIFD 187
           N+  KKLRIFD
Sbjct: 179 NTKLKKLRIFD 189

>ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {ON}
            some similarities with uniprot|P27895 Saccharomyces
            cerevisiae YEL061C CIN8 Kinesin motor protein involved in
            mitotic spindle assembly and chromosome segregation
          Length = 974

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/721 (47%), Positives = 512/721 (71%), Gaps = 37/721 (5%)

Query: 298  DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357
            D  +G+YIQNL++FHITSA++G++LLQ+GL+ RQVA+TKMNDFSSRSHTIFTI LY+EH 
Sbjct: 272  DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331

Query: 358  GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR 417
            G++F++SKMNLVDLAGSENISRSGAQ+QRAKEAGSINQSLLTLGRVINSLADK+ H+PFR
Sbjct: 332  GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFR 391

Query: 418  ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD 477
            ESKLTRLLQDSLGGNTKTALIATISPAK+NSEETCSTL+YA+KAK+IKN+PQL S I KD
Sbjct: 392  ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKD 451

Query: 478  ILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQ 537
            ILVKNI +ELAKVK+DLLSTK R+GVYMSQ +YKE+TNDLESYKTE+QE KR+I+ L++Q
Sbjct: 452  ILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQ 511

Query: 538  NGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEM 597
            N LLLKDKKASNEV+ LQ+IKLQ+MKD +S L + +E QH+KEQ LVD+   LKS     
Sbjct: 512  NSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLT 571

Query: 598  QATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINN-------TDLGM 650
            Q+ IK + +RE+    +M+ I  +E L+ + +L+ N+E I      N+         +  
Sbjct: 572  QSVIKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQ 631

Query: 651  NIEKIKDEVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQL 710
            N+  ++ EV  ++   Q  A  +YKD +E++++E+P +  ++++ + +++   + Y+++L
Sbjct: 632  NLNVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRL 691

Query: 711  SISISELNIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELY 770
            + ++S+++  +N+LKQY N  FFK++HEE+LN HI+KTY  ++ ++ G++++ K  ++ +
Sbjct: 692  TENLSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDH 751

Query: 771  LEESRNIIIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLS 830
            L++++ +++ SL++ T++ +  EM+LF P++KKWE+SF++IN CDS++N + GD+ + LS
Sbjct: 752  LKDNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALS 811

Query: 831  NMKTSVTSTSDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNE 890
            ++K++  S++D++   VS+++        ++ + + ++ + +Q  +++ K+S L + L +
Sbjct: 812  DIKSTFGSSTDVISRSVSKVKDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYK 871

Query: 891  SITMNESSINAFDKLSESIHSAFEKYNTA---NTISRLDESTNLMKQNKDGDISLDRVEM 947
            SI  ++  I+AFD+L E I +     N+    N I+    +T  + QN          E 
Sbjct: 872  SIKSSQGHISAFDELKERIRNTIASENSTLHQNKIA----TTPPLGQNS---------ER 918

Query: 948  LPLSPIFFSENKNNHVLSPSKVVVN-----SSAKKIQASKYQKRLNSTEDMDPIATKVQK 1002
             PL P          VL P+++  N      S  K Q SK    L   +D + +   V K
Sbjct: 919  SPLKPT---------VLQPNQLPENWRYGLRSPPKDQLSKSNGELKRHQDNETLEENVNK 969

Query: 1003 I 1003
            I
Sbjct: 970  I 970

 Score =  294 bits (752), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 141/189 (74%), Positives = 164/189 (86%), Gaps = 3/189 (1%)

Query: 1   MSLDPDKGNGD--ELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGI 58
           M   P  G  D  ELNI VAVR RGRNEREI+AKSSVVVSVPDV GS E+AINTT+DVGI
Sbjct: 1   MGSSPAGGGEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGI 60

Query: 59  AGQMNSKTYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTG 118
             QMNSKTY VDKVFGPSANQ+LIF+E+AEPLF DF++GYNCTVLVYGMTSTGKTYTMTG
Sbjct: 61  TAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTG 120

Query: 119 DERLYNGELSDSAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINS 178
           DE+LYN ELSDSAGIIPR+LFKLF+ ++ +++DY++KCSF+ELYNEELKDLLD+    NS
Sbjct: 121 DEKLYNDELSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDS-VENS 179

Query: 179 TAKKLRIFD 187
           + +KLRI+D
Sbjct: 180 SMRKLRIYD 188

>YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}
           CIN8Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 1000

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/643 (49%), Positives = 464/643 (72%), Gaps = 9/643 (1%)

Query: 297 PDKQT-GIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKE 355
           P+ QT GIYIQNL+EFHIT+A EG+ LLQ+GL++RQVASTKMNDFSSRSHTIFTI LYK+
Sbjct: 309 PNDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKK 368

Query: 356 HDGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIP 415
           H  ++FRISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L DK+ HIP
Sbjct: 369 HQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIP 428

Query: 416 FRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIIT 475
           FRESKLTRLLQDSLGGNTKTALIATISPAK+ SEETCSTLEYA+KAK+IKNKPQLGS I 
Sbjct: 429 FRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIM 488

Query: 476 KDILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLT 535
           KDILVKNI  ELAK+K+DLLSTKS++G+YMSQ HYK L +DLESYK EVQECKR I+ LT
Sbjct: 489 KDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLT 548

Query: 536 TQNGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSI 595
           ++N LL+KDK  S E    Q  +++S+K +I HL   ++KQH+ E  + D   KL+  + 
Sbjct: 549 SKNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTE 608

Query: 596 EMQATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKI 655
            MQ  +  + +RE     K +    +E+ +LKS L   L  + ++ ++  T++  N++ I
Sbjct: 609 VMQMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETNIQPNLDMI 668

Query: 656 KDEVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLND--DIIKM--QKISDLYNEQLS 711
           K+EV +++ T Q +A  +YKDC+++++ ESP     + +  DII++  QK    + + ++
Sbjct: 669 KNEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQK----FYKNIA 724

Query: 712 ISISELNIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYL 771
            ++S+++ E+N++KQYL   FFK++H+E+LN H++ TY+NI + +   VE  K  L  +L
Sbjct: 725 ENLSDISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVLNDHL 784

Query: 772 EESRNIIIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSN 831
           +E++ +I+ +L   TS ++  EM+LF PK+ KWE+SF++IN CDS+NN+++  ++A LS 
Sbjct: 785 DENKKLIMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAATLSQ 844

Query: 832 MKTSVTSTSDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNES 891
           +K++V ++S+ +++ +S M+   + +  +  L +N+ +   QF +++ K++ L+ ++  S
Sbjct: 845 IKSTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDNIKNS 904

Query: 892 ITMNESSINAFDKLSESIHSAFEKYNTANTISRLDESTNLMKQ 934
           IT   S I   D +  +I +  + Y      ++ +   N++K+
Sbjct: 905 ITSTHSHITNVDDIYNTIENIMKNYGNKENATKDEMIENILKE 947

 Score =  295 bits (754), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 152/184 (82%), Gaps = 7/184 (3%)

Query: 11  DELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVD 70
           +ELNI VAVRCRGRNEREI  KSSVVV+VPD+ GS EI+INTT D GI  QMN+K YTVD
Sbjct: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92

Query: 71  KVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDS 130
           KVFGP A+Q LIF+EVA PLF DFI+GYNCTVLVYGMTSTGKTYTMTGDE+LYNGELSD+
Sbjct: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152

Query: 131 AGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTA-------KKL 183
           AGIIPRVL KLFD +E Q +DY++KCSFIELYNEELKDLLD     +S         KKL
Sbjct: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDSNSNGSSNTGFDGQFMKKL 212

Query: 184 RIFD 187
           RIFD
Sbjct: 213 RIFD 216

>NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {ON}
           Anc_6.16
          Length = 1004

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/624 (50%), Positives = 464/624 (74%), Gaps = 10/624 (1%)

Query: 297 PDKQT-GIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKE 355
           PD+ T GIYIQNL+EFHIT+AKEG+ LLQ+GL++RQVASTKMNDFSSRSHTIFTI LYKE
Sbjct: 294 PDENTNGIYIQNLQEFHITNAKEGLSLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKE 353

Query: 356 HDGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIP 415
           H   +FR+SKMNLVDLAGSENI+RSGA NQRAKE GSINQSLLTLGRVINSLADK+ H+P
Sbjct: 354 HKDNLFRLSKMNLVDLAGSENINRSGAMNQRAKETGSINQSLLTLGRVINSLADKSPHVP 413

Query: 416 FRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIIT 475
           FRESKLTRLLQDSLGGNTKTALIATISPAK+ SEETCSTLEYA+KAK+IKNKPQLGS+I 
Sbjct: 414 FRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSVIL 473

Query: 476 KDILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLT 535
           KDIL+KNI SELAKVK+DL+STKS+DG+YMS  HY+EL  +LES KTEVQE KR+I+ L+
Sbjct: 474 KDILLKNITSELAKVKSDLMSTKSKDGIYMSHEHYQELIMELESSKTEVQESKRMIEKLS 533

Query: 536 TQNGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSI 595
           +QN +LLKDK+++NEV+ LQ+IKL ++KDS+S+L++ +E Q+ KE  L++ I +L+    
Sbjct: 534 SQNSMLLKDKRSANEVNELQRIKLNNLKDSMSNLNEKLEIQNGKETKLMEQIGQLEKSRE 593

Query: 596 EMQATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKI 655
           ++ + +K +  ++   + ++  I NE L  LK +L  + + I +     N D+ MN++ I
Sbjct: 594 KLNSLVKNYQTKQSQLKTQISNILNENLFELKKILNSHKDAIRQS--EGNFDVEMNLKVI 651

Query: 656 KDEVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQLSISIS 715
           KDE+ S+++ TQ +   +YK+ +E+ ++++PI L  + + + +++ +   Y  +++ ++S
Sbjct: 652 KDEITSMLEKTQHKTEMMYKEFIEEFLEQTPINLQKIFEHVTQVEFMVTGYYNEITENLS 711

Query: 716 ELNIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESR 775
           +++ E+N+LKQYL+  FF+++HE++LN HI  T D + ++S  +  + K  ++ +L E++
Sbjct: 712 DISEEYNNLKQYLDNDFFQNNHEDLLNIHINATSDILAQSSAELFNKFKIMMDAHLMENK 771

Query: 776 NIIIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKTS 835
            ++ID+ +  T+D++  EMELF PK+ KWE+S E+IN+CDS+NN +  +++  +S +KT+
Sbjct: 772 KLMIDNFRTATNDVITKEMELFKPKRNKWEESIELINRCDSINNGFHHNMTGQVSKIKTN 831

Query: 836 VTSTSDLVDDHVSQMRKYT------DNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLN 889
           + S+S  + + ++ ++         D++   T L EN     + F E++EKN  L+ +  
Sbjct: 832 LASSSSSIHNAIASIKSQVLEQLSNDDSDVKTAL-ENDPMFNKHFNEIIEKNMILQKNRK 890

Query: 890 ESITMNESSINAFDKLSESIHSAF 913
            +I   + S+   D+LSE++  A 
Sbjct: 891 NAINYTDKSLLNIDELSETVKIAL 914

 Score =  270 bits (691), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 131/193 (67%), Positives = 154/193 (79%), Gaps = 16/193 (8%)

Query: 12  ELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVDK 71
           ELNI VAVRCRGRNEREI +KS VVV+VPD+ G+ EI+INTT + GI  QMNSKTYTVDK
Sbjct: 28  ELNITVAVRCRGRNEREINSKSPVVVTVPDITGAQEISINTTGETGITAQMNSKTYTVDK 87

Query: 72  VFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLY-NGE-LSD 129
           VFGP+A+Q LIF+EVAEPLF DF++GYNCTVLVYGMTSTGKTYTMTGDE+LY NG  LSD
Sbjct: 88  VFGPAADQDLIFQEVAEPLFRDFVKGYNCTVLVYGMTSTGKTYTMTGDEKLYQNGTMLSD 147

Query: 130 SAGIIPRVLFKLFDAMEFQ--------NDDYIIKCSFIELYNEELKDLL-----DECQAI 176
           +AGIIPR+LFKLFD ++            D+++KCSF+ELYNE+LKDLL     DE Q  
Sbjct: 148 AAGIIPRILFKLFDTLDNHRHSDVTGSTTDFVVKCSFVELYNEDLKDLLNYDSNDEQQQQ 207

Query: 177 NS-TAKKLRIFDS 188
               ++KLRIFDS
Sbjct: 208 QQLGSRKLRIFDS 220

>Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON}
           YEL061C (REAL)
          Length = 998

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/614 (50%), Positives = 453/614 (73%), Gaps = 4/614 (0%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357
           D+  GIYIQNL+EFHIT+A EG+ LLQRGL++RQVASTKMNDFSSRSHTIFTI LYK+H 
Sbjct: 309 DQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 368

Query: 358 GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR 417
            ++FRISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L D++ HIPFR
Sbjct: 369 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFR 428

Query: 418 ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD 477
           ESKLTRLLQDSLGGNTKTALIATISPAK+ SEETCSTLEYA+KAK+IKNKPQLG+ + KD
Sbjct: 429 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKD 488

Query: 478 ILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQ 537
           ILVKNI  ELAK+K+DLLSTKS++G+YMSQ HYK L +DLES+K EVQECKR I+ L ++
Sbjct: 489 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASK 548

Query: 538 NGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEM 597
           N LL+KDK  S E    Q  +++S+K +I+HL   ++KQH+ E  +     KL+  +  M
Sbjct: 549 NSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVM 608

Query: 598 QATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKD 657
           Q  ++ + +RE     K +   ++E+  LK+ L   L+ + +K +   TD+  N++ +K+
Sbjct: 609 QVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKN 668

Query: 658 EVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLND--DIIKMQKISDLYNEQLSISIS 715
           EV ++++T Q +A  +YKDC+++++ ESP     + +  DII+++   + Y + ++ ++S
Sbjct: 669 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIE-FQNFY-KNIAENLS 726

Query: 716 ELNIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESR 775
           +++ E+N+LKQYL   FFK++H+E+LN HI+ TY+NI + +   VE  K  L  +LEE++
Sbjct: 727 DISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENK 786

Query: 776 NIIIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKTS 835
            +I+ ++ N TS ++  EM+LF P++ KWE+SF++INKCDS+NN+++ +++A LS +K +
Sbjct: 787 KLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKT 846

Query: 836 VTSTSDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNESITMN 895
           V ++S+ +++ +S M+   + +  +  L +N+ +   QF +++ K+  L+ ++  SIT  
Sbjct: 847 VDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIESSITST 906

Query: 896 ESSINAFDKLSESI 909
            S I   D +  +I
Sbjct: 907 HSHITNVDDIYNTI 920

 Score =  292 bits (748), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 136/184 (73%), Positives = 151/184 (82%), Gaps = 7/184 (3%)

Query: 11  DELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVD 70
           +ELNI VAVRCRGRNEREI  KSSVVV+VPD+ GS E++INTT D GI  QMN+K YTVD
Sbjct: 35  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVD 94

Query: 71  KVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDS 130
           KVFGP A+Q LIFEEVA PLF DFI+GYNCTVLVYGMTSTGKTYTMTGDE+LYNGEL+D+
Sbjct: 95  KVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA 154

Query: 131 AGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTA-------KKL 183
           AGIIPRVL KLFD +E Q  DY++KCSFIELYNEELKDLLD     +S         KKL
Sbjct: 155 AGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEELKDLLDNNSNGSSNNGFDGQFMKKL 214

Query: 184 RIFD 187
           RIFD
Sbjct: 215 RIFD 218

>Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON}
           YEL061C (REAL)
          Length = 1002

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/674 (46%), Positives = 468/674 (69%), Gaps = 6/674 (0%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357
           D+  GIYIQNL+EFHIT+A EG++LLQ+GL++RQVASTKMNDFSSRSHTIFTI LYK+H 
Sbjct: 313 DQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 372

Query: 358 GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR 417
            ++FRISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L DK+ HIPFR
Sbjct: 373 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFR 432

Query: 418 ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD 477
           ESKLTRLLQDSLGGNTKTALIATISPAK+ SEETCSTLEYA+KAK+IKNKPQLG+ I KD
Sbjct: 433 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 492

Query: 478 ILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQ 537
           ILVKNI  ELAK+K+DLLSTKS++G+YM+Q HYK L +DLESYK EVQECKR I+ LT++
Sbjct: 493 ILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESLTSK 552

Query: 538 NGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEM 597
           N LL+K+K  S E    Q  +++S+K +I HL   ++KQH+ E  +     KL+  +  M
Sbjct: 553 NSLLVKEKLKSKETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLTEVM 612

Query: 598 QATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKD 657
           Q  ++ +  RE     K +     E+  +K+ L   L  + ++ ++  TD+  N++ IK+
Sbjct: 613 QMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQETDIQPNLDIIKN 672

Query: 658 EVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQLSISISEL 717
           EV ++++T Q +A  +YKDC+++++ ESP    ++ + I  +    + + + ++ ++S++
Sbjct: 673 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFERFYKNIAENLSDI 732

Query: 718 NIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESRNI 777
           + E+N+LKQY    FF+++H+E+L+ H++ TY+ I + +   VE  K  L  +LEE++ +
Sbjct: 733 SEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKKALNDHLEENKKL 792

Query: 778 IIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKTSVT 837
           I+ +L  TTS ++  EM LF PK+ KWE SF++IN+CDS+NN+++  ++  LS +K++V 
Sbjct: 793 IMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSMATTLSQIKSTVD 852

Query: 838 STSDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNESITMNES 897
           ++S+ ++  +S M+   + +  +  L +N+ +   QF +++ K++ L+ ++  SIT   S
Sbjct: 853 TSSNSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTILKDNIESSITSTNS 912

Query: 898 SINAFDKLSESIHSAFEKYNTANTISRLDESTNLMKQNKDGDISLDRVEMLPLSPIFFSE 957
            I   D +  +I      Y      ++ +   NL+  N+  ++S    + +PL     + 
Sbjct: 913 HITNIDDIYNTIEKIMNNYGNKENATKDEMIENLL--NEIPNLS----KRMPLRISNTNS 966

Query: 958 NKNNHVLSPSKVVV 971
           N   +++SP K  +
Sbjct: 967 NSMQNIISPKKHAI 980

 Score =  296 bits (758), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 152/184 (82%), Gaps = 7/184 (3%)

Query: 11  DELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVD 70
           +ELNI VAVRCRGRNEREI  KSSVVV+VPD+ GS EI+INTT D GI  QMN+K YTVD
Sbjct: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92

Query: 71  KVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDS 130
           KVFGP A+Q LIF+EVA PLF DFI+GYNCTVLVYGMTSTGKTYTMTGDE+LYNGELSDS
Sbjct: 93  KVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDS 152

Query: 131 AGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTA-------KKL 183
           AGIIPRVL KLFD +E Q +DY++KCSFIELYNEELKDLLD     +S         KKL
Sbjct: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNSSSNNGFDGQFMKKL 212

Query: 184 RIFD 187
           RIFD
Sbjct: 213 RIFD 216

>NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {ON}
           Anc_6.16
          Length = 1069

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/625 (50%), Positives = 456/625 (72%), Gaps = 14/625 (2%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357
           D   GIYIQNL+EFHI++AKEG+ LLQ+GL+YRQVASTKMNDFSSRSHTIFTI LYKEH 
Sbjct: 342 DNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQ 401

Query: 358 GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR 417
           G +FR+SKMNLVDLAGSENI+RSGA NQRAKE GSINQSLLTLGRVINSLAD+N HIPFR
Sbjct: 402 GTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFR 461

Query: 418 ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD 477
           ESKLTRLLQDSLGGNTKTALIATISPAK+ SEETCSTLEYA+KAK+IKNKPQLGSII+KD
Sbjct: 462 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKD 521

Query: 478 ILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQ 537
           IL+KNI +EL++VK+DLLSTKS++G+YMSQ HY++L N+L+++KTE  E KR+I+ L++Q
Sbjct: 522 ILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSSQ 581

Query: 538 NGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEM 597
           N LLLKDK+ SNEV+ LQ+IKL   +DSI+ L + IE Q+ KEQ LV  + KL++     
Sbjct: 582 NALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDTF 641

Query: 598 QATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKD 657
           +  I+ +  ++   ++K++QI  ++LL L++LL ++  +I       + D+G N++ I++
Sbjct: 642 KKMIENYECQQIDVKSKIEQILEDDLLSLRNLLQDHQNKIKTLNSGTDFDIGSNLDMIQN 701

Query: 658 EVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDI----IKMQKISDLYNEQLSIS 713
           EV  ++ TTQ +A   YK  +E  +K++P     + +DI    IK+Q     ++  ++ +
Sbjct: 702 EVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQN----HHAAVAQN 757

Query: 714 ISELNIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEE 773
           +S+++ E+N+LKQYLN + F+++HE+++N HI  T   +  ++  +    K  +  +LE 
Sbjct: 758 LSDISEEYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLES 817

Query: 774 SRNIIIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMK 833
           +RN++++S K  T +++  EMELF P+KKKWE+S ++IN+CDSLNN +  +++  LS  +
Sbjct: 818 NRNLMLNSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLSYTR 877

Query: 834 TSVTSTSDLVDDHVSQMRKYTD------NTSRSTKLTENSKRIGQQFTEMMEKNSKLESH 887
           + +T++ + + D+ ++++          N+  +  + E+++ I  QF E+  KNS  + +
Sbjct: 878 SKITASINQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNELARKNSIFQDN 937

Query: 888 LNESITMNESSINAFDKLSESIHSA 912
           +  S+    +S+N  + L +SI  A
Sbjct: 938 VENSLKCAVASVNNLNHLEDSIKMA 962

 Score =  300 bits (769), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 160/183 (87%), Gaps = 4/183 (2%)

Query: 13  LNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVDKV 72
           LNI VAVRCRGRNEREIK KSSV+V+VPD+ GS+E++INTT+DVGI  QMNSKTYTVDKV
Sbjct: 52  LNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKV 111

Query: 73  FGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDSAG 132
           FGPSANQ+LIF+EVAEPLF DFI+GYNCTVLVYGMTSTGKTYTMTGDE+LYNGELS+SAG
Sbjct: 112 FGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSESAG 171

Query: 133 IIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDE----CQAINSTAKKLRIFDS 188
           IIPR+LFKLFD +E   +DY++KCSFIELYNE+LKDLL++         S   KLRIFDS
Sbjct: 172 IIPRILFKLFDTLEMNQEDYVVKCSFIELYNEDLKDLLNDNNNSINNSKSNINKLRIFDS 231

Query: 189 NAS 191
           + +
Sbjct: 232 STA 234

>SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar to
            uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
            Kinesin motor protein involved in mitotic spindle
            assembly and chromosome segregation
          Length = 948

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/712 (45%), Positives = 491/712 (68%), Gaps = 24/712 (3%)

Query: 298  DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357
            ++ + IYIQNL+EFHIT+AK+GI LLQRGL++RQVASTKMNDFSSRSHTIFTI LYK H+
Sbjct: 256  EQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHN 315

Query: 358  GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR 417
            G++FR+SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN HIPFR
Sbjct: 316  GEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFR 375

Query: 418  ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD 477
            ESKLTRLLQDSLGGNTKTALIATISPAK+N+EET STLEYA KAK+IKNKPQLG+++ KD
Sbjct: 376  ESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLVMKD 435

Query: 478  ILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQ 537
            ILVKNI  ELAK+K+D LSTKS+DG+YM+Q HYKELT+DLE+YKTEVQECKR I+ + +Q
Sbjct: 436  ILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKREIEKMNSQ 495

Query: 538  NGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEM 597
            N LLLKDK+AS+EV  LQ+IK++ + D I+HL+D ++KQH+ EQ LV  I  LK     +
Sbjct: 496  NVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKDAIYTV 555

Query: 598  QATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKD 657
            Q ++K   + +   +++M+ +  + +   K  + E L  +       +  +  NI+ I++
Sbjct: 556  QNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGIDGNIDIIQE 615

Query: 658  EVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQLSISISEL 717
            E+  ++++  + +  V + C+E++++ +P    S+  D++ +  + D Y+ +L  ++ ++
Sbjct: 616  ELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSNELVKNLGDI 675

Query: 718  NIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESRNI 777
            + E+N+ ++YLN   FK++HEE L+ H++KTY  +++++  +  + K  ++ +LEE++++
Sbjct: 676  SEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMDSHLEENKSL 735

Query: 778  IIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKTSVT 837
            +I SLK  + ++V  E++LFAP K+KWE S E INKCDSLNN +   +   L  ++ ++ 
Sbjct: 736  MIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDALRRLEGNIE 795

Query: 838  STSDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNESITMNES 897
             + +           ++ NT+   K   +S +     +E+++ N+K+ +++NE    +  
Sbjct: 796  GSLE-----------FSKNTAGDVK---DSLKKFDGISEVLKNNTKVVNNINEVKEKHTF 841

Query: 898  SINAFDKLSESIHSAFEKYNTANTISR--LDE--STNLMKQNKDGDISLDRVEMLPLSPI 953
              +  ++ S  I +A EK+   +   R  +D+   T+L+   +  ++ L+++    L PI
Sbjct: 842  LRDQVERTSSYIEAANEKFEGIDQFIRQIIDKKLPTHLVGNGELVNVMLEQLGKTHLKPI 901

Query: 954  F-FSENKNNHVLSPSKVVVNSSAKKIQASKYQKRLNSTEDMDPIATKVQKIK 1004
               S   ++  +SP K + N+    I  SK  ++++ TE+     +K Q+IK
Sbjct: 902  GSASRTPSSRSVSPMKTLDNNIFNGISPSK--RKVDETEND---RSKSQRIK 948

 Score =  313 bits (802), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 141/179 (78%), Positives = 165/179 (92%), Gaps = 1/179 (0%)

Query: 9   NGDELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYT 68
           NG ELNI V+VRCRGRNEREIKAKSSVVV+VPDV GS+E++INTT+++GI  QMNSKTYT
Sbjct: 13  NGQELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYT 72

Query: 69  VDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELS 128
           VDKVFGPSA+Q LIF+++AEPLF+DFI+GYNCTVLVYGMTSTGKTYTMTGDERLY+GELS
Sbjct: 73  VDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELS 132

Query: 129 DSAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTAKKLRIFD 187
           D+AGIIPR+LFKLFD +E Q++DY++KCSFIELYNEELKDLL+E Q  +   KKLRIFD
Sbjct: 133 DAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQE-SGVIKKLRIFD 190

>Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON}
           YEL061C (REAL)
          Length = 999

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/621 (51%), Positives = 454/621 (73%), Gaps = 4/621 (0%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357
           D+  GIYIQNL+EFHIT+A EG+ LLQRGL++RQVASTKMNDFSSRSHTIFTI LYK+H 
Sbjct: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369

Query: 358 GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR 417
            ++FRISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+LADK+ HIPFR
Sbjct: 370 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFR 429

Query: 418 ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD 477
           ESKLTRLLQDSLGGNTKTALIATISPAK+ SEETCSTLEYA+KAK+IKNKPQLG+ I KD
Sbjct: 430 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 489

Query: 478 ILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQ 537
           ILVKNI  ELAK+K+DLLSTKS++G+YMSQ HYK L +DLESYK EVQECKR I+ L+++
Sbjct: 490 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSSK 549

Query: 538 NGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEM 597
           N LLLKDK  S +    Q  +++S+K +I+ L   ++KQH+ E  +     KL+  +  M
Sbjct: 550 NSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIM 609

Query: 598 QATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKD 657
           Q  ++ +  RE     K +   ++E+  LK+ L   L  + +  +   T++  N++ IK+
Sbjct: 610 QLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKN 669

Query: 658 EVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLND--DIIKMQKISDLYNEQLSISIS 715
           EV ++++T Q +A  +YKDC+++++ ESP     + +  DII++      YN  ++ ++S
Sbjct: 670 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVD-FQRFYN-NIAENLS 727

Query: 716 ELNIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESR 775
           +++ E+N+LKQYL   FFK++H+E+LN HI+ TY++I + ++  VE  K  L  +LEE++
Sbjct: 728 DISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENK 787

Query: 776 NIIIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKTS 835
            +I+ +L N TS ++  EM+LF PK+ KWE+SF++INKCDS+NN+++ +++  LS +K +
Sbjct: 788 KLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNT 847

Query: 836 VTSTSDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNESITMN 895
           V ++S+ ++  +S M+   + +  +  L +N+K+   QF +++ K++ L+ ++  SIT  
Sbjct: 848 VDTSSNSMNKSISVMKGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILKDNIENSITST 907

Query: 896 ESSINAFDKLSESIHSAFEKY 916
            S I   D + ++I +  + Y
Sbjct: 908 HSHITNIDDIYDTIENIMKNY 928

 Score =  293 bits (749), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 136/184 (73%), Positives = 152/184 (82%), Gaps = 7/184 (3%)

Query: 11  DELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVD 70
           +ELNI VAVRCRGRNEREI  KSSVVV+VPD+ GS E++INTT D GI  QMN+K YTVD
Sbjct: 33  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 92

Query: 71  KVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDS 130
           KVFGP A+Q LIF+EVA PLF DFI+GYNCTVLVYGMTSTGKTYTMTGDE+LYNGELSD+
Sbjct: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152

Query: 131 AGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTA-------KKL 183
           AGIIPRVL KLFD +E Q +DY++KCSFIELYNEELKDLLD     +S         KKL
Sbjct: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPFMKKL 212

Query: 184 RIFD 187
           RIFD
Sbjct: 213 RIFD 216

>KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16
           YEL061C
          Length = 963

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/623 (47%), Positives = 435/623 (69%), Gaps = 6/623 (0%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357
           D+  GIYIQNL+EFHIT+AKEGI+LLQ+GL+YRQVASTKMNDFSSRSHTIFTI L+KE  
Sbjct: 285 DQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVK 344

Query: 358 GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR 417
           G+IFR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVINSLADKN+H+PFR
Sbjct: 345 GEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFR 404

Query: 418 ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD 477
           ESKLTRLLQDSLGGNTKTALIATISPAK+  EETCSTLEYA+KAK+IKNKPQLGS I KD
Sbjct: 405 ESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKD 464

Query: 478 ILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQ 537
           IL+KNI +EL K+K+DLLSTKS+DG+YM Q HYKELT DL++YKTE+QECKR I+ LT+Q
Sbjct: 465 ILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQ 524

Query: 538 NGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEM 597
           N LLLKDK+  NE + LQ+IK+Q+M +S+  L+  IE+Q   E  L   I      + ++
Sbjct: 525 NALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKL 584

Query: 598 QATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKD 657
              I     RE +  +K K + +  L  +   L   +E    + +  N  +  N++ IK 
Sbjct: 585 TKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKS 644

Query: 658 EVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQLSISISEL 717
           E+ +++ T +      Y++C+ + + ++P+L   +ND+++ ++ ++  Y  Q++ ++S+L
Sbjct: 645 EMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDL 704

Query: 718 NIEHNDLKQYLNGSFF---KSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEES 774
           + E+N+ KQ++   F+   K    E+LN++I  T   I  +S  ++  ++  L  +L  +
Sbjct: 705 SEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRAN 764

Query: 775 RNIIIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKT 834
           + +II+SL N T++++ +E++   PK  KWE+S E+IN+ D+LNN++  ++ + ++ M  
Sbjct: 765 KELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTD 824

Query: 835 SVTSTSDLVDDHVSQMRKY--TDNTSRSTKLT-ENSKRIGQQFTEMMEKNSKLESHLNES 891
            +  T+D +++++ ++ ++  T++ + S  L  +++  I   F  + EKNS+L   + E 
Sbjct: 825 KIKQTNDSINNNIKKINEHFKTNDIAHSNNLMIDDNNIIKNNFKSIEEKNSRLHEFVKEG 884

Query: 892 ITMNESSINAFDKLSESIHSAFE 914
             +   S+   ++L  SI +  +
Sbjct: 885 YLVTNESMKKLNELDTSIRTVLK 907

 Score =  304 bits (778), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 137/179 (76%), Positives = 158/179 (88%), Gaps = 1/179 (0%)

Query: 11  DELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVD 70
           +ELNI VAVRCRGRN+REI AKSSVVV+VPD+ GS E+AINT+ED+G   QMNSKTYTVD
Sbjct: 15  EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 74

Query: 71  KVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDS 130
           KVFGPSA Q LIF+E+AEPLF+DFI+GYNCT+LVYGMTSTGKTYTMTGDE+LYN ELSDS
Sbjct: 75  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 134

Query: 131 AGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLL-DECQAINSTAKKLRIFDS 188
           AGIIPR+LFKLF+ +E  N+D+I+KCSF+ELYNEELKDLL  +C   N   KKLRIFDS
Sbjct: 135 AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIFDS 193

>KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {ON}
           similar to uniprot|P27895 Saccharomyces cerevisiae
           YEL061C CIN8 Kinesin motor protein involved in mitotic
           spindle assembly and chromosome segregation
          Length = 941

 Score =  549 bits (1415), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 297/639 (46%), Positives = 434/639 (67%), Gaps = 14/639 (2%)

Query: 301 TGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHDGKI 360
           + I+IQNL+EFHI  AKEGI LLQRGL++RQVASTKMND SSRSHTIFTI LY++ +G+ 
Sbjct: 235 SAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGES 294

Query: 361 FRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFRESK 420
           FR+SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN HIPFRESK
Sbjct: 295 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESK 354

Query: 421 LTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKDILV 480
           LTRLLQDSLGGNTKTALIATISPAK+NSEET STLEYA KAK+IKNKPQ+GS I KD+LV
Sbjct: 355 LTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLV 414

Query: 481 KNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQNGL 540
           KN+ +EL K+++DLL+TKS+DG+YMSQ +YKELTN+LE+YKTEVQECKR I+ L+TQNGL
Sbjct: 415 KNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQNGL 474

Query: 541 LLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEMQAT 600
           L K+K+ +NEV+  Q++K++ + ++I  L+D I++QH+ EQ L +++ +L      MQ +
Sbjct: 475 LTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRTMQNS 534

Query: 601 IKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKDEVK 660
           +K + ++    Q +M+++  E +   K  L+  +E++ K    +  D+  NI+ +  E+ 
Sbjct: 535 LKVYEDQGHRFQTEMERVLYENIGSFKHSLLNEIEKL-KGTEEDGFDVDANIDTLTKELN 593

Query: 661 SIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQLSISISELNIE 720
            I D        + +  M ++ +++P  L  + + +  +  +   Y+  L + +S ++ E
Sbjct: 594 RIYDFINTSTIEICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSSDLMMHLSSISEE 653

Query: 721 HNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESRNIIID 780
           +N LK YLN  FFK++ ++ L+ H+++TY  ++ ++  I  +L+  +   LE ++ I++ 
Sbjct: 654 YNHLKDYLNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMNEELETNKEIMMQ 713

Query: 781 SLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKTSVTS-- 838
           SLKN  S++V  EM L  P K+ WE S E IN+CD LN+ +  DI +++ ++   +    
Sbjct: 714 SLKNAASEVVAKEMGLLDPVKQAWESSLENINECDKLNSGFEKDIGSVVRDVFEKINEGL 773

Query: 839 --TSDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNESITMNE 896
             +   V D    + ++ D  SR+ +  +    I     E+ +K++ L+  + +S +  E
Sbjct: 774 QFSESAVGDANLDLSRFQD-ASRALRTDD---VIPGSIEEIKKKHNMLKLKVQDSASYME 829

Query: 897 SSINAFDKLSESIHS-----AFEKYNTANTISRLDESTN 930
           ++   F ++ +SI       A  + ++ N I  L E  N
Sbjct: 830 AATQKFGEIDDSIQGLLNSQAVSQPHSENRIEGLLEQLN 868

 Score =  304 bits (779), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 160/178 (89%), Gaps = 1/178 (0%)

Query: 11  DELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVD 70
           +ELNI VAVRCRGRNE+E+KAKSSVVV+VPDV G++E++INTT D GI  Q+NSKTYTVD
Sbjct: 5   EELNITVAVRCRGRNEKEVKAKSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64

Query: 71  KVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDS 130
           +VFGPSA+Q LIF+ +AEPLF DFI+GYNCTVLVYGMTSTGKTYTMTGDERLY+GELS+ 
Sbjct: 65  RVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124

Query: 131 AGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTAKKLRIFDS 188
           AGIIPRVLFKLFDA++  NDDY+IKCSFIELYNEELKDLLDE    +S  +KLRIFDS
Sbjct: 125 AGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPD-SSMPRKLRIFDS 181

>Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to
           Ashbya gossypii ACR010C
          Length = 944

 Score =  546 bits (1407), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 286/617 (46%), Positives = 435/617 (70%), Gaps = 10/617 (1%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357
           ++ + IYIQNL+EFHIT+A+EGI +LQ+GL++RQVASTKMNDFSSRSHTIFTI LYK ++
Sbjct: 242 EQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYE 301

Query: 358 GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR 417
           G++FRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK+IHIPFR
Sbjct: 302 GELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 361

Query: 418 ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD 477
           ESKLTRLLQDSLGGNTKTALIATISPAK+N++ET STLEYA KAK+IKN+PQLGS + KD
Sbjct: 362 ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKD 421

Query: 478 ILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQ 537
           ILVK+I+SEL+K+K+D LSTK+++G+YMS  HY+E+ NDLE+Y+TE+QE KR ++  ++Q
Sbjct: 422 ILVKSISSELSKLKSDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQ 481

Query: 538 NGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEM 597
           N LLLKDKKAS +++ LQ +K+  ++++I +L D IE+QHR E  LV  I KLK     M
Sbjct: 482 NSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTM 541

Query: 598 QATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKD 657
           + +++ +   E   Q  +K++  + +   +  + ++LE +  +++  N  +  N+++I+ 
Sbjct: 542 KGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIRT 601

Query: 658 EVKSIIDTTQAEANHVYKDCMEQLMKESPI-----LLGSLNDDIIKMQKISDLYNEQLSI 712
                +D+ ++  + +  + + +++K+ P         +L D   K+Q     Y+  L+ 
Sbjct: 602 IFHETLDSVRSAGSDMCTNIV-KIVKDQPSTSYQQFKEALGDLDTKVQT----YSVTLTN 656

Query: 713 SISELNIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLE 772
            ++E+  E+N++K+YL+  F K++++E+L+  +EK Y   + AS  ++  + + +E ++E
Sbjct: 657 KLTEMTEENNNMKEYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDALISSVVSMMESHME 716

Query: 773 ESRNIIIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNM 832
           ESRN+++ S+K+  S+++  E+E+F P K++W  SFE IN+CD+ + ++    + LL+N+
Sbjct: 717 ESRNLMLSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFENKSTKLLTNL 776

Query: 833 KTSVTSTSDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNESI 892
           K    ++    DD   Q+++   N     +     + I +Q  ++ +K+  LE H   +I
Sbjct: 777 KELADNSVVAADDVAKQVQENVTNFEGIVRQASAKESIVKQMNDINDKHKMLEDHFENNI 836

Query: 893 TMNESSINAFDKLSESI 909
              + S   F+++  SI
Sbjct: 837 KYFKESSKGFEEMDCSI 853

 Score =  308 bits (788), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 166/185 (89%), Gaps = 4/185 (2%)

Query: 6   DKGNGDELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSK 65
           D GN +ELNI VAVRCRGRNEREIKAKS+VVV+VPDV GS+E++INTT D+GIAG+MNS+
Sbjct: 15  DDGN-EELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSR 73

Query: 66  TYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNG 125
           TYTVD+VFGPSA+Q+LIF+ +AEPLF+DFI+GYNCTVLVYGMTSTGKTYTMTGDE+LY+G
Sbjct: 74  TYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDG 133

Query: 126 ELSDSAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTAKKLRI 185
           ELSDSAGIIPRVLF+LFD +E    D+++KCS+IELYNEELKDLLD+       +K+LRI
Sbjct: 134 ELSDSAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTP---DYSKRLRI 190

Query: 186 FDSNA 190
           FDSN 
Sbjct: 191 FDSNT 195

>KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar to
           uniprot|Q8J1G7 Ashbya gossypii ACR010C CIN8 Kinesin-like
           protein CIN8 and some similarites with YEL061C
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 965

 Score =  546 bits (1408), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 284/615 (46%), Positives = 432/615 (70%), Gaps = 6/615 (0%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357
           ++ + IYIQ+L+EFHIT AKEG+ LLQ+GL +RQVASTKMND SSRSHTIFT+ LYK  +
Sbjct: 264 EQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFN 323

Query: 358 GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR 417
           G+ FR+SK+NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN HIPFR
Sbjct: 324 GETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFR 383

Query: 418 ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD 477
           ESKLTRLLQDSLGGNTKTALIATISPAK+NSEET STLEYA KAK+IKNKPQLGS + KD
Sbjct: 384 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKD 443

Query: 478 ILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQ 537
           ILVKNI+ ELAK+K+D LSTKS++G+YMS +HY E+ ND+E+YKTE+QE +R I+ L++Q
Sbjct: 444 ILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQ 503

Query: 538 NGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEM 597
           N LL KDKK+S +    Q++++++++ S+ +L++ I+ +H+ E  L ++I+KLK     M
Sbjct: 504 NQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNM 563

Query: 598 QATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKD 657
           Q  +K H + EQ  Q+ ++++  + +L  +  +   L+ + ++ +  +  +  +I  +KD
Sbjct: 564 QGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVKD 623

Query: 658 EVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQLSISISEL 717
            ++++++T + +A  + ++  ++++ + P    S+  ++  M    D + ++L   +S++
Sbjct: 624 SLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQI 683

Query: 718 NIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESRNI 777
             E+N+LK YL+  FF+++H+EILN H +KTY  +  +S  ++ ++   +  ++E++R +
Sbjct: 684 TAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRTL 743

Query: 778 IIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKTSVT 837
           ++D+LK  T++++  EM  F P +K WE SF  IN CDSL+NK+  D +  L+++K+ + 
Sbjct: 744 LMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHME 803

Query: 838 ST---SDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNESITM 894
           ST   S L+ D +     +  + +    +T N   I     ++  K+S L   L ++++ 
Sbjct: 804 STVRESSLIADKIKDNLCHFQDRNDIANMTTN---INGTVDDIKNKHSVLRDELEKNVSF 860

Query: 895 NESSINAFDKLSESI 909
             +S   F  +  S+
Sbjct: 861 IHASSEGFKAIDSSL 875

 Score =  302 bits (774), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 133/180 (73%), Positives = 164/180 (91%), Gaps = 1/180 (0%)

Query: 10  GDELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTV 69
           GDELNI VAVRCRGRNE+EIKAKSSVVV+ PDV G++E++INT+ D+GI  +MNSKTYTV
Sbjct: 10  GDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTV 69

Query: 70  DKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSD 129
           DKVFGPSA+Q L+F+E+A+P+F+DFI+GYNCT+LVYGMTSTGKTYTMTGDE+LY+GELS+
Sbjct: 70  DKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSE 129

Query: 130 SAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQ-AINSTAKKLRIFDS 188
           +AGIIPRVLFKLFD +E Q  DY++KCSFIELYNEELKDLLD+ Q +  + ++KLRI+DS
Sbjct: 130 AAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIYDS 189

>CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} similar
           to uniprot|P27895 Saccharomyces cerevisiae YEL061c CIN8
           Kinesin-like protein
          Length = 988

 Score =  547 bits (1409), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 280/606 (46%), Positives = 430/606 (70%), Gaps = 3/606 (0%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357
           D+   IYIQNL+EFHITSA EG++LLQ+GL+ RQVASTKMNDFSSRSH+IFTI LYKE +
Sbjct: 304 DQSASIYIQNLEEFHITSAMEGLQLLQKGLKQRQVASTKMNDFSSRSHSIFTITLYKEQN 363

Query: 358 GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR 417
           G++FR+SKMNLVDLAGSENISRSGA NQRAKEAGSINQSLLTLGRVINSLADK+ HIPFR
Sbjct: 364 GELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFR 423

Query: 418 ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD 477
           ESKLTRLLQDSLGGNTKTALIATISPAK+ SEETCSTLEYA+KAK+IKNKPQLG+ I KD
Sbjct: 424 ESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 483

Query: 478 ILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQ 537
           ILV++I SELAK+K+DLLSTKS++GVYMS  HYK+L  D+E YKTE++E KR I+ LT Q
Sbjct: 484 ILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQ 543

Query: 538 NGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEM 597
           N +L +++ +  + +   K  + S+KD++  L  S+++Q  KE  +  L+  ++  + EM
Sbjct: 544 NAMLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEM 603

Query: 598 QATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKD 657
           + TI     ++Q  Q  +    ++E+  ++  L +++E +     + +T++  N+ +++ 
Sbjct: 604 KKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLEK 663

Query: 658 EVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQLSISISEL 717
           EV  +I   + EA+  Y +C++ ++KE+P L  S++  +  + K+++  + +++ ++S++
Sbjct: 664 EVVKVIKAAEEEASKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLSDV 723

Query: 718 NIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESRNI 777
           + E+N+LKQYL  +FFK++HEE+L+ H++ TY  +   S  +++     L+ +++E++  
Sbjct: 724 SEEYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRH 783

Query: 778 IIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKTSVT 837
           +++++   T +++ +E+++F  ++ KWE S  +IN+CDS+N+ +   + + L  ++  V+
Sbjct: 784 MLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDVVS 843

Query: 838 STSDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKL---ESHLNESITM 894
           S+ D +   +S ++  T N     ++ + +  I QQ T + +KN  L   + H  E+ T 
Sbjct: 844 SSRDNIGATISSIQSRTRNRQSIEEMIQGNDVIRQQITRIKQKNKSLSLFKEHSTETATT 903

Query: 895 NESSIN 900
           +  S+N
Sbjct: 904 SIGSVN 909

 Score =  310 bits (793), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 162/180 (90%), Gaps = 1/180 (0%)

Query: 11  DELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVD 70
           +ELNI+VAVRCRGRNEREIKAKSSVVV VPD   ++E++INTT+DVGIA +MNSKTYTVD
Sbjct: 30  EELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVD 89

Query: 71  KVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDS 130
           KVFGPSA+Q+L++EE+AEPLF DFI+GYNCT+LVYGMTSTGKTYTMTGDE+L+NGEL D+
Sbjct: 90  KVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDA 149

Query: 131 AGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQ-AINSTAKKLRIFDSN 189
           AGIIPRVLF+LFD +E   DDY++KCSF+ELYNEELKDLLD    A NS  KKLRIFDSN
Sbjct: 150 AGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDNKKLRIFDSN 209

>Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061C
           (CIN8) - 1:1 [contig 185] FULL
          Length = 943

 Score =  543 bits (1399), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 275/549 (50%), Positives = 397/549 (72%), Gaps = 8/549 (1%)

Query: 301 TGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHDGKI 360
           + I+IQNL+EFHI  AKEGI LLQRGL++RQVASTKMND SSRSHTIFTI LYK+ +G+ 
Sbjct: 236 SAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGES 295

Query: 361 FRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFRESK 420
           FR+SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK++HIPFRESK
Sbjct: 296 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESK 355

Query: 421 LTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKDILV 480
           LTRLLQDSLGGNTKTALIATISPAK+NSEET STLEYA KAK+IKNKPQ+GS I KD+L+
Sbjct: 356 LTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLL 415

Query: 481 KNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQNGL 540
           K++ +EL K+K+DLLSTKS+DG+YMSQ +YKELTN+LE+YKTEV+ECKR ++ ++ QN L
Sbjct: 416 KSVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQNSL 475

Query: 541 LLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEMQAT 600
           L+K+K+ SNEV+  QK+KL+ + ++I  L+D I++QH+ EQ L +++ +L      MQ +
Sbjct: 476 LIKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHTMQQS 535

Query: 601 IKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKDEVK 660
           ++ + ++ Q    +M+++  + +   K  L++ +E++   +  N  D+ +N++ +  E+ 
Sbjct: 536 LRIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKINVDENGDDVEVNVDAVTTELT 595

Query: 661 SIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQLSISISELNIE 720
            I D   +    V+++ ++++  ++P     +   +  +  +   Y+  L I +S ++ E
Sbjct: 596 RIFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQVESITSVVSSYSSNLMIHLSSISEE 655

Query: 721 HNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESRNIIID 780
           +N+LK YLN  FFK++ +E L+ H+++TY  ++ ++  I  +L+  L   L+ ++  ++ 
Sbjct: 656 YNNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELDTNKEFMMQ 715

Query: 781 SLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNM-------- 832
           SL++  S++V  EM L  P K+ WE+S E IN+CD LNN +   I   ++ +        
Sbjct: 716 SLRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEIFKTIDQGQ 775

Query: 833 KTSVTSTSD 841
           KTS  +T D
Sbjct: 776 KTSQVTTED 784

 Score =  303 bits (777), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 139/177 (78%), Positives = 158/177 (89%), Gaps = 1/177 (0%)

Query: 11  DELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVD 70
           +ELNI VAVRCRGRNE+E+KA+SSVVV+VPDV G++E++INTT D GI  Q+NSKTYTVD
Sbjct: 5   EELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64

Query: 71  KVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDS 130
           KVFGPSA+Q LIF+ +AEPLF DFI+GYNCTVLVYGMTSTGKTYTMTGDERLY+GELS+ 
Sbjct: 65  KVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124

Query: 131 AGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTAKKLRIFD 187
           AGIIPRVLFKLFDA+  Q DDY+IKCSFIELYNEELKDLLDE    +S  KKLRIFD
Sbjct: 125 AGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPD-SSMPKKLRIFD 180

>ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL061C
           (CIN8)
          Length = 945

 Score =  537 bits (1383), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 285/610 (46%), Positives = 424/610 (69%), Gaps = 2/610 (0%)

Query: 301 TGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHDGKI 360
           +GIY+QN++EFHI +A+EGI +LQ+GL++RQVASTKMNDFSSRSHTIFTI LYK  DG++
Sbjct: 246 SGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCDGEL 305

Query: 361 FRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFRESK 420
           FR+SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK+IHIPFRESK
Sbjct: 306 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESK 365

Query: 421 LTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKDILV 480
           LTRLLQDSLGGNTKTALIATISPAK+N++ET STLEYAAKAK+IKN+PQLG+++ KDILV
Sbjct: 366 LTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMKDILV 425

Query: 481 KNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQNGL 540
           KNI+SELAK+K+D LSTKS+DG+YMS  HY+E+ NDLE+ +TE+QE KR I+ LT+QN L
Sbjct: 426 KNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESLTSQNNL 485

Query: 541 LLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEMQAT 600
           LLKDKKAS EV  LQ  K++ ++ +I +L+D IE+QH  E  L   I KLK     MQ +
Sbjct: 486 LLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEALHTMQGS 545

Query: 601 IKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKDEVK 660
           +K +   E   Q  +K++  + +   +  + ++LE++   ++  N  +  NI  I     
Sbjct: 546 LKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDKNLSIKENINNITTIFD 605

Query: 661 SIIDTTQAEANHVYKDCMEQLMKESP-ILLGSLNDDIIKMQKISDLYNEQLSISISELNI 719
             + + +A  + +  D + +L+KE+P + L   N+ +  ++     Y+  L+  ++E++ 
Sbjct: 606 DTLKSVEANGSDMC-DTLVKLIKETPSMYLKEFNETVSSLKSELSSYSNALTNKLTEISE 664

Query: 720 EHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESRNIII 779
           E+N L++YL+   FK+  +E+L+  +E  Y  ++  S  ++ +L + +  ++EESR +++
Sbjct: 665 ENNHLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEESRTLMV 724

Query: 780 DSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKTSVTST 839
           +S+K+T ++I+ +E  LF P + +W  S + IN+CD+ +  +    ++ L  +K    ++
Sbjct: 725 NSMKDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQNFEAKSTSGLDKLKELSDAS 784

Query: 840 SDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNESITMNESSI 899
               +D V++ +  TD+     +     + + +Q  ++ +K+  LE H ++++   + S 
Sbjct: 785 LKSSEDAVNKAKHRTDSFHDFVQKLCCDQSLKKQMHDISDKHRMLEDHFDDNVKYFKESS 844

Query: 900 NAFDKLSESI 909
             F+ +  SI
Sbjct: 845 KGFEDMDCSI 854

 Score =  308 bits (788), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 136/180 (75%), Positives = 168/180 (93%), Gaps = 3/180 (1%)

Query: 11  DELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVD 70
           +ELNI VAVRCRGRNEREIKAKSSVVV+VPDV GS+E++INTT++VGIA +MNS+TYTVD
Sbjct: 19  EELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVD 78

Query: 71  KVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDS 130
           KVFGPSA+Q LIF+E+AEPLF+DF++GYNCTVLVYGMTSTGKTYTMTGDE+LY+G+LSDS
Sbjct: 79  KVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDS 138

Query: 131 AGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTAKKLRIFDSNA 190
           AGIIPR++FKLFDA+E  + D+++KCS+IELYNEELKDLLDE    + ++K+LRIFDS++
Sbjct: 139 AGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDES---HDSSKRLRIFDSSS 195

>TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON}
           Anc_6.16 YEL061C
          Length = 1097

 Score =  525 bits (1351), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 292/639 (45%), Positives = 426/639 (66%), Gaps = 25/639 (3%)

Query: 297 PDKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEH 356
           PD    IYIQNL+EF+I +A +GI+LLQ+GL++R+VASTKMND SSRSHTIFTI LYKEH
Sbjct: 328 PDNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEH 387

Query: 357 DGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPF 416
           +G ++R+SKMNLVDLAGSENI++SGAQ+QRAKEAGSINQSLLTLGRVINSLADK+IHIPF
Sbjct: 388 NGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPF 447

Query: 417 RESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITK 476
           RESKLTRLLQDSLGGNTKT LI+TISPAK+N +ET STLEYA+KAK+IKNKP LGS I K
Sbjct: 448 RESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMK 507

Query: 477 DILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTT 536
           D+L+KNI +EL K+K+DL+ST+ +DGVYMSQ HYKEL NDLESYKTEVQE KR  + L +
Sbjct: 508 DVLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLIS 567

Query: 537 QNGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIE 596
           QNG LLKDKKASNE++ LQ+I+++   + I  L++ +++ +++E  LV+LI +LK+    
Sbjct: 568 QNGSLLKDKKASNELNELQRIQIEKKNEKIKELYEILDEHYKREDILVELIRQLKNVGTS 627

Query: 597 MQATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIV-------------- 642
           MQ+TI+ + ER+   +   K+I   E   LK+ L + L  IN  I+              
Sbjct: 628 MQSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGNIIDNLKSSIISNNSSI 687

Query: 643 --INNTDLGMNIEKIKDEVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQ 700
             I++++   NI+ I++    I+   Q ++ H+Y  C+E+++ + P +L       I++ 
Sbjct: 688 EAIDSSNFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFK---IEIN 744

Query: 701 KISDLYNEQ---LSISISELNIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRAST 757
            I   YN+Q   ++ ++S+L+ E+N+ K+YLN SF ++++E IL  H+E     I   S 
Sbjct: 745 SIDFQYNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFSN 804

Query: 758 GIVEQLKTGLELYLEESRNIIIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSL 817
            ++  +   +  +   +  +  + L N  +DIVK E E   P K+KW  S E+IN  D +
Sbjct: 805 NLLLNINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDKI 864

Query: 818 NNKYFGDISALLSNMKTSVTSTSDLVDDHVSQMR--KYTDNTSRSTKLTENSKRIGQQFT 875
           NN +  D++  +  +   +  + + +++ ++ ++  +  +N + +  L+ N++ +     
Sbjct: 865 NNTFHNDMNNRILQINNLILQSHNDINNSINDIKVNEIRENEAVNEILSSNTEYVN-NIN 923

Query: 876 EMMEKNSKLESHLNESITMNESSINAFDKLSESIHSAFE 914
           E+  KN   +  L      +E+SIN  D   + I S  +
Sbjct: 924 ELKIKNMDYQEKLKCIGKSSENSINYLDSTKQVIESGLK 962

 Score =  314 bits (805), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 169/182 (92%), Gaps = 2/182 (1%)

Query: 10  GDELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTV 69
           G+ELNI VAVRCRGRNERE++AKSSVVVSVPD+ GS+E++INT+++VGIA  MNSKTYTV
Sbjct: 8   GEELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTV 67

Query: 70  DKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSD 129
           DKVFGPSA+Q L+F+E+AEPLF DFI+GYNCT+LVYGMTSTGKTYTMTGDE+LY+GELSD
Sbjct: 68  DKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSD 127

Query: 130 SAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTAKKLRIFDSN 189
           SAGIIPRVLFKLF++ E  NDDYIIKCSF+ELYNE+LKDLLD+  ++++T KKLRIFDS 
Sbjct: 128 SAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDD--SVDNTYKKLRIFDSM 185

Query: 190 AS 191
           +S
Sbjct: 186 SS 187

>KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6.16
           YEL061C
          Length = 950

 Score =  504 bits (1297), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 247/557 (44%), Positives = 404/557 (72%), Gaps = 1/557 (0%)

Query: 297 PDKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEH 356
           P  QTGIYIQNLK+FHI++AKEG++LLQRGLQ RQVA+TK+ND SSRSHTIFTI LYK+ 
Sbjct: 264 PPTQTGIYIQNLKDFHISTAKEGLQLLQRGLQRRQVATTKLNDVSSRSHTIFTITLYKKF 323

Query: 357 DGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPF 416
              ++R+SK+NLVDLAGSEN++++GA N RAKE+GSINQSLLTLGRVINSLADK+ HIPF
Sbjct: 324 KDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAHIPF 383

Query: 417 RESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITK 476
           RESKLTRLLQDSLGGNTKT LIATISPAK+ +EETCSTLEYA+KAK+IKNKPQLGS I K
Sbjct: 384 RESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGSFIIK 443

Query: 477 DILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTT 536
           DIL+K+++ EL K++ADL  TKS++G+Y+SQ +YKE+ +DL+++KTE+ E KR  D L  
Sbjct: 444 DILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTNDSLVQ 503

Query: 537 QNGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIE 596
           +N LL K+KK+  E  +  K +L +++  +  + + + + + +   L + +  +     E
Sbjct: 504 ENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNRIQTE 563

Query: 597 MQATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIK 656
           +++ I+ + ++ + ++ K +++  +EL  L + ++   + + K +   N  +  +I+ I+
Sbjct: 564 LKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTL-KNVNSGNYQIHTHIDSIR 622

Query: 657 DEVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQLSISISE 716
            EV ++++TT+  A  +YK C++ L+KE+P +   ++D++  ++ +++ +  +++ + S+
Sbjct: 623 GEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIRGMTEEHYTEMARNFSD 682

Query: 717 LNIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESRN 776
           L+ E N  KQYL+G FF+++H E++  H +    N+++ S  +++ ++  ++ YL  +  
Sbjct: 683 LSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLLQSVQNSIQNYLSTNAQ 742

Query: 777 IIIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKTSV 836
           ++ +S+ +   D++  EM+LFAPKK KWE+S ++IN+ DSL+NK+  +++  + ++ + +
Sbjct: 743 MVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNKFRNNMTKSVDDIASVI 802

Query: 837 TSTSDLVDDHVSQMRKY 853
            ++++ +D  +S ++K+
Sbjct: 803 RNSNESMDRSISTIKKH 819

 Score =  230 bits (586), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 153/198 (77%), Gaps = 20/198 (10%)

Query: 11  DELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVD 70
           D++NI VAVRCRGRN+REI+AKS +VV+VPDV  + E++INT+   GI  Q+ +KTYTVD
Sbjct: 23  DDINITVAVRCRGRNKREIEAKSPIVVTVPDVTTTPEVSINTSGGSGIEAQLQAKTYTVD 82

Query: 71  KVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGD-ERLYNGELSD 129
           KV+GP ++Q+L+FE+ AEPLF+DF+RGYNCT+LVYGMTSTGKTYTMTGD E    G+++ 
Sbjct: 83  KVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVNG 142

Query: 130 SAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQ--------------- 174
            AGI PR+L KLF+ ++   DDY++KCSF+ELYNE+L+DLL E Q               
Sbjct: 143 QAGIAPRILVKLFECLQ---DDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTENSSKQPE 199

Query: 175 AINSTAKKLRIFDSNASQ 192
           ++N+ +KKLRIFDSN S+
Sbjct: 200 SLNA-SKKLRIFDSNNSR 216

>Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa]
           {ON} complement(169349..172237) [2889 nt, 963 aa]
          Length = 962

 Score =  481 bits (1239), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 259/617 (41%), Positives = 417/617 (67%), Gaps = 2/617 (0%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357
           +K    YIQNL+EFHIT+AKEGI+LL RGL+ RQ+AS+K   +SSR+ TIFTI LYKE +
Sbjct: 252 EKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEE 311

Query: 358 GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR 417
           G+IFR+SK N VDLAG+E+  +    NQR K+   INQ +  L +++NSL +K   IPF+
Sbjct: 312 GEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDINIINQGIQNLNKIVNSLHEKESVIPFK 371

Query: 418 ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD 477
           +SKLT L++D+L GN+K+  I T+   K + +E   TLE+  K +S+K  P LG  I K+
Sbjct: 372 DSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKE 431

Query: 478 ILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQ 537
            L+K+I++ELAKVK+DLLSTKS++GVYMS  HY  LT DL+ +K E+ + K+VID L  Q
Sbjct: 432 TLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDELNEQ 491

Query: 538 NGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEM 597
           +  L KDK+A  EV+ +Q+IKLQSM+DS+S ++ +IEKQ R+E  L++   KLK     M
Sbjct: 492 STTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDLINSTDKLKETVNNM 551

Query: 598 QATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKD 657
             TI  +++RE   Q +MK +FNEEL +LKS+L++NL +  K  +I+N ++  N+ K  +
Sbjct: 552 NVTIARYTDRESSVQTQMKTLFNEELSKLKSMLLKNLRQFEKNELIDNLEIENNLNKAHE 611

Query: 658 EVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQ-KISDLYNEQLSISISE 716
           E+K I+  ++ E + ++ DC++++ +ESP L  S   D+ +++   S+ YN  L+  +S+
Sbjct: 612 EIKQILQISENEIDSLFLDCIKKMSEESPKLFSSFIQDVSRLENSTSENYN-NLAELLSD 670

Query: 717 LNIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESRN 776
           ++ E N+LKQY+N  FFK++HEE+L  ++ KTY  ++++S   + +    LE YLE +++
Sbjct: 671 VSEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDFLLKFNDLLESYLEGNKS 730

Query: 777 IIIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKTSV 836
           +++ ++K+ TS+++++EM  F P+K+KWE S E+I K    +N++      ++  ++ ++
Sbjct: 731 VLLQNIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSNEFKTKNRVIVGKLQDTL 790

Query: 837 TSTSDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNESITMNE 896
             TS+ + D +S+M+   +   ++  + EN++ + ++F  +M+KN  L+  LN ++T  E
Sbjct: 791 KGTSESLFDTLSEMKSKINELQKAANIIENNEVVTEEFISIMKKNGILKDTLNINMTSTE 850

Query: 897 SSINAFDKLSESIHSAF 913
            SI AFDKL +SI + F
Sbjct: 851 ESIVAFDKLDDSIRNVF 867

 Score =  130 bits (326), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 74/200 (37%), Positives = 117/200 (58%), Gaps = 17/200 (8%)

Query: 1   MSLDPDKGNGDELNIIVAVRCRGR--NEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGI 58
           MSL     +  E NI V  R +G+  NE+    +  +++  P +     I     +D   
Sbjct: 1   MSLSDGVKDKVECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGL-----IKFKGKDDAV- 54

Query: 59  AGQMNSKTYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTG 118
                 + + +D +F     Q  ++ +  +P+F DFI GYNC+ LVYG T +GKTYT++G
Sbjct: 55  -----KREFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSG 109

Query: 119 DE-RLYNGELSD-SAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLL-DECQA 175
           +E  L + E S  S G+IPRVL +LFD +   N D+++KCS++E+YNEELKDLL D+  +
Sbjct: 110 EEDSLLHSEASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNS 169

Query: 176 -INSTAKKLRIFDSNASQIR 194
            ++++ KKLRI DS +  ++
Sbjct: 170 LLSASIKKLRIVDSGSPNVK 189

>TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16
           YEL061C
          Length = 982

 Score =  345 bits (884), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 223/647 (34%), Positives = 398/647 (61%), Gaps = 16/647 (2%)

Query: 302 GIYIQNLKEFHITSAKEGIELLQRGLQYRQVAST----KMNDFSSRSHTIFTINLYKEHD 357
            IYIQNL+E  IT  +EG+ ++++GL+ R++AST      N+FS RSH+IF I LYKE +
Sbjct: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEE 330

Query: 358 -GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPF 416
             ++FR+SK++ V+ AGSE    + ++N      G+ N +L +  ++IN + + + +  F
Sbjct: 331 VNEVFRMSKLSFVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNSTYASF 384

Query: 417 RESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITK 476
            +SKLT+LLQ++  G T+T  IA I+P K   + TCS L  A K K IKN+P+ GS+ITK
Sbjct: 385 LDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITK 444

Query: 477 DILVKNIASELAKVKADLLSTKSRD-GVYMSQIHYKELTNDLESYKTEVQECKRVIDGLT 535
           + L+K +++EL K K+DLLS KS D G+YM + HY ELT  LESYK ++Q  K  I+ LT
Sbjct: 445 ESLIKILSNELVKTKSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELT 504

Query: 536 TQNGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSI 595
            +   +  +K+   E++  Q+IKLQ+++++IS+L+ ++EKQ ++E  L ++ +KL S   
Sbjct: 505 KKGNEIRIEKRTFEEINERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSILG 564

Query: 596 EMQATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKI 655
            MQ +++ +S++E   Q K+K ++++EL++LK+ L  N   I  ++  +N ++  NI+ I
Sbjct: 565 NMQKSVEKYSDKEIHLQNKLKLLYDKELVKLKNSLESNFADIKNRMPDDNDNMNTNIDNI 624

Query: 656 KDEVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQLSISIS 715
           K E+  I + +Q++   +  +   Q++  SP     L+ ++  +++  ++ + + S  +S
Sbjct: 625 KAEILKIANQSQSKVKELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELLS 684

Query: 716 ELNIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESR 775
           +++ E N+L  Y+N +F KS HEE+++ +I +TY  ++  S    E  K  L++Y+E++ 
Sbjct: 685 DISEEFNNLNNYINDNFLKSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKNT 744

Query: 776 NIIIDSLKNTTSDIVKSEMELFAPKKKKWE-DSFEMINKCDSLNNKYFGDISALLSNMKT 834
             +  S+ + TS+IV++E+  F P+KKKWE  S E+I   +    K     S +L+ + +
Sbjct: 745 KSLSKSITSLTSEIVENELTQFNPEKKKWELASNEIIENFNESITKNKNKNSEILAKLLS 804

Query: 835 SVTSTSDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNESITM 894
             TSTS+L  +++S ++K  +     +++  ++  I  +F E++ KN KL+  + ++   
Sbjct: 805 ESTSTSELFINNMSSIKKNVEIVEEFSEIFNSNDLIKSEFLEIINKNKKLKDLITDNFNS 864

Query: 895 NESSINAFDKLSESIHSAFE---KYNTANTISRLDESTNLMKQNKDG 938
           +E+SI++FD L E++ + F+   K + +N    L E    M+Q K G
Sbjct: 865 SENSIDSFDNLKEAMQNVFKNEMKESYSNDTLNLKEIFEQMEQQKLG 911

 Score =  131 bits (330), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 111/196 (56%), Gaps = 21/196 (10%)

Query: 14  NIIVAVRCRGRNEREIKAKSSVVVSVPDVA-GSSEIAINTTEDVGIAGQMNSKTYTVDKV 72
           NI VAVRCR   + E  + S  ++S+ D   G+S   I   E  G       K YT+D V
Sbjct: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTG-----RKKIYTLDAV 63

Query: 73  FGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGD----ERLYNGELS 128
           +G   +Q+ +F+E   P +  F  GYN +++ YG   +GK YT+ G+    +   N E S
Sbjct: 64  YGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAE-S 122

Query: 129 DSAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDEC----------QAINS 178
           ++ G++PRVL +LF  +E   +D+IIKCSF+E+YN+EL+DLL +            A  S
Sbjct: 123 ENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDTGNNANGNNSNGATGS 182

Query: 179 TAKKLRIFDSNASQIR 194
           T KKLRI DS ++ +R
Sbjct: 183 TGKKLRIVDSASNGLR 198

>SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1112

 Score =  242 bits (618), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 137/251 (54%), Positives = 180/251 (71%), Gaps = 15/251 (5%)

Query: 297 PDKQT----GIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTI-- 350
           P+K T     I ++ ++E +I SA+EG++LL  G   RQVASTK ND SSRSHT+FTI  
Sbjct: 242 PEKNTQGSHSIMVKGMEEIYIKSAQEGLKLLTEGSIKRQVASTKCNDLSSRSHTVFTITT 301

Query: 351 NLYK--EHDGKIF-RISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL 407
           N+ K     G+ + +  K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L
Sbjct: 302 NVTKVDPLSGEEYVKNGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINAL 361

Query: 408 ADKNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNK 467
            D + HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA +AKSIKN 
Sbjct: 362 VDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETVSTLEYATRAKSIKNT 421

Query: 468 PQLGSIITKDILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDL-ESYKTEVQE 526
           PQ+   +TKD  +     E+ +++ +L +T+++DG+Y++Q  Y     DL ES    V E
Sbjct: 422 PQINQSMTKDSCITEYIHEIDRLRKELRATRTKDGIYITQEKY-----DLYESNCILVGE 476

Query: 527 CKRVIDGLTTQ 537
            K  ID L  Q
Sbjct: 477 QKARIDNLEEQ 487

 Score =  155 bits (392), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 87/195 (44%), Positives = 115/195 (58%), Gaps = 14/195 (7%)

Query: 4   DPDKGNGDELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMN 63
           DPD       NI V VRCR RN+REI  KSSVV+S     G   I  N +     +    
Sbjct: 47  DPDSPG---YNIKVYVRCRSRNKREIGEKSSVVISTMGAQGRDVILSNPSSSSSGSLTNV 103

Query: 64  SKTYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLY 123
            KTYT D+VFG  ++Q ++F  VA+   ++ ++GYNCTV  YG T TGKTYTM+GD  + 
Sbjct: 104 KKTYTFDRVFGAESDQEVVFNSVAKNYISEMLQGYNCTVFAYGQTGTGKTYTMSGDINIL 163

Query: 124 NGE----------LSDSAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLL-DE 172
                        LS+ AGIIPRVL  LF  ++ ++ DY +K SF+ELYNE LKDLL D 
Sbjct: 164 GSTTHNHDQSSILLSEHAGIIPRVLVDLFKDLKNESTDYSVKVSFLELYNERLKDLLADS 223

Query: 173 CQAINSTAKKLRIFD 187
            +  ++ A+ +RIFD
Sbjct: 224 NKEDDNNAESIRIFD 238

>ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL063W
           (KIP1)
          Length = 1129

 Score =  240 bits (612), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 178/240 (74%), Gaps = 9/240 (3%)

Query: 303 IYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTI--NLYKEH--DG 358
           I+++ ++E +I SA+EG++LL  G   R+VA+TK ND SSRSHTIFTI  N+ K H   G
Sbjct: 251 IFVKGMEEMYIRSAQEGLKLLMDGSLKRKVAATKCNDLSSRSHTIFTITTNVTKIHPISG 310

Query: 359 KIF-RISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR 417
           + + ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D + HIP+R
Sbjct: 311 EQYVKVGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHIPYR 370

Query: 418 ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD 477
           ESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA +AKSIKN PQ+  ++ K+
Sbjct: 371 ESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYATRAKSIKNTPQVNQLMAKE 430

Query: 478 ILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQ 537
             +     E+ +++ +L ++ S++G+Y++Q  ++      ES    V+E +  ID L  Q
Sbjct: 431 SCIIEYIQEIERLRKELRASHSKEGIYITQEKFE----TYESNSILVEEQQAKIDNLQEQ 486

 Score =  156 bits (395), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 115/194 (59%), Gaps = 24/194 (12%)

Query: 12  ELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVDK 71
           E NI V VRCR RNEREI+ KSSVV+S     G   I  N        G  ++KTYT D+
Sbjct: 52  EYNIKVYVRCRSRNEREIREKSSVVISTLGNNGREVILTN-------PGTGSNKTYTFDR 104

Query: 72  VFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE----- 126
           VFG  ++Q  +F +VA    N+ I GYNCTV  YG T TGKTYTM+GD  +         
Sbjct: 105 VFGVESDQESMFNQVARAYINEMIEGYNCTVFAYGQTGTGKTYTMSGDITMMGSSEDDPN 164

Query: 127 ---LSDSAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAIN------ 177
              LS+ AGIIPRVL +LF  +   ++DY +K SF+ELYNE+L+DLL + + ++      
Sbjct: 165 FVLLSEHAGIIPRVLVELFRELREVSEDYSVKVSFLELYNEKLRDLLVDDKDVSLEDHNF 224

Query: 178 ---STAKKLRIFDS 188
              +  + +RI+DS
Sbjct: 225 NGMAPPESIRIYDS 238

>Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  239 bits (609), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 120/215 (55%), Positives = 163/215 (75%), Gaps = 8/215 (3%)

Query: 301 TGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINL------YK 354
           + I ++ ++E  I SA EG+ LL +G   R+VA+TK ND SSRSHT+FTI         K
Sbjct: 239 SSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIIEQDSK 298

Query: 355 EH--DGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNI 412
           EH  +    +I K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D + 
Sbjct: 299 EHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSN 358

Query: 413 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGS 472
           HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA +AKSIKN PQ+  
Sbjct: 359 HIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNSPQVNQ 418

Query: 473 IITKDILVKNIASELAKVKADLLSTKSRDGVYMSQ 507
            ++KD  +K+   E+ K++ DL +++++ G++++Q
Sbjct: 419 SLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQ 453

 Score =  153 bits (387), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 109/189 (57%), Gaps = 14/189 (7%)

Query: 12  ELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVDK 71
           E NI V VRCR RN REI  KSSVV+S     G   I  N +     + +   KTY  D+
Sbjct: 50  ESNIHVYVRCRSRNRREIDEKSSVVISTLGPQGKEIILSNGSHQSYSSSK---KTYQFDQ 106

Query: 72  VFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLY-------N 124
           VFG  ++Q ++F   A+    + + GYNCT+  YG T TGKTYTM+GD  +        N
Sbjct: 107 VFGAESDQEMVFHATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDN 166

Query: 125 GELSDSAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLL----DECQAINSTA 180
             L + AGIIPRVL  LF  +   N +Y +K SF+ELYNE LKDLL    D+    N + 
Sbjct: 167 LLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVSFLELYNENLKDLLSDNEDDDPTANDSK 226

Query: 181 KKLRIFDSN 189
           K++RIFD+N
Sbjct: 227 KQIRIFDNN 235

>Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W
           (REAL)
          Length = 1113

 Score =  238 bits (607), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 162/215 (75%), Gaps = 8/215 (3%)

Query: 301 TGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINL-YKEHDGK 359
           + I ++ ++E  I SA EG+ LL +G   R+VA+TK ND SSRSHT+FTI     E D K
Sbjct: 239 SSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSK 298

Query: 360 -------IFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNI 412
                    +I K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D + 
Sbjct: 299 DHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSN 358

Query: 413 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGS 472
           HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA +AKSIKN PQ+  
Sbjct: 359 HIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNTPQVNQ 418

Query: 473 IITKDILVKNIASELAKVKADLLSTKSRDGVYMSQ 507
            ++KD  +K+   E+ K+K DL +++++ G++++Q
Sbjct: 419 SLSKDTCLKDYIQEIEKLKNDLKNSRNKQGIFITQ 453

 Score =  142 bits (357), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 83/190 (43%), Positives = 109/190 (57%), Gaps = 20/190 (10%)

Query: 14  NIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVDKVF 73
           NI V VRCR RN+REI  KSSVV+S     G   I  N +     + +   KTY  D+VF
Sbjct: 52  NIHVYVRCRSRNKREIDEKSSVVISTLGPQGKEIILSNGSHQSYSSSK---KTYQFDQVF 108

Query: 74  GPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGD----------ERLY 123
           G  ++Q  +F   A+    + + GYNCT+  YG T TGKTYTM+GD          ++L 
Sbjct: 109 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDKLL 168

Query: 124 NGELSDSAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQ----AINST 179
            GE    AGIIPRVL  LF  +   N +Y +K SF+ELYNE LKDLL +       +N T
Sbjct: 169 LGE---HAGIIPRVLVDLFKELSTLNREYSVKISFLELYNENLKDLLSDSDDDDPVVNDT 225

Query: 180 AKKLRIFDSN 189
            +++RIFD+N
Sbjct: 226 KRQIRIFDNN 235

>TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7.387
           YBL063W
          Length = 1232

 Score =  239 bits (609), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 165/212 (77%), Gaps = 5/212 (2%)

Query: 301 TGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTI--NLYKEHD- 357
           + I ++ ++E +I SA EG++LL  G   R+VASTK+ND SSRSHTIFTI  N+ K    
Sbjct: 338 SSITVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKLNDLSSRSHTIFTIITNVTKVDPV 397

Query: 358 -GKIF-RISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIP 415
            GK F +  K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D++ HIP
Sbjct: 398 TGKHFVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDRSHHIP 457

Query: 416 FRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIIT 475
           +RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA +AKSIKN PQ+   ++
Sbjct: 458 YRESKLTRLLQDSLGGKTKTCIIATVSPAKISLEETVSTLEYATRAKSIKNTPQINQSLS 517

Query: 476 KDILVKNIASELAKVKADLLSTKSRDGVYMSQ 507
           KD  +    +E+ +++ +L   ++++G+Y++Q
Sbjct: 518 KDTFIHEYINEIDRLRNELKLARTKEGIYITQ 549

 Score =  122 bits (307), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 82/237 (34%), Positives = 106/237 (44%), Gaps = 73/237 (30%)

Query: 14  NIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEI------------------------- 48
           NI V VRCR R +REI  KSSVV+S     G+  I                         
Sbjct: 51  NIKVYVRCRSRTQREIDEKSSVVISTLGANGNKVILSPNQSRKLYNTNANGSTRTKNNTN 110

Query: 49  ------AINTTEDVGIAGQMNSKTYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTV 102
                    T  + G  G    +TYT DKVFG  ++Q  +FE VA+    + ++GYNCTV
Sbjct: 111 LNNNIKNATTNSNTGTNG----RTYTFDKVFGVESDQETLFESVAKNYIYEMLQGYNCTV 166

Query: 103 LVYGMTSTGKTYTMTGDERLYNG-------ELSDSAGIIPRVLFKLF------------- 142
             YG T TGKTYTM+GD  +           L + AGIIPRVL  LF             
Sbjct: 167 FAYGQTGTGKTYTMSGDLNILGNLDSKDKILLGEHAGIIPRVLVYLFKELSKNDTITNTK 226

Query: 143 ----------------DAMEFQNDDYIIKCSFIELYNEELKDLLD--ECQAINSTAK 181
                           + +  +N +Y +K SF+ELYNE+L DLL   +  A+NS  K
Sbjct: 227 VNNNKNNNNNSNNKNEEQINLKNTEYSVKVSFLELYNEKLTDLLSNYKTDALNSNDK 283

>YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}
           KIP1Kinesin-related motor protein required for mitotic
           spindle assembly, chromosome segregation, and 2 micron
           plasmid partitioning; functionally redundant with Cin8p
           for chromosomal but not plasmid functions
          Length = 1111

 Score =  238 bits (606), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 162/215 (75%), Gaps = 8/215 (3%)

Query: 301 TGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINL-YKEHDGK 359
           + I ++ ++E  I SA EG+ LL +G   R+VA+TK ND SSRSHT+FTI     E D K
Sbjct: 239 SSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSK 298

Query: 360 -------IFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNI 412
                    +I K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D + 
Sbjct: 299 DHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSN 358

Query: 413 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGS 472
           HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA +AKSIKN PQ+  
Sbjct: 359 HIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQVNQ 418

Query: 473 IITKDILVKNIASELAKVKADLLSTKSRDGVYMSQ 507
            ++KD  +K+   E+ K++ DL +++++ G++++Q
Sbjct: 419 SLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQ 453

 Score =  143 bits (361), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 85/199 (42%), Positives = 114/199 (57%), Gaps = 17/199 (8%)

Query: 5   PDKGNG---DELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQ 61
           P   NG    + NI V VRCR RN+REI+ KSSVV+S     G   I  N +     + +
Sbjct: 40  PTCNNGAATSDSNIHVYVRCRSRNKREIEEKSSVVISTLGPQGKEIILSNGSHQSYSSSK 99

Query: 62  MNSKTYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDER 121
              KTY  D+VFG  ++Q  +F   A+    + + GYNCT+  YG T TGKTYTM+GD  
Sbjct: 100 ---KTYQFDQVFGAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDIN 156

Query: 122 LY-------NGELSDSAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQ 174
           +        N  L + AGIIPRVL  LF  +   N +Y +K SF+ELYNE LKDLL + +
Sbjct: 157 ILGDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKISFLELYNENLKDLLSDSE 216

Query: 175 ----AINSTAKKLRIFDSN 189
               A+N   +++RIFD+N
Sbjct: 217 DDDPAVNDPKRQIRIFDNN 235

>Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  238 bits (606), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 162/215 (75%), Gaps = 8/215 (3%)

Query: 301 TGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINL-YKEHDGK 359
           + I ++ ++E  I SA EG+ LL +G   R+VA+TK ND SSRSHT+FTI     E D K
Sbjct: 238 SSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSK 297

Query: 360 -------IFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNI 412
                    +I K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D + 
Sbjct: 298 DHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSN 357

Query: 413 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGS 472
           HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA +AKSIKN PQ+  
Sbjct: 358 HIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQVNQ 417

Query: 473 IITKDILVKNIASELAKVKADLLSTKSRDGVYMSQ 507
            ++KD  +K+   E+ K++ DL +++++ G++++Q
Sbjct: 418 SLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQ 452

 Score =  152 bits (383), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 82/187 (43%), Positives = 110/187 (58%), Gaps = 14/187 (7%)

Query: 14  NIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVDKVF 73
           NI V VRCR RN+REI  KSSVV+S     G   I  N +     +   + KTY  D+VF
Sbjct: 51  NIHVYVRCRSRNKREIDEKSSVVISTLGPQGKEIILSNGSHQ---SYSSSKKTYQFDQVF 107

Query: 74  GPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLY-------NGE 126
           G  ++Q  +F   A+    + + GYNCT+  YG T TGKTYTM+GD  +        N  
Sbjct: 108 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLL 167

Query: 127 LSDSAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLL----DECQAINSTAKK 182
           L + AGIIPRVL  LF  +   N +Y +K +F+ELYNE LKDLL    D+  A+N + ++
Sbjct: 168 LGEHAGIIPRVLVDLFKELSSLNKEYSVKVTFLELYNENLKDLLSDNEDDDPAVNDSKRQ 227

Query: 183 LRIFDSN 189
           +RIFD+N
Sbjct: 228 IRIFDNN 234

>Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} similar
           to Ashbya gossypii ACR228C
          Length = 1134

 Score =  236 bits (601), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 127/243 (52%), Positives = 177/243 (72%), Gaps = 15/243 (6%)

Query: 303 IYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTI--NLYKEH--DG 358
           I ++ ++E +I SA+EG++LL  G   R+VA+T+ ND SSRSHTIFTI  N+ K H   G
Sbjct: 255 IMVKGMEEMYIRSAQEGLKLLMEGSLKRKVAATRCNDLSSRSHTIFTITTNVTKIHPISG 314

Query: 359 KIF-RISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR 417
           + + +I K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D + HIP+R
Sbjct: 315 EQYVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHIPYR 374

Query: 418 ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD 477
           ESKLTRLLQDSLGG TKT +IAT+SPAK + EET STLEYA +AKSIKN PQ+  ++ K+
Sbjct: 375 ESKLTRLLQDSLGGKTKTCIIATVSPAKTSMEETASTLEYATRAKSIKNTPQINQLMAKE 434

Query: 478 ILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTE---VQECKRVIDGL 534
             +     E+ K++ +L +  +++G+Y+++  Y       E+Y++    V+E +  ID L
Sbjct: 435 SCILGYIKEIEKLRKNLKANHAKEGIYITEEKY-------ETYESNCILVEEQQAKIDNL 487

Query: 535 TTQ 537
             Q
Sbjct: 488 QEQ 490

 Score =  153 bits (386), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 81/167 (48%), Positives = 103/167 (61%), Gaps = 15/167 (8%)

Query: 14  NIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVDKVF 73
           NI V VRCR RN REIK KSSVVVS     G   I  N +         N+KTYT D+VF
Sbjct: 56  NIKVYVRCRSRNVREIKEKSSVVVSTLGSQGREIILSNQSTG-------NNKTYTFDQVF 108

Query: 74  GPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDS--- 130
           G  ++Q  +F++VA     + + GYNCTV  YG T TGKTYTM+GD  +    L D    
Sbjct: 109 GVESDQESLFDKVARAYITEMLEGYNCTVFAYGQTGTGKTYTMSGDISVVGASLEDPNYV 168

Query: 131 -----AGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDE 172
                AGIIPRVL +LF  ++ +++DY +K SF+ELYNE+L+DLL E
Sbjct: 169 LLSEHAGIIPRVLVELFQQLQRESEDYSVKVSFLELYNEKLRDLLVE 215

>NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {ON}
           Anc_7.387
          Length = 1186

 Score =  235 bits (599), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 130/269 (48%), Positives = 189/269 (70%), Gaps = 30/269 (11%)

Query: 301 TGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTI--NLYK--EH 356
           + I ++ ++E +I SA EG++LL  G   R+VASTK ND SSRSHT+FTI  N+ K    
Sbjct: 287 SSIMVKGMEEIYIKSAHEGLQLLMDGSLKRKVASTKCNDLSSRSHTVFTIATNITKIDPI 346

Query: 357 DGKIF-RISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIP 415
            G+ + +  K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D + HIP
Sbjct: 347 SGEQYIKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHIP 406

Query: 416 FRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIIT 475
           +RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA +AKSIKN PQ+   ++
Sbjct: 407 YRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYAIRAKSIKNTPQINQSMS 466

Query: 476 KDILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLT 535
           KD  +    SE+ +++ +L +++ +DG+ ++Q       + L+ Y++             
Sbjct: 467 KDTCINEYVSEIERLRLELKTSRQKDGICITQ-------DQLDLYES------------- 506

Query: 536 TQNGLLLKDKKASNEVHNLQKIKLQSMKD 564
             NG+L+ ++K   ++HN+++ ++Q  K+
Sbjct: 507 --NGILVDEQKT--KIHNMEE-QIQKFKE 530

 Score =  151 bits (381), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 84/183 (45%), Positives = 111/183 (60%), Gaps = 15/183 (8%)

Query: 14  NIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVDKVF 73
           NI V VRCR R+EREIK KSSVV+S     G+  I  N +  +        K+Y+ D+VF
Sbjct: 108 NIKVYVRCRSRSEREIKEKSSVVISTLGPQGNQVILSNPSSPLSYP----KKSYSFDRVF 163

Query: 74  GPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDER-LYNGE------ 126
           G  ++Q  +F + A+   ++ + GYNCTV  YG T TGKTYTM+GD   L N E      
Sbjct: 164 GAESDQETVFNDAAKNYISEMLSGYNCTVFAYGQTGTGKTYTMSGDLNILGNLESKDMIL 223

Query: 127 LSDSAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTAKKLRIF 186
           L + AGIIPRVL  LF  +  +N DY +K SF+ELYNE LKDL  + +   S  + +RIF
Sbjct: 224 LGEHAGIIPRVLVNLFKMLALEN-DYSVKISFLELYNERLKDLFAQNE---SEEETIRIF 279

Query: 187 DSN 189
           D+N
Sbjct: 280 DNN 282

>TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7.387
           YBL063W
          Length = 1105

 Score =  232 bits (592), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 165/214 (77%), Gaps = 5/214 (2%)

Query: 303 IYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTI--NLYKE---HD 357
           I ++ ++EF+I SA EG+ELL  G   R+VA+TK ND SSRSHT+FTI  N+ +     +
Sbjct: 248 IMVKGMEEFYIKSAHEGLELLMTGSLKRKVAATKCNDLSSRSHTVFTITTNVARTDPVSN 307

Query: 358 GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR 417
            +  +I K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D + HIP+R
Sbjct: 308 EQYIKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDNSQHIPYR 367

Query: 418 ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD 477
           ESKLTRLLQDSLGG TKT +IATISPAK++ +ET STLEYA +AKSIKN PQ+   ++K+
Sbjct: 368 ESKLTRLLQDSLGGKTKTCIIATISPAKISMDETVSTLEYATRAKSIKNTPQVNQSMSKN 427

Query: 478 ILVKNIASELAKVKADLLSTKSRDGVYMSQIHYK 511
             +     E+ +++ +L +++ ++G+Y+++  ++
Sbjct: 428 SCLGEYIHEIERLRQELKASRQKEGMYITEDQFQ 461

 Score =  152 bits (385), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 116/187 (62%), Gaps = 20/187 (10%)

Query: 14  NIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMN--SKTYTVDK 71
           N+ V VRCR RNE+EI+ KSSVV+S     G   I  N       AG ++   +TYT D+
Sbjct: 41  NMRVYVRCRSRNEQEIEEKSSVVISTLGAKGREVILSNG------AGSLSHSKRTYTFDQ 94

Query: 72  VFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE----- 126
           VFG  ++Q  +F+EVA+   ++ + GYNCTV  YG T TGKTYTM+GD  +  G+     
Sbjct: 95  VFGAESDQETVFDEVAKDYISEMLEGYNCTVFTYGQTGTGKTYTMSGDISIL-GDLDSQD 153

Query: 127 ---LSDSAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTAKKL 183
              L + +GIIPRVL  LF  +  + ++Y +K SF+ELYNE+LKDLL E +      + +
Sbjct: 154 KILLGEHSGIIPRVLVDLFKQLSQETNEYTVKVSFLELYNEKLKDLLAESE---QEEENI 210

Query: 184 RIFDSNA 190
           RIFD+N+
Sbjct: 211 RIFDNNS 217

>NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7.387
          Length = 1102

 Score =  231 bits (590), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 137/315 (43%), Positives = 196/315 (62%), Gaps = 43/315 (13%)

Query: 301 TGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTIN-----LYKE 355
           + I ++ ++E +I SA +G++LL  G   R+VA+TK ND SSRSHT+FTI      L   
Sbjct: 240 SSIMVKGMEEIYINSAHQGLQLLMDGSIKRKVAATKCNDLSSRSHTVFTITTNITKLDPV 299

Query: 356 HDGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIP 415
              +  +  K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D   HIP
Sbjct: 300 SGEQYVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHTQHIP 359

Query: 416 FRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIIT 475
           +RESKLTRLLQDSLGG TKT +IATISPAK++ +ET STLEYA +AKSIKN PQ+   ++
Sbjct: 360 YRESKLTRLLQDSLGGKTKTCIIATISPAKISMDETISTLEYATRAKSIKNTPQVNQSMS 419

Query: 476 KDILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLT 535
           KD  +     E+ +++ +L +++ +DG+ ++Q  +                       L 
Sbjct: 420 KDSCINEYVHEIERLRQELKTSRQKDGISITQDQF----------------------DLY 457

Query: 536 TQNGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSI 595
             NG+L+ +          QK K+Q+M++ I    D   K     QT ++  L+ + K  
Sbjct: 458 ESNGILVDE----------QKTKIQNMEEQIQRFKDKYVK-----QTELNKNLESRLKQN 502

Query: 596 EMQATIKYHSEREQV 610
           E+Q TI+  S+R Q+
Sbjct: 503 ELQ-TIQLKSQRTQL 516

 Score =  148 bits (374), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 110/181 (60%), Gaps = 15/181 (8%)

Query: 15  IIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVDKVFG 74
           I V VRCR RNEREI+ KSSVV+S      S+++ ++         +   +TYT D+VFG
Sbjct: 61  IKVYVRCRSRNEREIQEKSSVVISTLGAPQSTQLLLSNPLLPLAYAK---RTYTFDRVFG 117

Query: 75  PSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE-------- 126
             ++Q  +F + A+   ++ + GYNCTV  YG T TGKTYTM+GD  +  G+        
Sbjct: 118 AESDQESVFNDAAKNYIHEMLEGYNCTVFAYGQTGTGKTYTMSGDLNILGGDLDSNTMVL 177

Query: 127 LSDSAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTAKKLRIF 186
           L + AGIIPRVL +LF  ++  N+ Y +K SF+ELYNE LKDLL   Q   S  + +RIF
Sbjct: 178 LGEHAGIIPRVLVELFRWLD-GNEGYSVKVSFLELYNERLKDLLASEQ---SEEENIRIF 233

Query: 187 D 187
           D
Sbjct: 234 D 234

>KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa]
           {ON} Anc_7.387 YBL063W
          Length = 1151

 Score =  231 bits (590), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 120/215 (55%), Positives = 160/215 (74%), Gaps = 5/215 (2%)

Query: 301 TGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHDGKI 360
           + I ++ ++E +I SA EG++LL  G   R+VASTK ND SSRSHTIFTI         +
Sbjct: 252 SSIMVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKCNDLSSRSHTIFTITTNITKIDPV 311

Query: 361 -----FRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIP 415
                 +I K+NLVDLAGSENISRSGA+N RA+EAG IN+SLLTLGRVIN+L D + HIP
Sbjct: 312 SGEQYVKIGKLNLVDLAGSENISRSGAENMRAQEAGLINKSLLTLGRVINALVDHSQHIP 371

Query: 416 FRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIIT 475
           +RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA +AKSIKN PQ+   ++
Sbjct: 372 YRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETISTLEYATRAKSIKNTPQINQSMS 431

Query: 476 KDILVKNIASELAKVKADLLSTKSRDGVYMSQIHY 510
           KD+ +     E+ +++ +L +++ +DGVY++Q  +
Sbjct: 432 KDVCINEYVQEIERLRQELKASRQKDGVYITQEQF 466

 Score =  147 bits (372), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 84/196 (42%), Positives = 117/196 (59%), Gaps = 20/196 (10%)

Query: 14  NIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVDKVF 73
           NI V VRCR RN+REI+ KSSVV+S     G  E+ ++   D         KTY  D+VF
Sbjct: 59  NIQVYVRCRSRNQREIEEKSSVVISTMGAQGK-EVVLS---DPSSVLSHTKKTYIFDQVF 114

Query: 74  GPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE------- 126
           G  ++Q ++F   A+   ++ ++GYNCT+  YG T TGKTYTM+GD  +  G+       
Sbjct: 115 GVESDQEVVFNATAQNYIHEMLQGYNCTIFAYGQTGTGKTYTMSGDINIL-GDLESQDKI 173

Query: 127 -LSDSAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTAKKLRI 185
            L + AGIIPRVL  LF  +  ++ +Y +K SF+ELYNE LKDLL + +    T + +RI
Sbjct: 174 LLGEHAGIIPRVLVNLFQYLTRESTEYSVKISFLELYNERLKDLLSQSK---ETEESIRI 230

Query: 186 FD----SNASQIRKVS 197
           FD    S  S+I+K S
Sbjct: 231 FDNHIPSGNSKIQKSS 246

>ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1138

 Score =  230 bits (587), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 125/241 (51%), Positives = 171/241 (70%), Gaps = 11/241 (4%)

Query: 303 IYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHDGKI-- 360
           I ++ ++E +I SA EG++LL +G   R+VA+TK ND SSRSHTIFTI  +      +  
Sbjct: 268 ITVKGMEERYIKSAYEGLQLLTKGSLKRKVAATKCNDLSSRSHTIFTIVTHVARTDPVSG 327

Query: 361 ---FRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR 417
               +I K+NLVDLAGSENI+RSGA+N RA+EAG IN+SLLTLGRVIN+L + + HIP+R
Sbjct: 328 EQYVKIGKLNLVDLAGSENINRSGAENMRAQEAGLINKSLLTLGRVINALVEHSSHIPYR 387

Query: 418 ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD 477
            SKLTRLLQDSLGG TKT +IATISPA+++ +ET STLEYA +AKSIKN PQ+   ++KD
Sbjct: 388 GSKLTRLLQDSLGGKTKTCIIATISPARISMDETVSTLEYATRAKSIKNTPQVNQSLSKD 447

Query: 478 ILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDL-ESYKTEVQECKRVIDGLTT 536
             +     E+ +++ +L +++ R+G+Y++Q  Y     DL ES    V+E K VI  +  
Sbjct: 448 SCIMEYIYEIERLRQELKASRQREGMYITQEQY-----DLYESNSLLVEEQKVVIQNMGE 502

Query: 537 Q 537
           Q
Sbjct: 503 Q 503

 Score =  152 bits (383), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 111/192 (57%), Gaps = 16/192 (8%)

Query: 14  NIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVDKVF 73
           NI V VRCR RN+REI  KSSVVVS     G S I  N +  +        KTY  D+VF
Sbjct: 44  NIKVYVRCRSRNQREIDEKSSVVVSTMGRKGKSVILSNPSSPLSHP----KKTYMFDEVF 99

Query: 74  GPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE------- 126
           G  ++Q  IF EVA+    + + GYNCTV  YG T TGKTYTM+GD  ++ G+       
Sbjct: 100 GADSDQESIFTEVAKNYIQEMLEGYNCTVFAYGQTGTGKTYTMSGDMSIW-GDLDSQDKI 158

Query: 127 -LSDSAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTAKKLRI 185
            L + AGIIPRVL  LF  +  +  ++ +K SF+ELYNE LKDLL +    +S    +RI
Sbjct: 159 LLGEHAGIIPRVLVNLFKQLSKETTEHSVKISFLELYNERLKDLLADN---DSDEDNIRI 215

Query: 186 FDSNASQIRKVS 197
           FD+N S     S
Sbjct: 216 FDNNNSNAHGAS 227

>TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7.387
           YBL063W
          Length = 1142

 Score =  172 bits (437), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 116/267 (43%), Positives = 162/267 (60%), Gaps = 36/267 (13%)

Query: 301 TGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTIN-----LYKE 355
           + I ++ ++E  I +A EG+ LL +G   R+V STK+ND SSRSHTIFTI      L  +
Sbjct: 206 SSIIVKGMQEIFIKNAMEGLNLLMKGSLQRKVKSTKLNDLSSRSHTIFTITTNIIKLDNQ 265

Query: 356 HDGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK--NIH 413
            + +  +I K+NLVDLAGSENI++SG +  R++E G IN+SLLTLGRVIN+L+DK  N H
Sbjct: 266 TNKEYIKIGKLNLVDLAGSENITKSGLK--RSQETGLINKSLLTLGRVINALSDKTNNTH 323

Query: 414 ----------------------IPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEET 451
                                 IP+RESKLTRLLQDSLGG TKT +IATISPAK   +ET
Sbjct: 324 GSNNDNNNSSSSSSISNSHHSHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKTCLDET 383

Query: 452 CSTLEYAAKAKSIKNKPQLGSIITKDILVKNIASELAKVKADL-LSTKSRDGVYMSQIHY 510
            STLEYA +A SIKN P++         + +  +++ ++K +L  ST    G+++     
Sbjct: 384 ISTLEYATRAMSIKNNPKINKSQNPSNFINDYINQIDRLKLELQTSTDKIGGIFIPL--- 440

Query: 511 KELTNDLESYKTEVQECKRVIDGLTTQ 537
            E  N  +S +  ++E    I+ +T Q
Sbjct: 441 -EKLNYYKSNEILIEEQNAKINNMTNQ 466

 Score =  133 bits (335), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 79/172 (45%), Positives = 95/172 (55%), Gaps = 24/172 (13%)

Query: 14  NIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVDKVF 73
           NI V VRCR RN++EI  KSSVVVS     G+  I  N+T         N   Y  D VF
Sbjct: 9   NIKVYVRCRSRNQKEIDEKSSVVVSTLGQNGNQIIISNST---------NKNKYIFDNVF 59

Query: 74  GPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLY-------NGE 126
           G  ++Q  IF  VA     + I GYNCT+  YG T TGKTYTM+GD  +        N  
Sbjct: 60  GVESDQESIFNSVAYNYIQEMIDGYNCTLFAYGQTGTGKTYTMSGDLNIIGDLNSTKNIL 119

Query: 127 LSDSAGIIPRVLFKLFDAME--FQND------DYIIKCSFIELYNEELKDLL 170
           L + AGIIPRVL +LF ++E    N        Y +K SF+ELYNE LKDLL
Sbjct: 120 LGEHAGIIPRVLVQLFTSLEDSISNQKNTSVKGYTVKISFLELYNERLKDLL 171

>KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W
          Length = 473

 Score =  144 bits (363), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 126/193 (65%), Gaps = 10/193 (5%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357
           DK T  +++ L+EF + S  E ++ L++G + + V +T +N+ SSRSHTIFTIN+ ++ +
Sbjct: 165 DKTT--FVEGLQEFEVNSVDEILDYLRQGSERKTVGATLVNEQSSRSHTIFTINVEQKEN 222

Query: 358 ---GKIF-RISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIH 413
              G +  R S + L+DLAGSE  + SGA  +R KE  +IN+SL TLGRVI  LA K   
Sbjct: 223 SPLGHVLERRSSIRLIDLAGSERANASGATGERLKEGSNINKSLSTLGRVIAMLAKKKQP 282

Query: 414 --IPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLG 471
             IP+R++ LT +L++SLGGN+KT +IA +SP     EET STL YA  A+S+K   QL 
Sbjct: 283 RLIPYRDAALTWVLKESLGGNSKTCMIACVSPCDF--EETMSTLRYATLARSVKTFAQLN 340

Query: 472 SIITKDILVKNIA 484
           +  T D  V+ +A
Sbjct: 341 TQETVDGKVQMLA 353

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 57/100 (57%), Gaps = 15/100 (15%)

Query: 78  NQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDSAGIIPRV 137
           +Q  ++E++A       + GYN  +  YG T +GK++TMTG   L         GI+PR+
Sbjct: 62  DQAQLYEQLARDYLLHALDGYNTCIFAYGQTGSGKSHTMTGSAEL--------PGIVPRM 113

Query: 138 LFKLFDAMEF--QNDD-----YIIKCSFIELYNEELKDLL 170
             +LF+  E    +DD     + I+CS++E+YNE ++DLL
Sbjct: 114 CQELFEVREMYESSDDQASTQFKIRCSYLEIYNETVRDLL 153

>SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 504

 Score =  143 bits (360), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 83/182 (45%), Positives = 120/182 (65%), Gaps = 12/182 (6%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357
           DK T  +++ L EF +   +E +E +++G + R V  T MN+ SSRSH IFTI++ K+ +
Sbjct: 194 DKTT--FVEGLNEFKVCKVEEILEYMKQGDRLRTVGVTNMNNSSSRSHAIFTISI-KQSE 250

Query: 358 GKIF-----RISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNI 412
             +      R S + LVDLAGSE +S +GA+  R KE  +IN+SL TLGRV++ LA KN 
Sbjct: 251 TTLAGDLTERRSSIKLVDLAGSERVSTTGARGDRLKEGSNINKSLTTLGRVVSVLAKKNR 310

Query: 413 H--IPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQL 470
              IP+R+S LT +L+++LGGN+KT +IA +SP   + EET STL YA  AK +KN  ++
Sbjct: 311 PKLIPYRDSALTWVLKENLGGNSKTVMIACVSPC--DYEETISTLRYATTAKEVKNTARV 368

Query: 471 GS 472
            S
Sbjct: 369 NS 370

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 59/180 (32%), Positives = 86/180 (47%), Gaps = 22/180 (12%)

Query: 14  NIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVDKVF 73
           NI VAVR R    RE        V+ P  +   +  I+T+  +        K +T D  F
Sbjct: 4   NIKVAVRLRSPLPREHGQPIITQVTSP-TSFVIQQHISTSSLLATEEFTQGKIFTFDHCF 62

Query: 74  GPSAN----QRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDE---RLYNGE 126
             S N    Q +I++ +        + GYN  +L YG T +GK++TM G E     +N +
Sbjct: 63  KYSENASHDQEVIYDTIGREYLLHTLDGYNTCILAYGQTGSGKSFTMMGPEVSKHFHNNQ 122

Query: 127 ------LSDSA-GIIPRVLFKLFDAMEFQNDD-------YIIKCSFIELYNEELKDLLDE 172
                 + DSA GIIPRV   LFD     N +       + I CS++E+YNE+++DLL E
Sbjct: 123 TALDRAIEDSAIGIIPRVCCDLFDICNMCNSEEDGIKTQFEIYCSYLEIYNEQVRDLLSE 182

>SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]
           {ON} weakly similar to uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a
           kinesin, colocalizes with Myo2p; kinesin heavy chain
           homolog
          Length = 649

 Score =  140 bits (353), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 129/218 (59%), Gaps = 17/218 (7%)

Query: 299 KQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD- 357
           K +GIY++ L   ++TS +E ++ +++G   R V+ST MN  SSRSH+I  INL K +  
Sbjct: 193 KDSGIYVKGLNTNYVTSEQELLDYIKQGESQRNVSSTSMNLESSRSHSIVRINLEKRNAL 252

Query: 358 GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD-------K 410
            +  + S + LVDLAGSE + ++ A     +EA  IN SL  LG VIN+L          
Sbjct: 253 EENIQHSFLYLVDLAGSEKVGKTNAAGVTLEEAKKINSSLSALGNVINALTQVESKSKRT 312

Query: 411 NIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQL 470
           + HIP+R+SKLTRLLQDSLGGN+KT LI   S ++ N +ET STL + ++AK IKN    
Sbjct: 313 SAHIPYRDSKLTRLLQDSLGGNSKTTLILNCSTSRFNEQETLSTLRFGSRAKKIKNFA-- 370

Query: 471 GSIITKDILVKNIASELAKVKADLLSTKSRDGVYMSQI 508
                  IL KN  S    ++  L   KSR+  Y+ +I
Sbjct: 371 -------ILNKNNLSSRNLLEQQLEELKSRETGYLLRI 401

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 78/139 (56%), Gaps = 16/139 (11%)

Query: 61  QMNSKTYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDE 120
           Q N + +T D+VF   + Q  ++E VA  +   F +GYN T+L YG T +GK++TM G +
Sbjct: 69  QNNDRLFTFDRVFDTGSTQESVYEFVAGDMLKSFFQGYNGTILAYGQTGSGKSHTMFGPK 128

Query: 121 RLYNGELSDSAGIIPRV---LFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAIN 177
                   ++ G+IPR+   +FK  +  ++++  + +  SF+E+Y E++ DLL   Q++ 
Sbjct: 129 --------ENRGVIPRICHDIFKQIETPDYEDCIFTVSVSFMEVYLEKIYDLL--AQSLE 178

Query: 178 STAKK---LRIFDSNASQI 193
             A K   L + D+  S I
Sbjct: 179 KPADKRISLSLHDTKDSGI 197

>KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1 Kinesin-related motor protein
           required for mitotic spindle assembly and chromosome
           segregation; functionally redundant with Cin8p
          Length = 456

 Score =  135 bits (339), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 86/181 (47%), Positives = 119/181 (65%), Gaps = 9/181 (4%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINL-YKEH 356
           DK+T  ++Q++  F +   +E +E L  G   R VAST+MN  SSRSH IFT+++  +E 
Sbjct: 145 DKKT--FVQDITTFKVNRVEEVLEYLSIGDSKRSVASTRMNMESSRSHAIFTLSIKQQEP 202

Query: 357 DGKIFRISKMNLVDLAGSENISRS-GAQN-QRAKEAGSINQSLLTLGRVINSLADKNIH- 413
           DG I R S + LVDLAGSE  + + G  N +R KE  +IN+SL TLGR I+ LA  + H 
Sbjct: 203 DGSI-RESDLKLVDLAGSERANATMGIDNGKRMKEGANINKSLSTLGRCISQLAKNSKHL 261

Query: 414 IPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSI 473
           IP+R+S LT +L+++LGGN+KT +IA ISP  L  EE+ STL YA  AK IK +  +  I
Sbjct: 262 IPYRDSLLTWVLKENLGGNSKTCMIACISPIDL--EESLSTLRYATTAKEIKLRATMNEI 319

Query: 474 I 474
           +
Sbjct: 320 V 320

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 56/109 (51%), Gaps = 9/109 (8%)

Query: 65  KTYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYN 124
           +++  D +F  S++Q  I  E+        + GYN  +  YG T +GKTYTM G      
Sbjct: 35  RSFNFDHIFDTSSSQTDIPGELCSKYVLHALEGYNACIFAYGQTGSGKTYTMRGT----- 89

Query: 125 GELSDSAGIIPRVLFKLFDAMEFQNDDY-IIKCSFIELYNEELKDLLDE 172
              + + GIIP +   LFDA+E        +  ++ E+YNE+L DLL +
Sbjct: 90  ---NSNPGIIPLLCRDLFDALELDKTTVSSVSITYFEIYNEKLIDLLGD 135

>Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {ON}
           YGL216W (KIP3) - kinesin-related protein involved in
           mitosis [contig 192] FULL
          Length = 479

 Score =  132 bits (331), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 76/181 (41%), Positives = 118/181 (65%), Gaps = 10/181 (5%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357
           DK T  +++ L+EF ++S ++ +  +++G + R + ST +N++SSRSHTIFTI++ ++  
Sbjct: 165 DKTT--FVEGLREFDVSSVEDILNYVKQGNEKRMMGSTLVNEYSSRSHTIFTISIKQKEK 222

Query: 358 GK----IFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIH 413
                 I R S + L+DLAGSE    +     R KE  +IN+SL TLGRVI+ LA +   
Sbjct: 223 SALGHVIERHSSIKLIDLAGSERAKAAKTSGDRLKEGSNINKSLSTLGRVISMLAKRKQP 282

Query: 414 --IPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLG 471
             IP+R++ LT +L++SLGGN+KT +IA +SP   + EET STL YA  A+++K   QL 
Sbjct: 283 KLIPYRDAALTWVLKESLGGNSKTCMIACVSPC--DYEETLSTLRYATLARNVKTCAQLN 340

Query: 472 S 472
           +
Sbjct: 341 A 341

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/169 (30%), Positives = 83/169 (49%), Gaps = 31/169 (18%)

Query: 14  NIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMN-SKTYTVDKV 72
           NI VAVR R   ERE+    S++  V D              V    Q N ++++  D+ 
Sbjct: 4   NIKVAVRLRRPLEREVD--ESIIARVED---------GNVIQVKDRNQKNETRSFHFDQC 52

Query: 73  FGPS----ANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELS 128
           F  S    A+Q  ++E+++       + GY+  V  YG T +GK++TMTG          
Sbjct: 53  FAYSENIEADQLELYEQLSREYLLHALDGYHTCVFAYGQTGSGKSHTMTGS--------P 104

Query: 129 DSAGIIPRVLFKLFDAMEFQ-------NDDYIIKCSFIELYNEELKDLL 170
           +S GI+ R+  +LF+  E         N  + I+CS++E+YNE ++DLL
Sbjct: 105 ESPGIVSRMCQELFEVREIYESSDDQVNTQFKIRCSYLEIYNETVRDLL 153

>Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar to
           Ashbya gossypii ADR145C
          Length = 662

 Score =  128 bits (321), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 106/171 (61%), Gaps = 6/171 (3%)

Query: 302 GIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEH--DGK 359
           G+Y+Q+     ++   E +  +  G   R  +ST MN  SSRSH I  INL K    +G 
Sbjct: 215 GVYVQSATVISVSDGDELLHCIHLGESQRCKSSTDMNFESSRSHAIVKINLLKRDNLEGS 274

Query: 360 IFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN---IHIPF 416
           I + S + LVDLAGSE +S++ A     +EA  IN SL +LG VIN+L  K+    HIP+
Sbjct: 275 IQK-SDLFLVDLAGSEKVSKTNAVGATLEEAKKINLSLSSLGNVINALTQKDKKRTHIPY 333

Query: 417 RESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNK 467
           R+S+LTRLL+DSLGGN+KT LI   +  K N  ET +TL + ++AK I+NK
Sbjct: 334 RDSQLTRLLRDSLGGNSKTTLILNCACDKSNEAETLTTLRFGSRAKQIENK 384

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 77/128 (60%), Gaps = 14/128 (10%)

Query: 57  GIAGQMNSKTYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTM 116
           G+ G+  S+++  D VFG ++ Q  +++ VAE + + F  GYN T+L YG T +GK+YTM
Sbjct: 77  GVQGESPSRSFHFDYVFGTNSTQDDVYDFVAEEMLDQFFTGYNSTILAYGQTGSGKSYTM 136

Query: 117 TGDERLYNGELSDSAGIIPRVLFKLFDAMEF----QNDDYIIKCSFIELYNEELKDLLDE 172
            G          D+ G+IPR+  ++F+ +       + +Y++  SF+E+Y E++ DLL E
Sbjct: 137 FGP--------IDNRGLIPRICHEIFERIGLLKSSADIEYVVSVSFLEIYLEKVYDLLGE 188

Query: 173 CQAINSTA 180
             +IN +A
Sbjct: 189 --SINKSA 194

>ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL079W
           (SMY1)
          Length = 635

 Score =  125 bits (315), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 76/170 (44%), Positives = 104/170 (61%), Gaps = 5/170 (2%)

Query: 302 GIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEH--DGK 359
           G+Y++      ++   E +  +  G   R   ST MN  SSRSH I  INL K    +G 
Sbjct: 188 GVYVEGATIVSVSDGDELLNCIHLGEAQRYKGSTDMNLESSRSHAIVKINLLKRDNLEGN 247

Query: 360 IFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA--DKNIHIPFR 417
           I + S + LVDLAGSE ++++ A     +EA  IN SL +LG VIN+L   +K  HIP+R
Sbjct: 248 IQK-SDLFLVDLAGSEKVAKTNAVGATLEEAKKINLSLSSLGNVINALTQKEKRTHIPYR 306

Query: 418 ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNK 467
           +S+LTRLL+DSLGGN+KT LI   +  K N  ET +TL + ++AK IKNK
Sbjct: 307 DSQLTRLLRDSLGGNSKTTLILNCACDKSNESETLTTLRFGSRAKHIKNK 356

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 54/183 (29%), Positives = 92/183 (50%), Gaps = 33/183 (18%)

Query: 6   DKGNGDELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAIN--TTEDVGIAGQMN 63
           D+G  D++ ++V +R                  +P+   ++ +A +  T E  G A +  
Sbjct: 16  DEGADDKMKVVVRLR-----------------PLPEGGSAAVVAADEGTVEFAGAADE-- 56

Query: 64  SKTYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLY 123
           ++ +  D VFG  A Q  +F+ VAE + + F  GYN T+L YG T +GK+YTM G     
Sbjct: 57  ARAFRFDYVFGTDARQEEVFDYVAEEMLDQFFTGYNSTILAYGQTGSGKSYTMFGP---- 112

Query: 124 NGELSDSAGIIPRVLFKLFDAMEFQND----DYIIKCSFIELYNEELKDLLDECQAINST 179
                   G+IPR+  ++F+ +    +    +Y++  SF+E+Y E++ DLL E     S+
Sbjct: 113 ----PGHRGLIPRICQQIFERIGLLKNCADIEYVVSVSFLEIYLEKVYDLLGESINKASS 168

Query: 180 AKK 182
            KK
Sbjct: 169 PKK 171

>Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii ACR228C - AER441C - ADR145C
          Length = 478

 Score =  123 bits (309), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 115/181 (63%), Gaps = 9/181 (4%)

Query: 297 PDKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYK-E 355
           P K T  YI+ L +  + S +E ++ ++ G   R VA T +N+ SSRSH I TIN+ + E
Sbjct: 168 PRKVT--YIEGLSDRIVNSCEELLKCIEEGSARRSVAGTAVNENSSRSHAICTINIQQTE 225

Query: 356 HDG---KIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNI 412
            D     + R+S + LVDLAGSE    S  +++R KE  +IN+SL+TL RV+  L++  +
Sbjct: 226 IDSFGDTVERVSSIKLVDLAGSERTKVSKTKDERFKEGTNINKSLMTLRRVVTMLSNNKV 285

Query: 413 -HIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLG 471
             +P+RES LTR+L+D+L GN+ T ++A ISP   + EE+ STL YA+ AK ++ +  L 
Sbjct: 286 TGVPYRESLLTRVLRDNLDGNSITCILACISPC--DYEESISTLRYASTAKHVRTEAHLN 343

Query: 472 S 472
           +
Sbjct: 344 T 344

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/166 (31%), Positives = 80/166 (48%), Gaps = 23/166 (13%)

Query: 14  NIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVDKVF 73
           NI VA+R R +  RE    S     V     S+EI +       +   +   T+  D+VF
Sbjct: 4   NIKVAIRIRDKISRETSRPS-----VIKRKTSNEITLQKDNTANVITTVE-HTFYFDQVF 57

Query: 74  GPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDSAGI 133
             S+NQ+ I+ E+A       + GY+  V+ YG T  GKTYTM G E+          GI
Sbjct: 58  DESSNQKQIYHELAREYILKALEGYHTCVIAYGQTGAGKTYTMMGTEQ--------EPGI 109

Query: 134 IPRV---LFKLFDAMEFQNDD------YIIKCSFIELYNEELKDLL 170
           IP V   LFK+ D  + +  D      + +  S+ ++YNE++ D+L
Sbjct: 110 IPLVSHELFKIIDMCQDEGPDEDALVHFKVTVSYFQIYNEQIYDML 155

>NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {ON}
           Anc_3.528
          Length = 868

 Score =  124 bits (310), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 111/188 (59%), Gaps = 23/188 (12%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTI------- 350
           DK + I + NL   +  S ++ I+L+ RG   R  +ST+ N+ SSRSH +  I       
Sbjct: 302 DKDSKISVSNLSYHYPKSVQDVIDLVIRGNINRSTSSTEANEVSSRSHAVLQIHIMQTNT 361

Query: 351 --NLYKEHDGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA 408
             +L  EH       + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L 
Sbjct: 362 KIDLTSEHT-----FATLSIIDLAGSERAAATKNRGERLYEGANINKSLLALGNCINALC 416

Query: 409 -------DKNI--HIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAA 459
                   +NI  HIP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA 
Sbjct: 417 IPTNNTRRRNIRYHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYAN 476

Query: 460 KAKSIKNK 467
           +AK IK K
Sbjct: 477 RAKEIKTK 484

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 73/133 (54%), Gaps = 14/133 (10%)

Query: 63  NSKTYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERL 122
           N   +  DK+F  +++Q  ++      L +  + G+N TV  YG T  GKTYT++G +  
Sbjct: 187 NEMKFVFDKIFDENSSQDEVYLGTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGTQ-- 244

Query: 123 YNGELSDSAGIIPRVLFKLFDAMEFQNDD--YIIKCSFIELYNEELKDLLDECQAINSTA 180
                 ++ GII RV+ +LF+ ME   D+  + +  S++E+YNE + DLL      ++ +
Sbjct: 245 ------ENPGIIFRVMQELFERMEDLKDEKTFQLSISYLEIYNEMIYDLLKP----DTPS 294

Query: 181 KKLRIFDSNASQI 193
           KKL I +   S+I
Sbjct: 295 KKLIIREDKDSKI 307

>Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  123 bits (308), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 108/178 (60%), Gaps = 8/178 (4%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357
           D Q  I + NL   H T+ ++ ++L+ +G   R  + T+ N+ SSRSH++  I++ + + 
Sbjct: 264 DTQNHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHSVLQIHIMQTNK 323

Query: 358 ----GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----D 409
                     + ++++DLAGSE  S +  +  R  E  +IN+SLL LG  IN+L      
Sbjct: 324 LVDLTSQHTFATLSIIDLAGSERASATRNRGIRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 410 KNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNK 467
           +  HIP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 384 RTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 58/106 (54%), Gaps = 10/106 (9%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  DK+F  +++Q  +++E   PL +  + G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQVRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 127 LSDSAGIIPRVLFKLFDAMEFQNDD--YIIKCSFIELYNEELKDLL 170
                GII   + +LF+ +    D+  + I  S++E+YNE + DLL
Sbjct: 206 -PSQPGIIFLAMEELFNKISDLKDEKNFEISLSYLEIYNERISDLL 250

>Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  123 bits (308), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 69/178 (38%), Positives = 109/178 (61%), Gaps = 8/178 (4%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357
           D Q+ I + NL   H T+ ++ ++L+ +G   R  + T+ N+ SSRSH +  I++ + + 
Sbjct: 264 DTQSHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNK 323

Query: 358 ----GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----D 409
                     + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      
Sbjct: 324 LVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 410 KNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNK 467
           ++ HIP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 384 RSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 69/130 (53%), Gaps = 14/130 (10%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  DK+F  +++Q  +++E   PL +  + G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQSRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 127 LSDSAGIIPRVLFKLFDAMEFQNDD--YIIKCSFIELYNEELKDLLDECQAINSTAKKLR 184
                GII   + +LF+ +    D+  + I  S++E+YNE ++DLL       + +K+L 
Sbjct: 206 -PSQPGIIFLAMEELFNKIADLRDEKNFEISLSYLEIYNERIRDLLKP----ETPSKRLV 260

Query: 185 IFDSNASQIR 194
           I +   S I+
Sbjct: 261 IREDTQSHIK 270

>SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 809

 Score =  122 bits (307), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 106/178 (59%), Gaps = 8/178 (4%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357
           D   GI + NL      + ++ ++L+ RG   R  + T  N+ SSRSH +  IN+ +++ 
Sbjct: 247 DSIKGISVANLSHHTPQTVQDVMDLVVRGNMNRTTSPTDANETSSRSHAVLQINVVQKNR 306

Query: 358 ----GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----D 409
                +    + ++++DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L      
Sbjct: 307 TAELSEAHTFATLSIIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRR 366

Query: 410 KNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNK 467
              H+P+R+SKLTRLL+ SLGGN KT +I  I+P+  + +ET +TL+YA +AK IK K
Sbjct: 367 STCHVPYRDSKLTRLLKFSLGGNCKTVMIVCIAPSSAHYDETLNTLKYANRAKEIKTK 424

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 56/106 (52%), Gaps = 10/106 (9%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  DK+F   A Q  ++E    PL +  + G+N TV  YG T  GKT+T++G        
Sbjct: 136 FVFDKLFDEDATQTEVYESTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISG-------- 187

Query: 127 LSDSAGIIPRVLFKLFDAMEFQNDD--YIIKCSFIELYNEELKDLL 170
             +  G+I   + +LF  +E   D   + +  S++E+YNE ++DLL
Sbjct: 188 TPEQPGVIFLTMQELFQRIEDLKDSKHFDLTLSYLEIYNESIRDLL 233

>KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {ON}
           Anc_3.528 YGL216W
          Length = 672

 Score =  122 bits (305), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 74/178 (41%), Positives = 111/178 (62%), Gaps = 8/178 (4%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINL---YK 354
           D+ + I + NL      + ++ I+L+ RG   R  + T+ N+ SSRSH++  I++    K
Sbjct: 206 DQNSKISVTNLSYHRPENVQDVIDLVIRGNLNRSSSPTEANEVSSRSHSVLQIHVKQVLK 265

Query: 355 EHD--GKIFRI-SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA--D 409
             D  G   +I S ++++DLAGSE    +  +  R  E  +IN+SLL LG  IN+L    
Sbjct: 266 NFDDIGSTNQIDSTLSIIDLAGSERAITTKNRGIRLYEGANINKSLLALGNCINALCINK 325

Query: 410 KNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNK 467
           K+ HIP+R+SKLTRLL+ SLGGN KT +I  +SP+ L+ +ET +TL+YA +AK IK K
Sbjct: 326 KSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSLHYDETLNTLKYANRAKEIKTK 383

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 67/132 (50%), Gaps = 17/132 (12%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  DK+F   + Q  IFE+   PL +  + G+N TV  YG T  GKTYT+ G        
Sbjct: 92  FIFDKLFDDDSTQEQIFEDTTRPLLDSVLDGFNGTVFAYGATGCGKTYTING-------- 143

Query: 127 LSDSAGIIPRVLFKLFDAMEFQNDD-----YIIKCSFIELYNEELKDLLDECQAINSTAK 181
            S+  GII R + +LF  +E    D       I  S++E+YNE ++DLL       + +K
Sbjct: 144 TSEDPGIIFRTMNELFGKIEILLQDSNRSKIEISLSYLEIYNETIRDLLKP----ETPSK 199

Query: 182 KLRIFDSNASQI 193
           KL I +   S+I
Sbjct: 200 KLIIREDQNSKI 211

>Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  121 bits (303), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 69/178 (38%), Positives = 106/178 (59%), Gaps = 8/178 (4%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357
           D Q  I + NL   H T+ ++ + L+ +G   R  + T+ N+ SSRSH +  I++ + + 
Sbjct: 264 DTQNHIKVANLSYHHPTTVEDVMNLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNK 323

Query: 358 ----GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----D 409
                     + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      
Sbjct: 324 LVDLTSQHTFATLSVIDLAGSERAAATRNRGLRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 410 KNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNK 467
           +  HIP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 384 RTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 60/106 (56%), Gaps = 10/106 (9%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  DK+F  +++Q  +++E   PL +  + GYN TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQTQVYKETTSPLLDSVLDGYNSTVFAYGATGCGKTYTVSGT------- 205

Query: 127 LSDSAGIIPRVLFKLFDAMEFQNDD--YIIKCSFIELYNEELKDLL 170
                G+I   + +LF+ ++   D+  + I  S++E+YNE ++DLL
Sbjct: 206 -PSQPGVIFLAMEELFNKIDDLKDEKNFEISLSYLEIYNERIRDLL 250

>TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa]
           {ON} Anc_3.528 YGL216W
          Length = 733

 Score =  120 bits (302), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 108/179 (60%), Gaps = 9/179 (5%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKE-H 356
           D +  I + NL      + ++ ++L+  G   R  ++T  N+ SSRSH +  IN+ +   
Sbjct: 240 DSENRISVANLSHHRPKTVEDVMDLVVLGNTNRTTSATDANETSSRSHAVLQINIVQSSR 299

Query: 357 DGKI---FRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----- 408
             +I      +K++++DLAGSE  + +  + +R +E  +IN+SLL LG  IN+L      
Sbjct: 300 TAEITSDHTFAKLSIIDLAGSERAASTKNRGERLQEGANINRSLLALGNCINALCISDGT 359

Query: 409 DKNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNK 467
            +  H+P+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K
Sbjct: 360 RRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKTK 418

 Score = 64.7 bits (156), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 55/106 (51%), Gaps = 10/106 (9%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  DK+F  +A Q  ++      L +  + G+N TV  YG T  GKTYT++G        
Sbjct: 129 FVFDKLFDENATQEEVYSGTTSELLDAVLDGFNGTVFAYGATGCGKTYTVSGT------- 181

Query: 127 LSDSAGIIPRVLFKLFDAMEFQNDD--YIIKCSFIELYNEELKDLL 170
             +  G+I   + +LF  ME   D   + I  S++E+YNE ++DLL
Sbjct: 182 -PERPGVIFLAMQELFARMEELEDTRKFEISVSYLEIYNETIRDLL 226

>KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528
           YGL216W
          Length = 723

 Score =  120 bits (301), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 71/183 (38%), Positives = 105/183 (57%), Gaps = 17/183 (9%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINL----- 352
           D    I + NL      S ++ ++L+ RG   R  + T+ N  SSRSH +  I++     
Sbjct: 254 DSNEKISVSNLSYHSPRSVQDVLDLVIRGNDNRTTSPTEANSVSSRSHAVLQIHIMQRNK 313

Query: 353 ---YKEHDGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD 409
               KEH         ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L  
Sbjct: 314 LVDLKEHQT----FGTLSIIDLAGSERAAATKNRGRRLHEGANINRSLLALGNCINALCS 369

Query: 410 -----KNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSI 464
                +N H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK I
Sbjct: 370 NDGSHRNQHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSAHYDETLNTLKYANRAKEI 429

Query: 465 KNK 467
           K K
Sbjct: 430 KTK 432

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 57/113 (50%), Gaps = 10/113 (8%)

Query: 60  GQMNSKTYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGD 119
           G  +   +  DK+F    +Q  ++      L +  + G+N TV  YG T  GKTYT++G 
Sbjct: 136 GSADETKFVFDKLFDTDVSQEDVYRGTTSTLLDSVLDGFNGTVFAYGATGCGKTYTVSGT 195

Query: 120 ERLYNGELSDSAGIIPRVLFKLFDAME--FQNDDYIIKCSFIELYNEELKDLL 170
                    ++ GII R + +LF  M+      D+ +  SF+E+YNE + DLL
Sbjct: 196 R--------ENPGIIFRTMEELFVKMDALAGTKDFELTVSFLEIYNETIHDLL 240

>CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216w KIP3
           kinesin-related protein required for nuclear migration
          Length = 705

 Score =  120 bits (301), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 68/180 (37%), Positives = 106/180 (58%), Gaps = 10/180 (5%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357
           D    I + NL +   T+ +E ++L+ RG   R  + T+ N+ SSRSH +  I++ +++ 
Sbjct: 267 DTDNKITVANLSQHFPTTVQEVMDLVIRGNFNRTTSPTEANEVSSRSHAVLQIHIVQKNR 326

Query: 358 GKIFR----ISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----- 408
               +       ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      
Sbjct: 327 TPDIKEEHTFGTLSIIDLAGSERAAATKNRGARLHEGANINRSLLALGNCINALCINGND 386

Query: 409 -DKNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNK 467
                H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 387 ERPRCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 446

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 58/106 (54%), Gaps = 10/106 (9%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  DK+F   A QR +++     L +  + G+N TV  YG T  GKTYT++G        
Sbjct: 156 FVFDKLFDTDATQREVYQSTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSG-------- 207

Query: 127 LSDSAGIIPRVLFKLFDAMEFQND--DYIIKCSFIELYNEELKDLL 170
             ++ GI+ + + +LF  ME   D   + I  SF+E+YNE ++DLL
Sbjct: 208 TPENPGIVFQAMEELFQKMEDLKDTKSFQISLSFLEIYNERIRDLL 253

>YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}
           KIP3Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 805

 Score =  120 bits (300), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 107/178 (60%), Gaps = 8/178 (4%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357
           D Q  I + NL   H  + ++ ++L+ +G   R  + T+ N+ SSRSH +  I++ + + 
Sbjct: 264 DTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNK 323

Query: 358 ----GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----D 409
                     + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      
Sbjct: 324 LVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 410 KNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNK 467
           ++ HIP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 384 RSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 72.0 bits (175), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 59/106 (55%), Gaps = 10/106 (9%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  DK+F  +++Q  +++E   PL +  + G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 127 LSDSAGIIPRVLFKLFDAMEFQND--DYIIKCSFIELYNEELKDLL 170
                GII   + +LF+ +    D  D+ I  S++E+YNE ++DLL
Sbjct: 206 -PSQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDLL 250

>NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}
           Anc_3.528
          Length = 784

 Score =  120 bits (300), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 108/185 (58%), Gaps = 20/185 (10%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIF--------- 348
           D    I + NL   +  + +E I+L+ +G   R  + T+ N+ SSRSH +          
Sbjct: 262 DGANKISVSNLSYHNPQTVQEVIDLVIKGNINRTTSPTEANEVSSRSHAVLQIHIMQTNR 321

Query: 349 TINLYKEHDGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA 408
           T +L  EH       + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L 
Sbjct: 322 TADLTSEHT-----FATLSIIDLAGSERAAATKNRGERLYEGANINRSLLALGNCINALC 376

Query: 409 ------DKNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAK 462
                 +++ HIP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK
Sbjct: 377 LTDGGTNRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAK 436

Query: 463 SIKNK 467
            IK K
Sbjct: 437 EIKTK 441

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 69/129 (53%), Gaps = 14/129 (10%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  DK+F   A+Q  +++     L +  + G+N TV  YG T  GKTYT++G        
Sbjct: 151 FVFDKLFDQDASQETVYQSTTSGLLDSVLDGFNGTVFAYGATGCGKTYTVSGT------- 203

Query: 127 LSDSAGIIPRVLFKLFDAMEFQNDD--YIIKCSFIELYNEELKDLLDECQAINSTAKKLR 184
             +  GII RV+ +LF+ ME   D   + +  S++E+YNE ++DLL       +  K+L 
Sbjct: 204 -PEQPGIIFRVMQELFERMEDLKDTKRFELSLSYLEIYNETIRDLLKP----ETVPKRLI 258

Query: 185 IFDSNASQI 193
           I +  A++I
Sbjct: 259 IREDGANKI 267

>Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]
           {ON} YGL216W (KIP3) - 1:1 [contig 188] FULL
          Length = 819

 Score =  120 bits (300), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 66/179 (36%), Positives = 107/179 (59%), Gaps = 9/179 (5%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357
           D    I + NL    +++ ++ ++L+ +G   R  ++T  N+ SSRSH +  +++ + + 
Sbjct: 236 DSHRHITVANLSHHPLSTVEDVMDLVIKGNTNRTTSATDANETSSRSHAVLQVHITQRNR 295

Query: 358 GKIF----RISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----- 408
                   + + ++L+DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L      
Sbjct: 296 TAELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRK 355

Query: 409 DKNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNK 467
               H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 356 RGGYHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSNHYDETLNTLKYATRAKEIKTK 414

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 59/107 (55%), Gaps = 10/107 (9%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  D+VF   ++Q  ++E    PL +  + G+N TV  YG T  GKTYT++G        
Sbjct: 125 FVFDRVFDMDSSQIEVYEATTRPLLDSVLDGFNGTVFAYGATGCGKTYTVSG-------- 176

Query: 127 LSDSAGIIPRVLFKLFDAMEFQNDD--YIIKCSFIELYNEELKDLLD 171
             ++ GII   + +LF  ME   D   + +  S++E+YNE ++DLL+
Sbjct: 177 TPENPGIIFLTMQELFAKMEELQDTKRFELSASYLEIYNETIRDLLE 223

>Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON}
           (54983..56503) [1521 nt, 507 aa]
          Length = 506

 Score =  117 bits (293), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 75/188 (39%), Positives = 106/188 (56%), Gaps = 22/188 (11%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEH- 356
           ++   +YI+N+ E  +++  + I+ ++ G + R   ST MN  SSRSH I +I + +   
Sbjct: 184 NRDRSMYIENITEIEVSNIDQMIKCVKMGFRNRTTRSTNMNVNSSRSHAIVSITIKRTDI 243

Query: 357 ----DGKIFRISKMNLVDLAGSE-NISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK- 410
               +  I   S    VDLAGSE + +     N R KE  SIN+SL TL RV+ SL  + 
Sbjct: 244 DLNTNSSIISDSICRFVDLAGSERSTATQNCHNDRLKEGNSINKSLSTLRRVLTSLKKRE 303

Query: 411 -------------NIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEY 457
                        NI +PFRES LT +L+D+LGGN+KT +IA ISP   N EE+ STL Y
Sbjct: 304 ELKYNSNSNSSAHNIVVPFRESLLTWILKDNLGGNSKTCIIACISPT--NFEESASTLRY 361

Query: 458 AAKAKSIK 465
           A  A++IK
Sbjct: 362 ADIAQTIK 369

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/112 (34%), Positives = 58/112 (51%), Gaps = 16/112 (14%)

Query: 70  DKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSD 129
           D+ FG   +Q   ++        D + GYNC +L YG T +GKTYTM G+ +      +D
Sbjct: 64  DEGFGKINSQSEFYKGSINHFVKDALNGYNCCILAYGQTGSGKTYTMMGESK------ND 117

Query: 130 SAGIIPRVLFKLFDAME----------FQNDDYIIKCSFIELYNEELKDLLD 171
           + G+IPR    LF  +E           Q  +Y + CS  E+YNE++ DLL+
Sbjct: 118 TRGVIPRFCEDLFHEIESIKIKDSSDLSQRSEYKVVCSIFEIYNEQIIDLLE 169

>ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {ON}
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 778

 Score =  119 bits (297), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 107/179 (59%), Gaps = 9/179 (5%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357
           D    I + NL  ++    ++ ++L+ +G   R  ++T  N+ SSRSH +  I++ + + 
Sbjct: 239 DSNESIRVSNLSHYNPQKVEDVMDLVIKGNMNRTTSATDANEASSRSHAVLQIHIMQHNR 298

Query: 358 GKIFR----ISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----- 408
               +     + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      
Sbjct: 299 TADLKSDHTFATLSIIDLAGSERAATTKNRGNRLYEGANINRSLLALGNCINALCLNDGT 358

Query: 409 DKNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNK 467
            ++ H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 359 RRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLKYANRAKEIKTK 417

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/137 (33%), Positives = 77/137 (56%), Gaps = 16/137 (11%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  D++F   + Q+ ++E    PL +  + G+N TV  YG T  GKTYT++G        
Sbjct: 128 FVFDRLFDVDSTQKDVYESTMIPLLDSVLDGFNGTVFAYGATGCGKTYTISGS------- 180

Query: 127 LSDSAGIIPRVLFKLFDAMEFQND--DYIIKCSFIELYNEELKDLLDECQAINSTAKKLR 184
             ++ GII + + +LF+ +E   D   + +  SF+E+YNE ++DLL  C    +++KKL 
Sbjct: 181 -PENPGIIFQAMQELFNRIENLKDTKHFELSLSFLEIYNESIRDLL--CP--ETSSKKLV 235

Query: 185 IF-DSNAS-QIRKVSEY 199
           I  DSN S ++  +S Y
Sbjct: 236 ILEDSNESIRVSNLSHY 252

>TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa]
           {ON} Anc_3.528 YGL216W
          Length = 801

 Score =  118 bits (295), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 70/185 (37%), Positives = 111/185 (60%), Gaps = 17/185 (9%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEH- 356
           D    I + NL  +   + +E ++L+ +G   R  +ST  N+ SSRSH +  I+L +++ 
Sbjct: 221 DANNKISVSNLSTYSPATIEEVMDLIIQGNLNRTTSSTHANETSSRSHAVLQIHLTQQNK 280

Query: 357 -------DGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-- 407
                    ++F  S ++++DLAGSE  + +  + +   E  +IN+SLL LG  IN+L  
Sbjct: 281 LNNDINSTEQLF--STLSIIDLAGSERAASTKNRGETLLEGANINKSLLALGNCINALCI 338

Query: 408 -----ADKNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAK 462
                + + IHIP+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK
Sbjct: 339 NTSSHSQQQIHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSKHYDETLNTLKYANRAK 398

Query: 463 SIKNK 467
            IK K
Sbjct: 399 EIKTK 403

 Score = 76.3 bits (186), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 60/107 (56%), Gaps = 10/107 (9%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  DK+   ++ Q+ +F+   EPL +  + GYN TV  YG T  GKTYT++G        
Sbjct: 110 FIFDKLLDQNSTQQHVFQSTTEPLLDSILDGYNGTVFAYGATGCGKTYTISGT------- 162

Query: 127 LSDSAGIIPRVLFKLFDAMEFQND--DYIIKCSFIELYNEELKDLLD 171
             ++ GII   L  LF+ +E   D  +  I  S++E+YNE +KDLLD
Sbjct: 163 -PENPGIIFLTLQSLFNKIENLKDTKEISISLSYLEIYNESIKDLLD 208

>Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON}
           (11134..13554) [2421 nt, 807 aa]
          Length = 806

 Score =  117 bits (294), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 110/184 (59%), Gaps = 19/184 (10%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIF--------- 348
           D ++ I + NL      + ++ ++L+ +G   R  ++T  N+ SSRSH +          
Sbjct: 257 DNESKISVANLSHHRPKTVQDVMDLIIKGNINRTTSATDANETSSRSHAVLQIHISQTNR 316

Query: 349 TINLYKEHDGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA 408
           T++L   H   +F  + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L 
Sbjct: 317 TVDLTSSH---VF--ATLSIIDLAGSERAASTKNRGERLYEGANINKSLLALGNCINALC 371

Query: 409 -----DKNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKS 463
                 ++ H+P+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK 
Sbjct: 372 LNDGTRRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKE 431

Query: 464 IKNK 467
           IK K
Sbjct: 432 IKTK 435

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 69/129 (53%), Gaps = 14/129 (10%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  DK+F   ++Q  ++      L +  + G+N TV  YG T  GKTYT++G        
Sbjct: 146 FIFDKLFNEGSSQLAVYRSTTSLLLDSVLDGFNGTVFAYGATGCGKTYTISGT------- 198

Query: 127 LSDSAGIIPRVLFKLFDAMEFQND--DYIIKCSFIELYNEELKDLLDECQAINSTAKKLR 184
             +  GII   + +LF  +E   D  ++ +  S++E+YNE ++DLL+     ++ +KKL 
Sbjct: 199 -PEQPGIIFLAMEELFQKIENIKDTKNFELTLSYLEIYNESIRDLLNP----DTPSKKLV 253

Query: 185 IFDSNASQI 193
           I + N S+I
Sbjct: 254 IREDNESKI 262

>KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 819

 Score =  117 bits (293), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 66/179 (36%), Positives = 106/179 (59%), Gaps = 9/179 (5%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357
           D    I + NL    + + ++ ++L+ +G   R  ++T  N+ SSRSH +  +++ +++ 
Sbjct: 236 DVHRHITVANLSHHPLFTVEDVMDLVVKGNINRTTSATDANETSSRSHAVLQVHITQKNR 295

Query: 358 GKIF----RISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----- 408
                   + + ++L+DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L      
Sbjct: 296 TAELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCAGGKR 355

Query: 409 DKNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNK 467
               H+P+R+SKLTRLL+ SLGGN KT +I  ISP   + +ET +TL+YA +AK IK K
Sbjct: 356 GGGFHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPTSNHYDETLNTLKYATRAKEIKTK 414

 Score = 74.3 bits (181), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 64/117 (54%), Gaps = 15/117 (12%)

Query: 62  MNSKT-----YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTM 116
           MNS+      +  D+VF   A+Q  ++E    PL +  + G+N TV  YG T  GKTYT+
Sbjct: 115 MNSRRSGEQKFVFDRVFDMHASQEEVYEATTRPLLDSVLDGFNSTVFAYGATGCGKTYTV 174

Query: 117 TGDERLYNGELSDSAGIIPRVLFKLFDAMEFQND--DYIIKCSFIELYNEELKDLLD 171
           +G         +++ GII   + +LF  ME   D   + +  S++E+YNE ++DLL+
Sbjct: 175 SGT--------AENPGIIFLTMQELFAKMEQLKDTKKFELTASYLEIYNESIRDLLE 223

>KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa]
           {ON} Anc_3.479 YPR141C
          Length = 764

 Score =  117 bits (292), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 70/157 (44%), Positives = 97/157 (61%), Gaps = 4/157 (2%)

Query: 313 ITSAKEGIE-LLQRGLQYRQVASTKMNDFSSRSHTIFTINLYK-EHDGKIFRISKMNLVD 370
           +  +KE ++ +L+R  + R  AST  N+ SSRSH+IF I L+   H  K      +NLVD
Sbjct: 602 VLESKESVDKVLKRATKLRSTASTLSNEHSSRSHSIFIIELHGVNHKTKEESCGVLNLVD 661

Query: 371 LAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNI--HIPFRESKLTRLLQDS 428
           LAGSE +  S    +R +E  +IN+SL  LG VI +L DKN   HIPFR SKLT LLQ S
Sbjct: 662 LAGSERVHSSQVTGERLRETQNINRSLSCLGDVIYALNDKNTKRHIPFRNSKLTYLLQYS 721

Query: 429 LGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIK 465
           L GN+KT +   ISP+  +  ET ++L +A+K  + +
Sbjct: 722 LVGNSKTLMFVNISPSSSHINETINSLRFASKVNATR 758

 Score = 71.2 bits (173), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 57/108 (52%), Gaps = 14/108 (12%)

Query: 66  TYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNG 125
           ++  DK+F    +   +F+EV + L    + GYN  +  YG T +GKTYTM         
Sbjct: 471 SFKFDKIFDTGESNDEVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM--------- 520

Query: 126 ELSDSAGIIPRVLFKLFDAME---FQNDDYIIKCSFIELYNEELKDLL 170
            L  + G+IP  +  +FD +E    +  +Y I C F+E+YNE + DLL
Sbjct: 521 -LHPNDGVIPATISHIFDWVENLKERGWEYKISCQFVEIYNENIVDLL 567

>TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {ON}
           Anc_3.528 YGL216W
          Length = 847

 Score =  116 bits (291), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 66/179 (36%), Positives = 101/179 (56%), Gaps = 9/179 (5%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357
           D    I + NL      + +E ++ + RG   R  + T  N+ SSRSH +  I++ +   
Sbjct: 239 DSDQKITVSNLSHHKPQTVQEVMDFVIRGNMNRTTSPTDANETSSRSHAVLQIHIAQTDR 298

Query: 358 GKIF----RISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----- 408
                     + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L      
Sbjct: 299 TPDLISNSTFATLSIIDLAGSERAASTKNRGERLIEGANINKSLLALGNCINALCISDGT 358

Query: 409 DKNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNK 467
            +  H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL YA +AK IK K
Sbjct: 359 RRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLTYANRAKDIKTK 417

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 64/121 (52%), Gaps = 14/121 (11%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  DK+F  +ANQ  ++      L +  + G+N TV  YG T  GKT+T++G        
Sbjct: 128 FVFDKLFDETANQTNVYNSTTSSLLDSVLDGFNGTVFAYGATGCGKTFTISG-------- 179

Query: 127 LSDSAGIIPRVLFKLFDAMEFQNDDYIIK--CSFIELYNEELKDLLDECQAINSTAKKLR 184
             +  GII   + +LF  +E   D   I+   S++E+YNE ++DLL+     N ++KKL 
Sbjct: 180 TPEQPGIIFLTMDELFKRIESLKDTKNIELTLSYLEIYNETIRDLLNP----NVSSKKLV 235

Query: 185 I 185
           I
Sbjct: 236 I 236

>ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1
          Length = 478

 Score =  113 bits (283), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 107/179 (59%), Gaps = 11/179 (6%)

Query: 304 YIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINL-YKEHDGKIFR 362
           +++ L+E  + + +E I  + +G + R V ST MN  SSRSH IF I++  KE   K   
Sbjct: 179 FVEGLEEIAVHNVEELISCIHKGNENRTVRSTNMNQESSRSHAIFHISVNQKETHKKTGT 238

Query: 363 I----SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD----KNIHI 414
           +    S   LVDLAGSE +  + A  +  +E  SIN+SL  LGRVI+ LA+    ++  I
Sbjct: 239 VVECHSTCKLVDLAGSERLGSAAADGKIRQEGTSINKSLSILGRVISLLAEGDRQRSQMI 298

Query: 415 PFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSI 473
           P+RES LT +L+++LGGN+ T L+A +SP   N  E+ STL YA+  K +K    + S+
Sbjct: 299 PYRESALTWILKENLGGNSNTCLVACVSPE--NYYESLSTLRYASLTKKVKTNATINSM 355

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 64/120 (53%), Gaps = 21/120 (17%)

Query: 64  SKTYTVDKVFGPS----ANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGD 119
           +K +  D  FG +     +Q +I+E +        + GYN  +L YG T +GKT+TM G+
Sbjct: 49  AKEFRYDHCFGSTDSVDRDQSIIYESLVRGYVLHTLEGYNSCILAYGQTGSGKTFTMMGE 108

Query: 120 ERLYNGELSDSAGIIPRVLFKLFDA--MEFQND-------DYIIKCSFIELYNEELKDLL 170
           +         + GI+PR   +LF+   M  Q+D       D+ +KCSF E+YNE++ DLL
Sbjct: 109 K--------GNEGIVPRFCRELFEVFHMCHQDDQESDIITDFQVKCSFFEIYNEQVIDLL 160

>AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL216W
           (KIP3)
          Length = 818

 Score =  114 bits (284), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 103/178 (57%), Gaps = 8/178 (4%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357
           D  +   + NL      + ++ ++L+ RG   R  + T  N+ SSRSH +  +++ +   
Sbjct: 239 DSDSTTTVANLSYHTPETVEDVMDLVIRGNVNRTTSPTDANETSSRSHAVLQVHVVQSSR 298

Query: 358 GKIFRISKM----NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN-- 411
               +  KM    +++DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L      
Sbjct: 299 TVDLKEDKMYATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMTGRR 358

Query: 412 --IHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNK 467
              H+P+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K
Sbjct: 359 AVCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKTK 416

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 70/135 (51%), Gaps = 18/135 (13%)

Query: 46  SEIAINTTEDVGIAGQM-------NSKTYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGY 98
           SE  +NT   VG  G++         + +  DK+F   A+Q+ +F+    PL +  + G+
Sbjct: 101 SETVLNTML-VGSRGEVRRRMRRNGEQKFMFDKLFDVDASQQDVFQCTTMPLLDSILDGF 159

Query: 99  NCTVLVYGMTSTGKTYTMTGDERLYNGELSDSAGIIPRVLFKLFDAMEFQND--DYIIKC 156
           N TV  YG T  GKT+T++G          DS GII   + +LF  +    D   + +  
Sbjct: 160 NGTVFAYGATGCGKTFTISG--------TPDSPGIIFLTMQELFQRINNLKDTKTFELTV 211

Query: 157 SFIELYNEELKDLLD 171
           S++E+YNE ++DLL+
Sbjct: 212 SYLEIYNETIRDLLE 226

>KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 769

 Score =  113 bits (282), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 132/239 (55%), Gaps = 18/239 (7%)

Query: 304 YIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHDGKIFR- 362
           ++ NL +    + +E ++L+ +G   R  + T  N+ SSRSH +  I++ + +     + 
Sbjct: 241 FVSNLSKHSPENVEEVMDLVIKGNMNRTTSPTDANETSSRSHAVLQIHVAQMNRTADIKQ 300

Query: 363 ---ISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN------IH 413
               + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L   +       H
Sbjct: 301 DQTFATLSIIDLAGSERAAVTKNRGERLLEGANINRSLLALGNCINALCVSSTRTGFSCH 360

Query: 414 IPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSI 473
           +P+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K     I
Sbjct: 361 VPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSGHYDETLNTLKYANRAKEIKTK----VI 416

Query: 474 ITKDILVKNIASELAKV---KADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKR 529
             K  L +++ S L  +   K+++   +SR+   M +I   +  N  E     ++E  R
Sbjct: 417 RNKQSLDRHVGSYLKLITEQKSEIEELRSREQ-KMIEIQLSQFRNGREKVNMLIKESVR 474

 Score = 75.1 bits (183), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 71/136 (52%), Gaps = 22/136 (16%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  D++F     Q+ ++E    PL +  + G+N TV  YG T  GKT+T++G        
Sbjct: 124 FIFDRIFDMDVTQQEVYENTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISGT------- 176

Query: 127 LSDSAGIIPRVLFKLFDAMEFQND--DYIIKCSFIELYNEELKDLLDECQAINSTAKKL- 183
            S+  GII   + +LF  ME   D   + ++ SF+E+YNE++ DLLD     N ++KKL 
Sbjct: 177 -SEQPGIIFLTMQELFIRMEQLKDTKKFQLQLSFLEIYNEQIHDLLDP----NISSKKLV 231

Query: 184 -------RIFDSNASQ 192
                  R F SN S+
Sbjct: 232 IREDSYNRTFVSNLSK 247

>TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON}
           Anc_3.479 YPR141C
          Length = 676

 Score =  112 bits (279), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 101/165 (61%), Gaps = 4/165 (2%)

Query: 305 IQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHDG-KIFRI 363
           ++NL+   +TS +    +L+  ++ R  AST  N+ SSRSH+IF I ++  ++G    R 
Sbjct: 506 VENLETITLTSKESVDAVLKNAMKLRATASTSSNERSSRSHSIFIIKIHGINEGLGEERN 565

Query: 364 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNI---HIPFRESK 420
             +NL+DLAGSE +S S  Q++R KE   IN+SL  LG V+NSL   +    HI FR+SK
Sbjct: 566 GLLNLIDLAGSERLSVSKVQSERIKETQHINKSLSFLGNVMNSLGSPDATTRHISFRDSK 625

Query: 421 LTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIK 465
           LT LLQ SL GN+KT ++  IS +  +  ET  +L +A K  S K
Sbjct: 626 LTYLLQYSLTGNSKTLMVVNISSSSDHINETIKSLNFAKKVNSTK 670

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 71/131 (54%), Gaps = 16/131 (12%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           Y+ DKVF  +   + IF+EV+E L    + G+N  +  YG T +GKT+TM          
Sbjct: 383 YSFDKVFSQTDTNQEIFKEVSE-LIQSSLDGFNVCIFAYGQTGSGKTFTM---------- 431

Query: 127 LSDSAGIIPRVLFKLFDAMEFQNDD---YIIKCSFIELYNEELKDLL--DECQAINSTAK 181
           L+   GIIP     +FD ++    +   Y + C F+E+YN+E+ DLL  D+ ++ +S   
Sbjct: 432 LNPKDGIIPSTAKHIFDWIDNSAKNGWKYNVTCEFLEIYNDEIYDLLRSDDNKSNSSNGP 491

Query: 182 KLRIFDSNASQ 192
           + +I   +AS+
Sbjct: 492 RHKIHHDDASK 502

>Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar to
           Ashbya gossypii AER441C
          Length = 833

 Score =  112 bits (280), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 101/171 (59%), Gaps = 8/171 (4%)

Query: 305 IQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHDGKIFRIS 364
           + NL      S ++ ++L+ +G   R  + T  N+ SSRSH +  I++ +       +  
Sbjct: 248 VANLSYHTPRSVQDVMDLVIKGNINRTTSPTDANETSSRSHAVLQIHVVQSSRSVDLKED 307

Query: 365 K----MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN----IHIPF 416
           K    ++++DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L         H+P+
Sbjct: 308 KTYATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMTGRRTYCHVPY 367

Query: 417 RESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNK 467
           R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K
Sbjct: 368 RDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKTK 418

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 69/135 (51%), Gaps = 18/135 (13%)

Query: 46  SEIAINTTEDVGIAGQM-------NSKTYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGY 98
           SE  +NT   VG  G++         + +  DK+F   A Q+ +F     PL +  I G+
Sbjct: 103 SETVLNTML-VGSRGEIRRRMRRNGEQKFMFDKLFDVEATQQDVFLGTTRPLLDSIIDGF 161

Query: 99  NCTVLVYGMTSTGKTYTMTGDERLYNGELSDSAGIIPRVLFKLFDAMEFQND--DYIIKC 156
           N TV  YG T  GKT+T++G          ++ GII   + +LF  +E   D   + +  
Sbjct: 162 NGTVFAYGATGCGKTFTISG--------TPENPGIIFLTMQELFQRIENLKDTKTFQLTV 213

Query: 157 SFIELYNEELKDLLD 171
           S++E+YNE ++DLL+
Sbjct: 214 SYLEIYNEMIRDLLE 228

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
           similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141c KAR3 kinesin-related protein
          Length = 692

 Score =  111 bits (277), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 101/166 (60%), Gaps = 4/166 (2%)

Query: 304 YIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHDGKIFRI 363
           YI N+    + S     ++L+R  + R  AST  N+ SSRSH+IF I+L  +++G   + 
Sbjct: 522 YITNITTCVLDSRDTVDKVLKRANKLRSTASTAANEHSSRSHSIFIIHLEGKNEGTGEKS 581

Query: 364 SK-MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI---NSLADKNIHIPFRES 419
              +NLVDLAGSE ++ S    +R +E  SIN+SL  LG VI   NS   +  HIPFR S
Sbjct: 582 QGILNLVDLAGSERLNSSMVVGERLRETQSINKSLSCLGDVIHALNSPDGQKRHIPFRNS 641

Query: 420 KLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIK 465
           KLT LLQ SL G++KT +   ISPA L+  ET ++L +A+K  + K
Sbjct: 642 KLTYLLQYSLIGSSKTLMFVNISPAALHLNETINSLRFASKVNNTK 687

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 52/107 (48%), Gaps = 14/107 (13%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  DK+F        IF+EV + L    + GYN  +  YG T +GKTYTM          
Sbjct: 397 FKFDKIFDQQETNDEIFKEVGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM---------- 445

Query: 127 LSDSAGIIPRV---LFKLFDAMEFQNDDYIIKCSFIELYNEELKDLL 170
           L+   GI+P     +F   D +  +   Y + C FIE+YNE + DLL
Sbjct: 446 LNPGDGIVPATINHIFSWIDKLAARGWSYKVSCEFIEIYNENIVDLL 492

>NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {ON}
           Anc_8.678
          Length = 655

 Score =  110 bits (276), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 71/183 (38%), Positives = 105/183 (57%), Gaps = 20/183 (10%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEH- 356
           D + G+ +  L+E    S++E ++ ++RG  +R+ A T  N  SSRSH I  I L   + 
Sbjct: 274 DSKYGVRVMGLREQRCESSEELMKWIRRGDSHRKTAETDYNARSSRSHAIVLIRLTNTNV 333

Query: 357 -DGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-------- 407
            DG     S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L        
Sbjct: 334 IDGTSIS-STLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSAESTAAS 389

Query: 408 ------ADKNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKA 461
                 A+ N HIP+R+SKLTR+LQ +L G++    I TI   K ++ ET +TL +A++A
Sbjct: 390 HGNSPNANGNGHIPYRDSKLTRILQPALSGDSIVTTICTIDTQKESAAETLNTLRFASRA 449

Query: 462 KSI 464
           K++
Sbjct: 450 KNV 452

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 60/117 (51%), Gaps = 8/117 (6%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  D V+ P  +   I+E + +P+ +   +G+N TV  YGMT +GKTYTM G       +
Sbjct: 135 FKFDHVYSPHVSNLEIYESINKPMIDKLFQGFNATVFAYGMTGSGKTYTMMGSGG----D 190

Query: 127 LSDSAGIIP---RVLF-KLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINST 179
             D  G+IP     LF K+ +        + +  S++E+YNE + DLLD    +  T
Sbjct: 191 GGDDDGLIPLSVSYLFSKVIEVGLVGERKFDVLLSYLEIYNERIYDLLDSESLVGGT 247

>TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {ON}
           Anc_3.479 YPR141C
          Length = 739

 Score =  110 bits (276), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 76/182 (41%), Positives = 101/182 (55%), Gaps = 14/182 (7%)

Query: 298 DKQTGI-YIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYK-E 355
           D Q+ I Y+ N+K F I +  + I L+ +    R  +ST +N  SSRSH IF I L    
Sbjct: 556 DDQSKITYVTNIKRFKIENISDTIGLINKSKIKRMTSSTGLNSHSSRSHGIFIIYLEGYN 615

Query: 356 HDGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-------- 407
           H      ISK+NLVDLAGSE I+ S  Q  R KE  SIN+SL  LG VI++L        
Sbjct: 616 HKTNEKCISKLNLVDLAGSERINFSKVQGDRLKETQSINKSLSCLGDVIHALNRGNKNHL 675

Query: 408 ----ADKNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKS 463
                 K  HIPFR SKLT LL+ SL G++KT +   +S  + +  ET ++L +A K  +
Sbjct: 676 NSNDLQKTRHIPFRNSKLTYLLKYSLIGDSKTLMFVNVSSNEAHLNETINSLRFATKVNN 735

Query: 464 IK 465
            K
Sbjct: 736 TK 737

 Score = 68.9 bits (167), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 57/113 (50%), Gaps = 16/113 (14%)

Query: 63  NSKTYTV--DKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDE 120
           N+ TY+   D VF        +F E+ E L    + GYN  +  YG T +GKTYTM    
Sbjct: 438 NNATYSFEFDHVFKQDEGNSEVFNEI-EQLIQSALDGYNVCIFAYGQTGSGKTYTM---- 492

Query: 121 RLYNGELSDSAGIIP---RVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLL 170
                 L+ + G+IP   + +F   D+++    +Y + C FIELYNE + DL 
Sbjct: 493 ------LNPNDGVIPMTIKYIFNSMDSLKKNGWEYNVSCEFIELYNENIIDLF 539

>AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR141C (KAR3)
          Length = 709

 Score =  110 bits (275), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 67/169 (39%), Positives = 101/169 (59%), Gaps = 6/169 (3%)

Query: 302 GIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKE--HDGK 359
           G YI N+    +TS  +   +L++  + R  A+T+ N+ SSRSH++F +++     H G+
Sbjct: 538 GTYITNVTRMKMTSTSQVDTILKKASKMRSTAATRSNERSSRSHSVFMVHINGRNLHTGE 597

Query: 360 IFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNI---HIPF 416
             +  K+NLVDLAGSE I+ S    +R +E  +IN+SL  LG VI +L   +    +IPF
Sbjct: 598 TSQ-GKLNLVDLAGSERINSSAVTGERLRETQNINKSLSCLGDVIYALNTPDAGKRYIPF 656

Query: 417 RESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIK 465
           R SKLT LLQ SL G++KT +   I P   +  ET ++L +A+K  S K
Sbjct: 657 RNSKLTYLLQYSLVGDSKTLMFVNIPPDPNHISETLNSLRFASKVNSTK 705

 Score = 78.2 bits (191), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 90/185 (48%), Gaps = 23/185 (12%)

Query: 14  NIIVAVRCRGRNEREIKAKSSVVVS-VPDVAGSSEIAINTTEDVGIAGQMNSKTYTVDKV 72
           NI V  R R     E +  S +++    +  G+  + IN  E     G++ S  +  D +
Sbjct: 366 NIRVYCRVRPPLLNEPQDMSHILIEKFNEAKGAQSLTINRNE-----GRILSYNFQFDMI 420

Query: 73  FGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDSAG 132
           F PS   + IFEE+ + L    + GYN  +  YG T +GKTYTM          L+   G
Sbjct: 421 FEPSHTNKEIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM----------LNAGDG 469

Query: 133 IIPRVL---FKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTAKKLRIFDSN 189
           +IP  L   FK    ++ +  +Y ++C +IE+YNE + DLL + ++ ++  +   I DS 
Sbjct: 470 MIPMTLSHIFKWTANLKERGWNYEMECEYIEIYNETILDLLRDFKSHDNIDE---ILDSQ 526

Query: 190 ASQIR 194
              IR
Sbjct: 527 KHDIR 531

>KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa]
           {ON} Anc_3.479 YPR141C
          Length = 706

 Score =  109 bits (273), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 92/152 (60%), Gaps = 12/152 (7%)

Query: 322 LLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHDGKIFRISK-----MNLVDLAGSEN 376
           +L R  + R  ASTK N+ SSRSH+IF I+L+    GK  + ++     +NLVDLAGSE 
Sbjct: 555 VLHRATKLRSTASTKSNEHSSRSHSIFIIHLH----GKNSKTNEDSYGILNLVDLAGSER 610

Query: 377 ISRSGAQNQRAKEAGSINQSLLTLGRVI---NSLADKNIHIPFRESKLTRLLQDSLGGNT 433
           I+ S    +R +E   IN+SL  LG VI   NS   K  HIPFR SKLT LL+ SL GN+
Sbjct: 611 INSSQVSGERLRETQHINKSLSCLGDVIHALNSSEHKERHIPFRNSKLTHLLKYSLSGNS 670

Query: 434 KTALIATISPAKLNSEETCSTLEYAAKAKSIK 465
           KT +   IS +  +  ET ++L +A+K  S K
Sbjct: 671 KTLMFVNISASLNHVNETINSLRFASKVNSTK 702

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/148 (33%), Positives = 75/148 (50%), Gaps = 18/148 (12%)

Query: 53  TEDVGIAGQMNSKTYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGK 112
           T+ + I    N+  Y  DK+F    +   IF+EV + L    + GYN  +  YG T +GK
Sbjct: 407 TQTMEITKNNNTNKYKFDKIFDQFESNSEIFKEVGQ-LVQSALDGYNVCIFAYGQTGSGK 465

Query: 113 TYTMTGDERLYNGELSDSAGIIP---RVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDL 169
           T+TM          L+ S GIIP   R +F   D ++ +  +Y I C F+E+YNE + DL
Sbjct: 466 TFTM----------LNPSDGIIPSTVRHIFTWIDNLKERGWEYQINCQFVEIYNENIIDL 515

Query: 170 LDECQAINSTAKKLRIFDSNASQIRKVS 197
           L E Q    T++K  I   + SQ   ++
Sbjct: 516 LREKQ----TSQKHDIRHDDESQTTSIT 539

>TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {ON}
           Anc_3.479 YPR141C
          Length = 704

 Score =  109 bits (272), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 98/165 (59%), Gaps = 4/165 (2%)

Query: 305 IQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHDGKIFRIS 364
           I N+    +TS     ELL+R  + R  AST  N+ SSRSH+IF ++L  E+     R  
Sbjct: 532 ITNVTTVPLTSKNTVDELLKRANKLRSTASTACNERSSRSHSIFIVHLSGENVLTGERSH 591

Query: 365 K-MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNI---HIPFRESK 420
             +NLVDLAGSE I+ S    +R +E  SIN+SL  LG VI++L   +    HIPFR SK
Sbjct: 592 GILNLVDLAGSERINTSQVIGERLRETQSINKSLSCLGDVIHALGSADASKRHIPFRNSK 651

Query: 421 LTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIK 465
           LT LLQ SL GN+KT +   IS    ++ ET ++L +A+K  S K
Sbjct: 652 LTYLLQYSLTGNSKTLMFVNISGNPNHTNETLNSLRFASKVNSTK 696

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 74/161 (45%), Gaps = 20/161 (12%)

Query: 14  NIIVAVRCRGRNEREIKAKSSV-VVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVDKV 72
           NI V  R R    RE    + + V    D AG+  I +      G   Q+    +  D++
Sbjct: 354 NIRVFCRVRPPLPRENATSNHLKVREFNDDAGNQVIEV-AKNGYGSGPQI----FKFDRI 408

Query: 73  FGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDSAG 132
           F        +F+E+ + L    + GYN  +  YG T +GKTYTM          L+ + G
Sbjct: 409 FNEKETNYDVFQEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM----------LNPTDG 457

Query: 133 IIPRVLFKLFDA---MEFQNDDYIIKCSFIELYNEELKDLL 170
           IIP  +  +F+    ++ +   Y + C F+E+YNE + DLL
Sbjct: 458 IIPATITHIFNWTKNLKERGWRYDVSCQFVEIYNETIADLL 498

>SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 706

 Score =  107 bits (268), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 92/149 (61%), Gaps = 6/149 (4%)

Query: 322 LLQRGLQYRQVASTKMNDFSSRSHTIFTINL--YKEHDGKIFRISKMNLVDLAGSENISR 379
           LL+R  + R  A+T  N+ SSRSH++F I L  Y  + G+  +   +NLVDLAGSE I+ 
Sbjct: 554 LLKRAAKLRSTAATGSNERSSRSHSVFIIKLRGYNSNTGEECQ-GTLNLVDLAGSERINA 612

Query: 380 SGAQNQRAKEAGSINQSLLTLGRVINSLADKNI---HIPFRESKLTRLLQDSLGGNTKTA 436
           S     R +E  +IN+SL  LG VI++LA  +    HIPFR SKLT LLQ SL G++KT 
Sbjct: 613 SQVTGDRLRETQNINKSLSCLGDVIHALASPDASKRHIPFRNSKLTYLLQYSLLGDSKTL 672

Query: 437 LIATISPAKLNSEETCSTLEYAAKAKSIK 465
           +   ISP   +  ET ++L +A+K  S +
Sbjct: 673 MFVNISPCLDHFNETLNSLRFASKVNSTR 701

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 58/121 (47%), Gaps = 14/121 (11%)

Query: 53  TEDVGIAGQMNSKTYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGK 112
           T+ + I        +  DK+F P  +   IFEE+ + L    + GYN  +  YG T +GK
Sbjct: 399 TQSMNITRDSKKHEFKFDKIFDPENSNDDIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGK 457

Query: 113 TYTMTGDERLYNGELSDSAGIIPRVL---FKLFDAMEFQNDDYIIKCSFIELYNEELKDL 169
           TYTM          L    G+IP  L   F+    ++ +  +Y I   FIE+YNE + DL
Sbjct: 458 TYTM----------LHPQNGMIPSTLDHIFQWIHLLKERGWEYEISSQFIEIYNETIIDL 507

Query: 170 L 170
           L
Sbjct: 508 L 508

>KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]
           {ON} similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141C KAR3 Minus-end-directed microtubule motor that
           functions in mitosis and meiosis localizes to the
           spindle pole body and localization is dependent on
           functional Cik1p required for nuclear fusion during
           mating potential Cdc28p substrate
          Length = 702

 Score =  107 bits (267), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 70/167 (41%), Positives = 97/167 (58%), Gaps = 6/167 (3%)

Query: 304 YIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINL--YKEHDGKIF 361
           +I N+    +TS +    +L+R L+ R  A+T  N  SSRSH++F I L  Y    G+  
Sbjct: 532 HITNITVCKLTSREMVNRMLRRALKMRSTAATVANSRSSRSHSVFIIKLDGYNTISGEK- 590

Query: 362 RISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNI---HIPFRE 418
               +NLVDLAGSE I     Q +R +E  +IN+SL  LG VI++L   +    HIPFR 
Sbjct: 591 STGTLNLVDLAGSERIHSLQPQAERLRETQNINKSLSCLGDVIHALGSADASKRHIPFRN 650

Query: 419 SKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIK 465
           SKLT LLQ SL G++KT +   +SP   +  ET ++L +AAK  S K
Sbjct: 651 SKLTYLLQYSLMGDSKTLMFVNVSPCANSMLETLNSLRFAAKVNSTK 697

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 80/179 (44%), Gaps = 28/179 (15%)

Query: 14  NIIVAVRCRGRNEREIKAKSSVVVS-VPDVAGSSEIAINTTEDVGIAGQMNSKT--YTVD 70
           NI V  R R   E E  + SS+ +    D  G   I I          + +SK   +T D
Sbjct: 363 NIRVFCRLRPALENENYSSSSIEIEKFSDETGMQSITI----------KRDSKQHKFTFD 412

Query: 71  KVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDS 130
           + F        +F E+ + L    + GYN  +  YG T +GKT+TM          L+ +
Sbjct: 413 RCFSAQETNGDVFSEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTFTM----------LNPN 461

Query: 131 AGIIPRVLFKLFDAMEFQND---DYIIKCSFIELYNEELKDLLDECQA-INSTAKKLRI 185
            GIIP  L  +F  +E   +    Y I   F+E+YNE +KDL  E  A ++ T + L+ 
Sbjct: 462 DGIIPSTLNHIFLWVEKLKELGWVYEITSQFVEIYNENIKDLFKENDADVDDTGESLKF 520

>Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}
           complement(87351..89429) [2079 nt, 693 aa]
          Length = 692

 Score =  106 bits (265), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 65/159 (40%), Positives = 99/159 (62%), Gaps = 7/159 (4%)

Query: 313 ITSAKEGIE-LLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD--GKIFRISKMNLV 369
           I  +K+ ++ L+++  + R  A+T  N+ SSRSH+IF I+L   ++  G+      +NLV
Sbjct: 529 ILKSKDSVDFLIKKATKLRATATTAANERSSRSHSIFIIHLRGSNNITGE-SSYGILNLV 587

Query: 370 DLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNI---HIPFRESKLTRLLQ 426
           DLAGSE ++ S  +  R +E  +IN+SL  LG VI++L   +    HIPFR SKLT LLQ
Sbjct: 588 DLAGSERLNSSQVEGARLRETQNINKSLSCLGDVIHALGSSDASKRHIPFRNSKLTYLLQ 647

Query: 427 DSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIK 465
            SL GN+KT +   ISP +   +ET ++L +A+K  + K
Sbjct: 648 YSLTGNSKTLMFVNISPTQQQIQETLNSLRFASKVNTTK 686

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 59/109 (54%), Gaps = 14/109 (12%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  D++F      + +F+E+ + L    + GYN  +  YG T +GKT+TM          
Sbjct: 397 FQFDRIFDQHEVNKDVFDEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 445

Query: 127 LSDSAGIIPRVLFKLFD---AMEFQNDDYIIKCSFIELYNEELKDLLDE 172
           L+ + G+IP  +  +FD   +++ +  +Y + C F+E+YNE + DLL E
Sbjct: 446 LNPNDGMIPATIDHIFDWTDSLKERGWEYEVSCQFVEIYNENIIDLLRE 494

>NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {ON}
           Anc_3.479 YPR141C
          Length = 698

 Score =  106 bits (265), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 70/167 (41%), Positives = 99/167 (59%), Gaps = 8/167 (4%)

Query: 305 IQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD---GKIF 361
           I N+   ++ S +    +L+R  + R  AST  N+ SSRSH+IF I+L   +     + +
Sbjct: 531 ITNIVTRNLDSEETADNILKRANKLRSTASTGSNEHSSRSHSIFIIHLRGSNSLTGEESY 590

Query: 362 RISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN---IHIPFRE 418
            I  +NLVDLAGSE I+ S     R +E  +IN+SL  LG VI++L   +    HIPFR 
Sbjct: 591 GI--LNLVDLAGSERINSSQVTGDRLRETQNINRSLSCLGDVIHALGGPDQGKRHIPFRN 648

Query: 419 SKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIK 465
           SKLT LLQ SL GN+KT +   ISP+  +  ET ++L +A+K  S K
Sbjct: 649 SKLTYLLQYSLTGNSKTLMFVNISPSANHINETINSLRFASKVNSTK 695

 Score = 68.2 bits (165), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 52/169 (30%), Positives = 79/169 (46%), Gaps = 23/169 (13%)

Query: 12  ELNIIVAVRCRGRNE-REIKAKSSVVVSVPDVAGSSEIAINTTEDV-GIAGQMNSKT--- 66
           EL   + V CR R     I++K +  + V D    +   I + E + GI    N+ T   
Sbjct: 344 ELRGKIRVYCRIRPPLPNIESKDTAHIKVEDFDDDN--GIQSMEVMKGIEVNNNNATQIP 401

Query: 67  --YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYN 124
             +  DK+F  +     +F+EV + L    + GYN  +  YG T +GKTYTM        
Sbjct: 402 QRFKFDKIFNQTDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM-------- 452

Query: 125 GELSDSAGIIPRVLFKLFDA---MEFQNDDYIIKCSFIELYNEELKDLL 170
             L    GIIP  +  +F+    ++ +   Y I C F+E+YNE + DLL
Sbjct: 453 --LRPKDGIIPSTIKHIFNWTKNLKERGWHYEIDCQFVEIYNENIIDLL 499

>Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar to
           Ashbya gossypii AGR253W
          Length = 711

 Score =  105 bits (263), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 66/166 (39%), Positives = 100/166 (60%), Gaps = 6/166 (3%)

Query: 305 IQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFT--INLYKEHDGKIFR 362
           I N+ +  +TS ++   +L+R  + R  A T+ N+ SSRSH++F   IN + +  G++  
Sbjct: 543 ITNVTKMKMTSQEQVDSMLKRASRMRSTACTRSNERSSRSHSVFMVHINGHNDQTGEVSH 602

Query: 363 ISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNI---HIPFRES 419
             K+NL+DLAGSE I+ S     R +E  +IN+SL  LG VI +L   +    HIPFR S
Sbjct: 603 -GKLNLIDLAGSERINSSLVTGDRLRETQNINKSLSCLGDVIYALNSPDAAKRHIPFRNS 661

Query: 420 KLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIK 465
           KLT LLQ SL G++KT +   I   + ++ ET ++L +A+K  S K
Sbjct: 662 KLTYLLQYSLIGDSKTLMFVNIPSDQKHTNETLNSLRFASKVNSTK 707

 Score = 70.5 bits (171), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 66/139 (47%), Gaps = 19/139 (13%)

Query: 60  GQMNSKTYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGD 119
           G+  S  +  DK+F P      +F+E+ + L    + GYN  +  YG T +GKTYTM   
Sbjct: 410 GRCFSYNFHFDKIFEPHNTNADVFQEICQ-LVQCSLDGYNVCIFAYGQTGSGKTYTM--- 465

Query: 120 ERLYNGELSDSAGIIPRVLFKLF----DAMEFQNDDYIIKCSFIELYNEELKDLLDECQA 175
                  L+   G+IP  L  +F    D ME     Y + C +IE+YNE + DLL E   
Sbjct: 466 -------LNPGDGMIPMTLSHIFQWTEDLME-HGWRYEMDCEYIEIYNETILDLLRE--- 514

Query: 176 INSTAKKLRIFDSNASQIR 194
            NS      I +S   +IR
Sbjct: 515 FNSNDNIDDILESQKHEIR 533

>Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]
           {ON} complement(235625..237718) [2094 nt, 698 aa]
          Length = 697

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 62/152 (40%), Positives = 98/152 (64%), Gaps = 4/152 (2%)

Query: 314 TSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHDGKIFRISK-MNLVDLA 372
           ++ +E  EL+QR  + R+ A T MN+ SSRSH++F + +   +     R    +NLVDLA
Sbjct: 543 SNRRELQELVQRLNKVRRTAKTAMNNRSSRSHSVFIVEVEGFNKDSEERCKGVLNLVDLA 602

Query: 373 GSENISRSG-AQNQRAKEAGSINQSLLTLGRVINSL--ADKNIHIPFRESKLTRLLQDSL 429
           GSE ++RSG    +R +E   IN+SL ++G VI++L     ++HIPFR +KLT LL+ SL
Sbjct: 603 GSERMNRSGLVDKERIEETKQINKSLSSVGDVIHALRQGSGSLHIPFRNTKLTYLLKHSL 662

Query: 430 GGNTKTALIATISPAKLNSEETCSTLEYAAKA 461
            G++KT ++ T+SP+  +  ET ++L +A K 
Sbjct: 663 QGSSKTLMLVTVSPSNSSRNETMNSLRFATKV 694

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 59/115 (51%), Gaps = 14/115 (12%)

Query: 64  SKTYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLY 123
           S  +  DK+F    + R +F EV E L    + G+N  +  YG T +GKTYTM       
Sbjct: 405 SVNFQFDKIFNYDESNRQVFGEVKE-LVQSALDGHNVCIFTYGQTGSGKTYTM------- 456

Query: 124 NGELSDSAGIIPRVLFKLFD---AMEFQNDDYIIKCSFIELYNEELKDLLDECQA 175
              L++  GIIP  L  + D   +M+     Y +K  F+E+YN+ + DLL++ + 
Sbjct: 457 ---LNEEDGIIPSTLDHIIDWTSSMKKLGWQYGLKIKFVEIYNDRIFDLLNDGKG 508

>NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa]
           {ON} Anc_3.479
          Length = 763

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 69/155 (44%), Positives = 93/155 (60%), Gaps = 13/155 (8%)

Query: 322 LLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD---GKIFRISKMNLVDLAGSENIS 378
           +L+R  + R  AST  N+ SSRSH+IF I+L   ++    K + I  +NLVDLAGSE I+
Sbjct: 603 ILRRANKLRSTASTLSNEHSSRSHSIFIIHLKGTNEITGEKSYGI--LNLVDLAGSERIN 660

Query: 379 RSGAQNQRAKEAGSINQSLLTLGRVINSLAD--------KNIHIPFRESKLTRLLQDSLG 430
            S    +R +E  +IN+SL  LG VI++L          K  HIPFR SKLT LLQ SL 
Sbjct: 661 SSQVTGERLRETQNINRSLSCLGDVIHALTGSEKDKENAKKRHIPFRNSKLTYLLQYSLI 720

Query: 431 GNTKTALIATISPAKLNSEETCSTLEYAAKAKSIK 465
           GN+KT +   ISP+     ET ++L +A+K  S K
Sbjct: 721 GNSKTLMFVNISPSINYVNETLNSLRFASKVNSAK 755

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 55/107 (51%), Gaps = 14/107 (13%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  DK+F  +     +F+EV + L    + GYN  +  YG T +GKTYTM          
Sbjct: 453 FKFDKIFNQNETNDDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 501

Query: 127 LSDSAGIIPRVLFKLFDA---MEFQNDDYIIKCSFIELYNEELKDLL 170
           L    GIIP  +  +F+    ++ +   Y I+C F+E+YNE + DLL
Sbjct: 502 LHPKDGIIPATISHIFNWTNNLKERGWKYEIECEFVEIYNENIVDLL 548

>Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON}
           (11880..13742) [1863 nt, 621 aa]
          Length = 620

 Score =  103 bits (258), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 94/319 (29%), Positives = 159/319 (49%), Gaps = 50/319 (15%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKE-- 355
           D   G+ +  L E    S +E +  ++ G ++R+ +ST  N  SSRSH I  I L     
Sbjct: 226 DPNYGVRVIGLTEKRCQSHEELLNWIKLGDKHRKTSSTDFNTRSSRSHAIILIRLISSDL 285

Query: 356 HDGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK----- 410
             G++   S ++L DLAGSE ++   AQ++R +E   IN+SLL LG VI+ L+ +     
Sbjct: 286 SSGEVV-TSTLSLCDLAGSERVT---AQHERRQEGSFINKSLLALGTVISKLSAEVNNST 341

Query: 411 ----NIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKN 466
               N HIP+R+SKLTR+LQ +L GN+    I TI  +   + E+ +TL +A++AK++  
Sbjct: 342 ESVNNSHIPYRDSKLTRILQPALSGNSIVTTICTIDTSVDATNESVNTLRFASRAKNVSL 401

Query: 467 KPQLGSIIT-------KDILVKNIASELAKVKADLLSTKSRDGV------------YMSQ 507
                S I+       KD +++++  +L + K  + + ++   +            Y   
Sbjct: 402 HVVKKSSISAYDANDQKDRIIESLVQQLQEQKIKIEAMENNYNINSFGDNETITSSYDPS 461

Query: 508 IHYKELTNDLESYKTEVQECKRVIDGLTTQNGLLLKDKKASN-------EVHNLQKIKLQ 560
           +   E  N +  YK E   C+R++D  T +    L DK+ +N       E+  L + K Q
Sbjct: 462 VALLENENKILRYKLE--HCERLLDKDTNE----LHDKEIANIADILPLEIGMLLETKFQ 515

Query: 561 SMKDSISHLH---DSIEKQ 576
            ++  I       D++EK+
Sbjct: 516 GLESQIREFKNYTDNLEKE 534

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 62/109 (56%), Gaps = 12/109 (11%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           YT D VF P A+   ++    +PL +    G+N TV  YGMT +GKTYTM+G        
Sbjct: 104 YTYDNVFHPDASNFDVYAATCKPLIDKLFDGFNSTVFAYGMTGSGKTYTMSG-------- 155

Query: 127 LSDSAGIIP----RVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLD 171
           +  +AG+IP     +  K+FD+   +N  Y    S++E+YNE++ DLL+
Sbjct: 156 VDGNAGLIPLSVAYMYSKIFDSTIHENKKYDTLVSYLEIYNEKIYDLLE 204

>KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 690

 Score =  103 bits (257), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 93/152 (61%), Gaps = 14/152 (9%)

Query: 322 LLQRGLQYRQVASTKMNDFSSRSHTIFTINLY-------KEHDGKIFRISKMNLVDLAGS 374
           +L+   + + +A+T  N+ SSRSH++FTI ++       +  DG       +NLVDLAGS
Sbjct: 541 VLRTANKTKSIAATNSNERSSRSHSVFTIRIHGTNSITGEASDGV------LNLVDLAGS 594

Query: 375 ENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNI-HIPFRESKLTRLLQDSLGGNT 433
           E I  S     R +E  +IN+SL  LG VI +L  K++ HIPFR SKLT LLQ SL G++
Sbjct: 595 ERIDTSNVTGDRLRETQNINKSLSCLGDVIYALNGKDMKHIPFRNSKLTYLLQYSLIGDS 654

Query: 434 KTALIATISPAKLNSEETCSTLEYAAKAKSIK 465
           KT +   +SP+  + +ET ++L +A+K  S K
Sbjct: 655 KTLMFVNVSPSSNHVKETLNSLRFASKVNSTK 686

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 54/160 (33%), Positives = 80/160 (50%), Gaps = 21/160 (13%)

Query: 14  NIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVDKVF 73
           NI V  R R   E E++  S + VS  D         N ++ + I+ +  +  +  DKVF
Sbjct: 358 NIRVYCRIRPPLENEVQDISHIHVSNFDNR-------NGSQAIEISNEDRNSRFLFDKVF 410

Query: 74  GPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDSAGI 133
             +A+ R +FEEV + L    + GYN  +  YG T +GKTYTM          ++D  G+
Sbjct: 411 SSNASNRDVFEEVGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM----------MNDPDGV 459

Query: 134 IPRVLFKLFDAMEF---QNDDYIIKCSFIELYNEELKDLL 170
           IP  L  +FD       +  DY  +  FIE+YNE++ DLL
Sbjct: 460 IPMTLDHIFDWTHLLKERGWDYSFEAQFIEIYNEQIVDLL 499

>TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {ON}
           Anc_3.479 YPR141C
          Length = 724

 Score =  103 bits (256), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 92/150 (61%), Gaps = 8/150 (5%)

Query: 322 LLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHDGKIFRISK---MNLVDLAGSENIS 378
           +L++  + R  A+T  N+ SSRSH++F I  Y +   +I   S    +NLVDLAGSE ++
Sbjct: 571 VLKKATKLRATAATNSNERSSRSHSVFMI--YLKGKNEITGDSSEGILNLVDLAGSERLN 628

Query: 379 RSGAQNQRAKEAGSINQSLLTLGRVINSLADKN---IHIPFRESKLTRLLQDSLGGNTKT 435
            S A   R +E  +IN+SL  LG VI++L   +    HIPFR SKLT LLQ SL G++KT
Sbjct: 629 SSQAVGARLRETQNINKSLSCLGDVIHALGQNDNTKRHIPFRNSKLTYLLQYSLTGSSKT 688

Query: 436 ALIATISPAKLNSEETCSTLEYAAKAKSIK 465
            +   ISP K +  ET ++L +A+K  S K
Sbjct: 689 LMFVNISPTKSHLNETINSLRFASKVNSTK 718

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 59/110 (53%), Gaps = 14/110 (12%)

Query: 64  SKTYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLY 123
           S+ Y  D++F  + +   +F+E+ + L    + G+N  +  YG T +GKTYTM       
Sbjct: 427 SQIYKFDRIFDQADSNTEVFKEIGQ-LVQSSLDGHNVCIFAYGQTGSGKTYTM------- 478

Query: 124 NGELSDSAGIIPRVLFKLFDAMEFQNDD---YIIKCSFIELYNEELKDLL 170
              L+D+ G+IP  +  +FD  E   +    Y I C FIE+YNE + DLL
Sbjct: 479 ---LNDNDGMIPATISHIFDWTESMKEKGWIYDISCQFIEIYNEGIIDLL 525

>YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON}
           KAR3Minus-end-directed microtubule motor that functions
           in mitosis and meiosis, localizes to the spindle pole
           body and localization is dependent on functional Cik1p,
           required for nuclear fusion during mating; potential
           Cdc28p substrate
          Length = 729

 Score =  103 bits (256), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 89/148 (60%), Gaps = 4/148 (2%)

Query: 322 LLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEH-DGKIFRISKMNLVDLAGSENISRS 380
           +L++  + R  AST  N+ SSRSH+IF I+L   +          +NLVDLAGSE I+ S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSERINVS 636

Query: 381 GAQNQRAKEAGSINQSLLTLGRVINSLADKNI---HIPFRESKLTRLLQDSLGGNTKTAL 437
                R +E  +IN+SL  LG VI++L   +    HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 438 IATISPAKLNSEETCSTLEYAAKAKSIK 465
              ISP+  +  ET ++L +A+K  S +
Sbjct: 697 FVNISPSSSHINETLNSLRFASKVNSTR 724

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 76/163 (46%), Gaps = 17/163 (10%)

Query: 12  ELNIIVAVRCRGRNE-REIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVD 70
           EL   + V CR R   + ++   + +++V +   +S   + + E   I        +  D
Sbjct: 382 ELRGNIRVYCRIRPALKNLENSDTSLINVNEFDDNS--GVQSMEVTKIQNTAQVHEFKFD 439

Query: 71  KVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDS 130
           K+F        +F+EV + L    + GYN  +  YG T +GKT+TM          L+  
Sbjct: 440 KIFDQQDTNVDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM----------LNPG 488

Query: 131 AGIIPRVL---FKLFDAMEFQNDDYIIKCSFIELYNEELKDLL 170
            GIIP  +   F   + ++ +  DY + C FIE+YNE + DLL
Sbjct: 489 DGIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLL 531

>Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {ON}
           YPR141C (REAL)
          Length = 731

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 90/148 (60%), Gaps = 4/148 (2%)

Query: 322 LLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHDGKIFR-ISKMNLVDLAGSENISRS 380
           +L+R  + R  AST  N+ SSRSH+IF I+L   +     +    +NLVDLAGSE I+ S
Sbjct: 576 VLKRANKLRSTASTASNEHSSRSHSIFIIHLSGLNAKTGAQSYGTLNLVDLAGSERINIS 635

Query: 381 GAQNQRAKEAGSINQSLLTLGRVINSLADKNI---HIPFRESKLTRLLQDSLGGNTKTAL 437
                R +E  +IN+SL  LG VI++L   +    HIPFR SKLT LLQ SL G++KT +
Sbjct: 636 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSAKRHIPFRNSKLTYLLQYSLTGDSKTLM 695

Query: 438 IATISPAKLNSEETCSTLEYAAKAKSIK 465
              ISP+  +  ET ++L +A+K  S +
Sbjct: 696 FVNISPSSSHINETLNSLRFASKVNSTR 723

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 54/107 (50%), Gaps = 14/107 (13%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  DK+F        +F+EV + L    + GYN  +  YG T +GKT+TM          
Sbjct: 436 FKFDKIFDQRNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 484

Query: 127 LSDSAGIIPRVL---FKLFDAMEFQNDDYIIKCSFIELYNEELKDLL 170
           L+   GIIP  +   F   + ++ +  DY + C FIE+YNE + DLL
Sbjct: 485 LNPGDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL 531

>Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 90/148 (60%), Gaps = 4/148 (2%)

Query: 322 LLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHDGKIFR-ISKMNLVDLAGSENISRS 380
           +L++  + R  AST  N+ SSRSH+IF I+L   +     +    +NLVDLAGSE I+ S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFMIHLSGSNAKTGAQSYGTLNLVDLAGSERINIS 636

Query: 381 GAQNQRAKEAGSINQSLLTLGRVINSLADKNI---HIPFRESKLTRLLQDSLGGNTKTAL 437
                R +E  +IN+SL  LG VI++L   +    HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 438 IATISPAKLNSEETCSTLEYAAKAKSIK 465
              ISP+  +  ET ++L +A+K  S +
Sbjct: 697 FVNISPSSSHINETLNSLRFASKVNSTR 724

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 55/109 (50%), Gaps = 18/109 (16%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTM--TGDERLYN 124
           +  DK+F        +F+EV + L    + GYN  +  YG T +GKT+TM  TGD     
Sbjct: 436 FKFDKIFDQQNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTMLNTGD----- 489

Query: 125 GELSDSAGIIPRVL---FKLFDAMEFQNDDYIIKCSFIELYNEELKDLL 170
                  GIIP  +   F   + ++ +  DY + C FIE+YNE + DLL
Sbjct: 490 -------GIIPSTISHIFSWINKLKTKGWDYKVNCEFIEIYNENIVDLL 531

>Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 90/148 (60%), Gaps = 4/148 (2%)

Query: 322 LLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHDGKIFR-ISKMNLVDLAGSENISRS 380
           +L++  + R  AST  N+ SSRSH+IF I+L   +     +    +NLVDLAGSE I+ S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNTKTGAQSYGTLNLVDLAGSERINIS 636

Query: 381 GAQNQRAKEAGSINQSLLTLGRVINSLADKNI---HIPFRESKLTRLLQDSLGGNTKTAL 437
                R +E  +IN+SL  LG VI++L   +    HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 438 IATISPAKLNSEETCSTLEYAAKAKSIK 465
              ISP+  +  ET ++L +A+K  S +
Sbjct: 697 FVNISPSSSHINETLNSLRFASKVNSTR 724

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 74/163 (45%), Gaps = 17/163 (10%)

Query: 12  ELNIIVAVRCRGRNERE-IKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVD 70
           EL   + V CR R   E ++   + +++V +        I + E   I        +  D
Sbjct: 382 ELRGNIRVYCRIRPALETLEDSDTSLINVNEF--DDNCGIQSMEVTKIHNTAQVHEFKFD 439

Query: 71  KVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDS 130
           K+F        +F+EV + L    + GYN  +  YG T +GKT+TM          L+  
Sbjct: 440 KIFDQKDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM----------LNPG 488

Query: 131 AGIIPRVL---FKLFDAMEFQNDDYIIKCSFIELYNEELKDLL 170
            GIIP  +   F   + ++ +  DY + C FIE+YNE + DLL
Sbjct: 489 DGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL 531

>KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {ON}
           Anc_8.678 YPL155C
          Length = 658

 Score =  101 bits (252), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 77/228 (33%), Positives = 114/228 (50%), Gaps = 38/228 (16%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEH- 356
           D + G+ I  L E    +++E ++ ++ G   R+ + T+ N  SSRSH +  + L   + 
Sbjct: 262 DLEYGVKITGLNEERCDTSQELMKWIKYGDSNRKTSETEYNLRSSRSHAVILVRLVTHNV 321

Query: 357 -DGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA------- 408
            DG     S + L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+       
Sbjct: 322 IDGSKTS-STLTLCDLAGSE---RAAGQQERRKEGAFINKSLLALGTVISKLSAESLSNS 377

Query: 409 -----------------DKNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEET 451
                            + N HIP+R+SKLTRLLQ +L GN+    I TI P      ET
Sbjct: 378 KHVSNPMGPPASPSLNSNGNNHIPYRDSKLTRLLQPALSGNSAVTTICTIDPRMETYAET 437

Query: 452 CSTLEYAAKAKSIK----NKPQLGSI----ITKDILVKNIASELAKVK 491
            +TL +A++AK++      K  L +I    + KD ++K +   L K K
Sbjct: 438 INTLRFASRAKNVSLRFNIKKNLSTISKSEVEKDKIIKELTFRLEKQK 485

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/112 (37%), Positives = 63/112 (56%), Gaps = 9/112 (8%)

Query: 63  NSKTYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERL 122
           N+  Y  D VF P  +   I++  A PL +    G+N T+  YGMT +GKTYTM GD   
Sbjct: 129 NNDEYKFDHVFSPHVDNFEIYKTTAIPLIDKLFTGFNATLFCYGMTGSGKTYTMMGDNE- 187

Query: 123 YNGELSDSAGIIPRVLFKLFD-AMEFQND-DYIIKCSFIELYNEELKDLLDE 172
                 +  GI+P  +  LF+  +  +ND  Y +  S++E+YNE++ DLLD+
Sbjct: 188 ------NPDGIVPLSVSLLFNQVLNSRNDKKYDVILSYLEIYNEKIYDLLDD 233

>ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 731

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 90/153 (58%), Gaps = 14/153 (9%)

Query: 322 LLQRGLQYRQVASTKMNDFSSRSHTIFTI------NLYKEHDGKIFRISKMNLVDLAGSE 375
           LL++  + R  AST  N+ SSRSH++F I      +L  E    I     +NLVDLAGSE
Sbjct: 566 LLRKANRLRSTASTSANERSSRSHSVFIIFLKGSNHLTGEQSDGI-----LNLVDLAGSE 620

Query: 376 NISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNI---HIPFRESKLTRLLQDSLGGN 432
            I+ S    +R +E  +IN+SL  LG V+++L   +    HIPFR SKLT LLQ SL GN
Sbjct: 621 RINSSQVLGERLRETQNINKSLSCLGDVVHALGSNDAAKRHIPFRNSKLTYLLQYSLTGN 680

Query: 433 TKTALIATISPAKLNSEETCSTLEYAAKAKSIK 465
           +KT +   IS  + +  ET ++L +A+K  S K
Sbjct: 681 SKTLMFVNISACESHLNETLNSLRFASKVNSTK 713

 Score = 71.6 bits (174), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 82/174 (47%), Gaps = 24/174 (13%)

Query: 12  ELNIIVAVRCRGRNEREIKAKSSVVVSV---PDVAGSSEIAINTTEDVGIAGQMNSKTYT 68
           EL   + V CR R   + +  ++  ++V    D  G   + I  + + G +   N   + 
Sbjct: 373 ELRGNIRVFCRIRPPLKYENPNTAHLTVNKFDDENGCQTMEIVKSNNTGNSIPQN---FK 429

Query: 69  VDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELS 128
            D++F  +     +FEE+ + L    + GYN  +  YG T +GKTYTM          L+
Sbjct: 430 FDRIFDQNETNENVFEEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM----------LN 478

Query: 129 DSAGIIPRVLFKLFDAMEF---QNDDYIIKCSFIELYNEELKDLL----DECQA 175
              GIIP  +  +F  +E    +  +Y I C FIE+YNE + DLL    D+ QA
Sbjct: 479 PRNGIIPATISHIFSWIENLKERGWNYEINCQFIEIYNENIADLLRSDQDDIQA 532

>Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C
           (KIP2) - kinesin-related protein [contig 68] FULL
          Length = 715

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 128/250 (51%), Gaps = 20/250 (8%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLY-KEH 356
           D + G+ +  L E  + S+++ ++ +  G   R+   T  N  SSRSH I T+NL   + 
Sbjct: 273 DSKHGVRVMGLTEQRVYSSEDVLKWISLGDTNRRTGETDYNTRSSRSHAIVTLNLACTDL 332

Query: 357 DGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK------ 410
                  S ++L DLAGSE   R+  Q++R KE   IN+SLL LG VI+ L+        
Sbjct: 333 VSGAETTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSASSMHTTP 389

Query: 411 ---NIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSI--- 464
              N HIP+R+SKLTR+LQ +L G +    I TI        ET +T+ +A++AK++   
Sbjct: 390 SFGNSHIPYRDSKLTRILQPALSGESIVTTICTIDTRLDAMSETVNTIRFASRAKNVSMT 449

Query: 465 --KNKPQLGSIITKDILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKT 522
             +N+ +L     KD L+ N+  +L + +  +   K              L  + ++ K 
Sbjct: 450 VKRNEAELAH--EKDALIHNLRRQLDEQQELIWELKRNQEKCEQTPDLYLLRKESDALKR 507

Query: 523 EVQECKRVID 532
           ++Q C+R++D
Sbjct: 508 KLQLCERLLD 517

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 61/109 (55%), Gaps = 11/109 (10%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  D VF P +N   +++++ +P+ +   +GYN  +  YGMT +GKT+TM+G        
Sbjct: 139 FKFDNVFRPQSNNYEVYQQIGKPMIDRLFQGYNAIIFAYGMTGSGKTFTMSGT------- 191

Query: 127 LSDSAGIIPRVLFKLFDAM---EFQNDDYIIKCSFIELYNEELKDLLDE 172
             + AG+I   +  +F  +      N  + +  S++E+YNE++ DLL++
Sbjct: 192 -PEEAGLISLSVEHIFAQIMSESLANKSFQVTVSYLEIYNEKIYDLLNQ 239

>KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 668

 Score =  100 bits (250), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 66/176 (37%), Positives = 103/176 (58%), Gaps = 13/176 (7%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLY--KE 355
           D + G+ +  L E +++S KE ++ +  G   R+   T  N  SSRSH +  I ++   E
Sbjct: 231 DLKYGVKVVGLVERNVSSNKELMKCISIGDHNRKTGETDFNTRSSRSHAVVLIRVFCTDE 290

Query: 356 HDGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA------D 409
             G+   +S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+       
Sbjct: 291 ITGEQV-MSTLSLCDLAGSE---RATGQQERRKEGAYINKSLLALGTVISKLSMESSGLS 346

Query: 410 KNI-HIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSI 464
            N+ HIP+R+SKLTR+LQ +L G++  A I T+      S E+ +T+ +A++AK+I
Sbjct: 347 TNVGHIPYRDSKLTRILQPALSGDSLVATICTVDTRPETSTESINTIRFASRAKNI 402

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 60/111 (54%), Gaps = 10/111 (9%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  D VF P  N   ++E +A P+ +    G+NCT+  YGMT +GKTYTM+G +      
Sbjct: 106 FNFDHVFSPEMNNDRVYETMALPMIDKLFEGFNCTIFAYGMTGSGKTYTMSGSK------ 159

Query: 127 LSDSAGIIPRVLFKLFDAME--FQNDDYIIKCSFIELYNEELKDLLDECQA 175
                GIIP  +  +FD +        + ++ S++E+YNE + DLL+  Q 
Sbjct: 160 --SGPGIIPMCVDTIFDRINVGLPRKKFTVRVSYLEIYNERIFDLLNLPQG 208

>TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.678
           YPL155C
          Length = 696

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 65/187 (34%), Positives = 103/187 (55%), Gaps = 23/187 (12%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYK-EH 356
           D Q GI +  L E   +S  + ++ ++ G + ++++ T+ N  SSRSH+I  + L   + 
Sbjct: 244 DAQYGIKVVGLSEHRCSSKDDLMKWVRIGDKNKKISETEYNSRSSRSHSILLVRLIATDL 303

Query: 357 DGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK------ 410
           +  I   S ++L DLAGSE   ++ +Q +R KE   IN+SLL LG VI  L+ +      
Sbjct: 304 ETGIVTTSTLSLCDLAGSE---KATSQQERRKEGAFINKSLLALGTVIAKLSSESNQHRN 360

Query: 411 -------------NIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEY 457
                        N HIP+R+SKLTR+LQ +L GN+    I T+      S ET +TL +
Sbjct: 361 ADNVNHQETSNPNNSHIPYRDSKLTRILQPALSGNSIITTICTVDIRSDASSETLNTLRF 420

Query: 458 AAKAKSI 464
           A++AK++
Sbjct: 421 ASRAKNV 427

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 82/161 (50%), Gaps = 31/161 (19%)

Query: 15  IIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVDKVFG 74
           IIVA+R +  +  E K        V ++  +  IA    +DVG         + +D++F 
Sbjct: 76  IIVAIRPKPISNNEKK--------VWNIVDNKRIA---HDDVG--------EFRLDRIFD 116

Query: 75  PSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDSAGII 134
              +   I+ E+ +PL +    GYN T+  YGMT +GKT+TM+G +        +  G+I
Sbjct: 117 CDVSNLEIYSELCKPLIDKLAMGYNATLFAYGMTGSGKTFTMSGTQ--------EDTGLI 168

Query: 135 PRVLFKLFDAMEFQN----DDYIIKCSFIELYNEELKDLLD 171
           P  +  LF+ +  +N      Y +  S++E+YNE+L DLLD
Sbjct: 169 PLSISHLFNTINEENLLGKKKYEMLVSYMEIYNEKLYDLLD 209

>ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 654

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 71/194 (36%), Positives = 103/194 (53%), Gaps = 21/194 (10%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357
           D + G+ I  L E    S+ E ++ ++ G + R+   T  N  SSRSH I  I L K   
Sbjct: 257 DSKYGVKIVGLTERRCESSDELLKWIRIGDKSRKTGETTYNTRSSRSHAIVMIRLTKTDL 316

Query: 358 GKIFRISK-MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNI---- 412
            +   +S  ++L DLAGSE   ++   N+R KE   IN+SLL LG VI+ L+ ++     
Sbjct: 317 KEGTSVSSTLSLCDLAGSE---KAVTHNERRKEGAFINKSLLALGTVISKLSAESTSHRN 373

Query: 413 ---------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKS 463
                    HIP+R+SKLTR+LQ +L GN     I TI      S ET +TL +A++AK+
Sbjct: 374 GGSSSPVTGHIPYRDSKLTRILQPALSGNGVVTTICTIDTRPDASSETLNTLRFASRAKN 433

Query: 464 IK----NKPQLGSI 473
           +      KP L S+
Sbjct: 434 VSLHIFRKPLLPSM 447

 Score = 70.9 bits (172), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 39/112 (34%), Positives = 62/112 (55%), Gaps = 13/112 (11%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  D VF  + N   ++ + ++P+ +    G N TV  YGMT +GKT+TM G E      
Sbjct: 122 FKYDHVFKTACNNVEVYAQTSKPMIDRVFEGLNATVFAYGMTGSGKTFTMAGTE------ 175

Query: 127 LSDSAGIIPRVLFKLFD-AME--FQNDD-YIIKCSFIELYNEELKDLLDECQ 174
             ++ G+IP  +  L+   ME   Q D  + I  S++E+YNE++ DLLD C+
Sbjct: 176 --ETLGLIPLSVAYLYSRVMEESLQGDSRFEIAVSYLEIYNEKIYDLLD-CE 224

>SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {ON}
           similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155C KIP2 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 657

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 79/269 (29%), Positives = 142/269 (52%), Gaps = 29/269 (10%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINL-YKEH 356
           D + G+ +  L E  + ++++ ++ +  G   R+   T  N  SSRSH I  I L   + 
Sbjct: 268 DSKYGVKVIGLTEQEVDTSEDVMKWIALGNSNRKTGETDFNSRSSRSHAIVLIRLTCTDL 327

Query: 357 DGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNI---- 412
              +   S ++L DLAGSE   R+ AQ +R KE   IN+SLL LG VI+ L+ ++     
Sbjct: 328 KSGLETTSTLSLCDLAGSE---RATAQRERRKEGAFINKSLLALGTVISKLSAESTQNMG 384

Query: 413 -----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSI--- 464
                HIP+R+SKLTR+LQ +L G+     I T+     +S ET +T+ +A++AK+I   
Sbjct: 385 VGGGHHIPYRDSKLTRILQPALSGDGIVTTICTVDAHAESSAETINTIRFASRAKNISLV 444

Query: 465 --KNKPQLGSIITKDILVKNIASELAKVKADLLSTKSRDG-VYMSQIHYKELTNDLES-- 519
             +N+  + +   KD +++N+  +L +    +   KS +G    +     E    L+S  
Sbjct: 445 VKRNEMDISN--EKDHIIENLRRQLEQQNETIAVLKSNNGTCRTTDAGASEDALSLQSEN 502

Query: 520 --YKTEVQECKRVIDGLTTQNGLLLKDKK 546
              K  ++ C++++D    ++ ++L+D++
Sbjct: 503 KVLKLRLEHCEKLLD----KDSMILQDQE 527

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 62/108 (57%), Gaps = 11/108 (10%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           ++ D VF P+ +   ++EE A P+     +G+N T+  YGMT +GKT+TM+G        
Sbjct: 147 FSFDHVFHPTNDNFAVYEETARPMIEKLFQGFNSTIFAYGMTGSGKTFTMSGT------- 199

Query: 127 LSDSAGIIPRVLFKLFD---AMEFQNDDYIIKCSFIELYNEELKDLLD 171
            S+  G+IP  +  +F    +    N  + +K S++E+YNE++ DLL+
Sbjct: 200 -SNEPGLIPLSVNDIFSNIMSKSLNNQRFDVKVSYLEIYNEKIYDLLN 246

>NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score = 97.4 bits (241), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 72/196 (36%), Positives = 101/196 (51%), Gaps = 33/196 (16%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKE-- 355
           D + G+ +  L E    S++E +  + +G + R+ A T  N  SSRSH I  I L     
Sbjct: 276 DSKYGVRVIGLTEKRCESSEELMNWIIKGDKIRKTAETDFNARSSRSHAIVLIRLTTSDM 335

Query: 356 HDGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA---DKNI 412
            DG     S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+   +KN 
Sbjct: 336 KDGTSIS-STLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSTESNKNR 391

Query: 413 ------------------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNS 448
                                   HIP+R+SKLTRLLQ +L G++    I TI     +S
Sbjct: 392 SPTLPSPPLSSSSSSTSINSSVPGHIPYRDSKLTRLLQPALSGDSIVTTICTIDTKNESS 451

Query: 449 EETCSTLEYAAKAKSI 464
            ET +TL +A++AK+I
Sbjct: 452 AETLNTLRFASRAKNI 467

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 57/110 (51%), Gaps = 9/110 (8%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  D VF    +   I++ +  P+ +   +G+N T+  YGMT +GKTYTM G       E
Sbjct: 137 FKFDHVFNSFVSNLEIYQVINRPMIDKLFQGFNSTIFAYGMTGSGKTYTMMGCP-----E 191

Query: 127 LSDSAGIIPRVLFKLFDAMEFQNDD----YIIKCSFIELYNEELKDLLDE 172
                G+IP  +  LF  +  +  D    + I  S++E+YNE++ DLL +
Sbjct: 192 REQKDGLIPLSVSYLFTKIMEETLDGDKKFEIVLSYLEIYNEKIYDLLGD 241

>CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa]
           {ON} similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155c KIP2 kinesin-related protein
          Length = 672

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 66/193 (34%), Positives = 103/193 (53%), Gaps = 29/193 (15%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLY-KEH 356
           D + G+ +  L +    +++E ++ + +G + R+ + T+ N  SSRSH I  I L  K+ 
Sbjct: 264 DSECGVRVVGLTQKRCDTSEEVLDWINKGNKNRKTSETEFNTRSSRSHAIVMIRLISKDI 323

Query: 357 DGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNI---- 412
                 I  ++L DLAGSE   R   QN+R KE   IN+SLL LG VI+ L+ +N     
Sbjct: 324 RTGEQNIRTLSLCDLAGSE---RGVGQNERRKEGAFINRSLLALGTVISRLSAENNGSHH 380

Query: 413 ---------------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEET 451
                                HIP+R+SKLTRLLQ +L G++    + TI  A  +S ET
Sbjct: 381 TGRAANSQQSLASPNGSSSGNHIPYRDSKLTRLLQPALSGDSVVVALCTIDLAHESSSET 440

Query: 452 CSTLEYAAKAKSI 464
            +TL +A+++K++
Sbjct: 441 LNTLRFASRSKNV 453

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 66/126 (52%), Gaps = 12/126 (9%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +T D VF    +   I+ +  +PL +  I GYN T+  YGMT +GKT+TM+G E      
Sbjct: 133 FTFDHVFSTGCSNFDIYGKTTQPLIDRLIEGYNATIFAYGMTGSGKTFTMSGTE------ 186

Query: 127 LSDSAGIIPRVLFKLFDAM----EFQNDDYIIKCSFIELYNEELKDLLDECQAINSTAKK 182
             +  G+IP  +  LF ++      +N+   +  S++E+YNE++ DLLD     N     
Sbjct: 187 --EEKGLIPLSVSYLFSSLLEKTNTENEKSEVWVSYLEIYNEKINDLLDVASGSNVQNTP 244

Query: 183 LRIFDS 188
            R+F S
Sbjct: 245 SRLFTS 250

>YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON}
           KIP2Kinesin-related motor protein involved in mitotic
           spindle positioning, stabilizes microtubules by
           targeting Bik1p to the plus end; Kip2p levels are
           controlled during the cell cycle
          Length = 706

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 71/199 (35%), Positives = 100/199 (50%), Gaps = 35/199 (17%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEH- 356
           D Q G+ +  L E    S++E +  +  G + R++  T  N  SSRSH I  I L   + 
Sbjct: 298 DSQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTNV 357

Query: 357 DGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-ADK----- 410
                R S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK     
Sbjct: 358 KNGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKMNSVG 414

Query: 411 -NI------------------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAK 445
            NI                        HIP+R+SKLTRLLQ +L G++    I T+    
Sbjct: 415 SNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRN 474

Query: 446 LNSEETCSTLEYAAKAKSI 464
             + ET +TL +A++AK++
Sbjct: 475 DAAAETMNTLRFASRAKNV 493

 Score = 71.6 bits (174), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 79/147 (53%), Gaps = 22/147 (14%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  D VF        ++E  ++P+ +  + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 127 LSDSAGIIPRVLFKLFDAMEFQ--NDD--YIIKCSFIELYNEELKDL----LDECQAINS 178
           L    G+IP  +  LF  +  Q  N D  + +  S++E+YNE + DL    L+E  +  S
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLLESGLEESGSRIS 274

Query: 179 TAKKLRIFDSNAS------QIRKVSEY 199
           T  +L +  SN++      +IR  S+Y
Sbjct: 275 TPSRLYMSKSNSNGLGVELKIRDDSQY 301

>ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL155C (KIP2)
          Length = 685

 Score = 94.0 bits (232), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 82/274 (29%), Positives = 135/274 (49%), Gaps = 43/274 (15%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357
           D + G+ + +L E  ++S ++ ++ +  G + R+   T  N  SSRSH I  + L + +D
Sbjct: 270 DSKYGVKVVDLTEQLVSSHEDVMKWIATGDRNRKTGETDFNTRSSRSHAIVLLRLTR-YD 328

Query: 358 GKIFR--ISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA------- 408
            K      S ++L DLAGSE   R+  Q  R KE   IN+SLL LG VI  L+       
Sbjct: 329 LKTGSEATSTLSLCDLAGSE---RAVTQIVRRKEGAFINKSLLALGTVIAKLSMLGSQAN 385

Query: 409 -----DKNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKS 463
                    HIP+R+SKLTR+LQ +L G++    I TI     +S ET +T+ +A++AK+
Sbjct: 386 GLQPSPAAGHIPYRDSKLTRILQPALTGDSIITTICTIDSKAESSTETTNTVRFASRAKN 445

Query: 464 IK---NKPQLGSIITKDILVKNIASEL-------------AKVKADLLSTKSRDGVYMSQ 507
           I     K ++ S   KD +++N+  +L             A   +   ST   D   +  
Sbjct: 446 IALNVRKNEMDSHAEKDTIIQNLRKQLDEQHETIVMLRRSAAAPSGNGSTSPLDSPGVGG 505

Query: 508 IHYKELTNDLES---------YKTEVQECKRVID 532
               E T+++E           KT+++ C++++D
Sbjct: 506 TSLSERTHNMEKGLLEVENSILKTKLEHCEKLLD 539

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 75/138 (54%), Gaps = 15/138 (10%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  D VF      + +++ +  P+ +    GYN T+  YGMT +GKT+TM+G+++     
Sbjct: 146 FQFDHVFTKGVCNQEVYQALGVPIIDKLFEGYNATIFAYGMTGSGKTFTMSGNKQ----- 200

Query: 127 LSDSAGIIPRVLFKLFDAMEFQNDD----YIIKCSFIELYNEELKDLLDEC-QAINSTAK 181
                G+IP+ +  +FD +  ++      Y +K S++E+YNE++ DLL+   +   ST +
Sbjct: 201 ---EPGLIPQCVGNIFDRISSEHHGASLAYEVKVSYLEIYNEKIYDLLNYVDRQAGSTGQ 257

Query: 182 KLRIFDSNASQIRKVSEY 199
             R  ++   +IR  S+Y
Sbjct: 258 PSR--NATGLKIRDDSKY 273

>Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {ON}
           YPL155C (REAL)
          Length = 706

 Score = 94.0 bits (232), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 99/199 (49%), Gaps = 35/199 (17%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYK-EH 356
           D + G+ +  L E    S +E +  +  G + R++  T  N  SSRSH I  I L   + 
Sbjct: 298 DSKYGVKVIGLTERRCESTEELLRWIGIGDKSRKIGETDYNTRSSRSHAIVLIRLTSTDV 357

Query: 357 DGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-------D 409
           +    R S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+       D
Sbjct: 358 NNGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTTSVD 414

Query: 410 KNI------------------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAK 445
            NI                        HIP+R+SKLTRLLQ +L G++    I T+    
Sbjct: 415 SNISTTPTGSSGSSSGSITGNSGIPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRN 474

Query: 446 LNSEETCSTLEYAAKAKSI 464
             + ET +TL +A++AK++
Sbjct: 475 DAAAETMNTLRFASRAKNV 493

 Score = 70.5 bits (171), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 61/109 (55%), Gaps = 12/109 (11%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  D VF        ++E   +P+ +  + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTGKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 127 LSDSAGIIPRVLFKLFDAMEFQNDD----YIIKCSFIELYNEELKDLLD 171
           L    G+IP  +  LF  +  Q+ D    + +  S++E+YNE + DLL+
Sbjct: 219 L----GLIPLSVSYLFSNIMEQSMDGDKKFDVIISYLEIYNERIYDLLE 263

>TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.678
           YPL155C
          Length = 468

 Score = 92.8 bits (229), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 62/169 (36%), Positives = 96/169 (56%), Gaps = 14/169 (8%)

Query: 305 IQNLKEFHIT------SAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHDG 358
           +  LKE  IT      S    +EL+ +G + R+V ST+ N  SSRSH +  + +  +  G
Sbjct: 220 LHGLKETTITLDDSEQSVSRVLELVAQGNRNRRVRSTQHNTGSSRSHAVLRLRI-TDSMG 278

Query: 359 KIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLG---RVINSLADKNIHIP 415
              R+  + L DLAGSE  S    +  RA E G+IN+SL+ LG   R++N     + H+P
Sbjct: 279 SKARV--LTLCDLAGSERASVHD-RGLRA-EGGAINKSLMALGTVVRLLNETGPSSTHVP 334

Query: 416 FRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSI 464
           +R+SKLTRLL+ SL GN    ++ T+S +  + E++  TL +A +A  +
Sbjct: 335 YRDSKLTRLLKPSLSGNGLVTMVCTVSLSGTDYEQSLGTLRFARRASGV 383

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 54/113 (47%), Gaps = 24/113 (21%)

Query: 82  IFEEVAEPLFN----DFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDSAGIIPRV 137
           IF    +PL +    D I G   T++ YG T +GKTYTM G +           GI+   
Sbjct: 122 IFVRDCKPLVHRVATDCISG---TIIAYGATGSGKTYTMHGTK--------AEGGIVQ-- 168

Query: 138 LFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTAKKLRIFDSNA 190
              + D +   + +  I  S++E+YNE L DLL  C       K+LRI D +A
Sbjct: 169 -LSIRDLLTQLSKNCQITISYLEIYNERLHDLL--CDG----TKELRILDDSA 214

>KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 678

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 97/184 (52%), Gaps = 20/184 (10%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINL-YKEH 356
           D + G+ +  L E  + S+++ +  ++ G   R+   T  N  SSRSH I TI +   E 
Sbjct: 270 DARHGVRVVGLTEQQVHSSEDVLRKIELGNSNRRTGETDYNTRSSRSHAIVTIKVTCTEL 329

Query: 357 DGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD------- 409
                  S ++L DLAGSE   R+  Q++R KE   IN+SLL LG VI+ L+        
Sbjct: 330 LSGTDTTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSAVSGASGG 386

Query: 410 ---------KNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAK 460
                     N H+P+R+SKLTR+LQ +L G++    I TI        ET +T+ +A++
Sbjct: 387 GAATPPPTFGNSHVPYRDSKLTRILQPALSGDSIVTTICTIDTKPDAMSETVNTIRFASR 446

Query: 461 AKSI 464
           AK++
Sbjct: 447 AKNV 450

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 63/108 (58%), Gaps = 11/108 (10%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  DKVF P  N   ++EE+ +P+ +   +GYN T+  YGMT +GKT+TM+G        
Sbjct: 140 FWFDKVFSPQTNNYGVYEEIGKPMIDKLFQGYNATIFAYGMTGSGKTFTMSGTR------ 193

Query: 127 LSDSAGIIPRVLFKLFDAM---EFQNDDYIIKCSFIELYNEELKDLLD 171
             D AG+I   + ++F  +      N  Y ++ S++E+YNE++ DLL+
Sbjct: 194 --DEAGLILLSVEQIFSQIMKESVNNKSYEVRVSYLEIYNEKIYDLLN 239

>KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8.678
           YPL155C
          Length = 625

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 88/304 (28%), Positives = 139/304 (45%), Gaps = 50/304 (16%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEH- 356
           D   G+ +  + E    +A+E ++ +  G   R+   T  N  SSRSH I  + L   + 
Sbjct: 238 DPVLGVKVHGVLEQKCDTAEELMKWVSVGEAVRKTGKTDYNMRSSRSHAIIQVKLITTNL 297

Query: 357 -DGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK----- 410
            +G     + ++L DLAGSE  S    Q +R KE   IN+SLL LG VI+ L+ +     
Sbjct: 298 LNGTTH-FNTLSLCDLAGSEKASE---QLERRKEGSFINKSLLALGTVISKLSAESNAHD 353

Query: 411 ----------NIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAK 460
                     N HIP+R+SKLTRLLQ +L  ++    I TI P K    ET +TL +A++
Sbjct: 354 SSRPSSGSLNNSHIPYRDSKLTRLLQPALCNDSVVTAICTIDPTKEAMTETVNTLRFASR 413

Query: 461 A---------KSIKNKP------------QLGSII-TKDILVKNIASELAKVKADLLSTK 498
           A         KSI  +P             L  ++  +D+++ N+  +     + L    
Sbjct: 414 AKNVSLNVSRKSISYRPDSQDAEKDKRVRSLTKLVEEQDLIISNLKKQQQHAGSALQRPN 473

Query: 499 SRDG-------VYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQNGLLLKDKKASNEV 551
           SR         V   ++ + E   D +S + +  +   ++D L  + G+LL+ K  S E 
Sbjct: 474 SRTALLEAENRVLRDKLQHCERLLDNDSVELQDSQIMEIVDFLPPEVGVLLETKFQSLES 533

Query: 552 HNLQ 555
            N Q
Sbjct: 534 ENRQ 537

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 55/105 (52%), Gaps = 6/105 (5%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  D VFGP+A    +F E+   L      G N T+L YG T +GKTYTM G    +N  
Sbjct: 127 FQFDHVFGPTATNEDLFAELGGGLVEKLFDGCNATLLAYGTTGSGKTYTMVG----HNDG 182

Query: 127 LSDSAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLD 171
           +    G    V  ++ +A + +     +  S++E+YNE++ DLL+
Sbjct: 183 IVKMCGDC--VFTRMLNAADERQVKRSVTVSYLEIYNEKICDLLN 225

>Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C
           (REAL)
          Length = 715

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 100/206 (48%), Gaps = 43/206 (20%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKE-- 355
           D Q G+ +  L E    S+++ +  +  G + R++  T  N  SSRSH I  I L     
Sbjct: 298 DSQYGVKVIGLTERRCESSEDLLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTDV 357

Query: 356 HDGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-ADK---- 410
            DG   R S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK    
Sbjct: 358 RDG-TSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTNSV 413

Query: 411 --------------------------------NIHIPFRESKLTRLLQDSLGGNTKTALI 438
                                           + HIP+R+SKLTRLLQ +L G++    I
Sbjct: 414 GSIIPTTPTSSGNSSSSSSSSSGSIVSNSNTSSNHIPYRDSKLTRLLQPALSGDSIVTTI 473

Query: 439 ATISPAKLNSEETCSTLEYAAKAKSI 464
            T+      + ET +TL +A++AK++
Sbjct: 474 CTVDTRNDAAAETMNTLRFASRAKNV 499

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 63/109 (57%), Gaps = 12/109 (11%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  D VF        ++E+ ++P+ +  + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYEKTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 127 LSDSAGIIPRVLFKLFDAMEFQ--NDD--YIIKCSFIELYNEELKDLLD 171
           L    G+IP  +  LF  +  Q  N D  + +  S++E+YNE + DLL+
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVVISYLEIYNERIYDLLE 263

>Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}
           similar to Ashbya gossypii ACR145W
          Length = 687

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 70/210 (33%), Positives = 109/210 (51%), Gaps = 23/210 (10%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYK-EH 356
           D + G+ + +L E  + S  E I+ +  G + R+   T  N  SSRSH I  + L + E 
Sbjct: 271 DSKYGVKVVDLTEQQVESHGEVIKWIAAGDKNRKTGETDFNSRSSRSHAIVLLRLTRCEL 330

Query: 357 DGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNI---- 412
                  S ++L DLAGSE   R+  Q  R KE   IN+SLL LG VI  L+  +     
Sbjct: 331 KTGTEVTSTLSLCDLAGSE---RAVTQLVRRKEGAFINKSLLALGTVIAKLSANSAGSGS 387

Query: 413 ------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAK 460
                       HIP+R+SKLTR+LQ +L G++    I TI     ++ ET +T+ +A++
Sbjct: 388 GSNGQPPSAMGGHIPYRDSKLTRILQPALTGDSIITTICTIDSKSESNSETTNTVRFASR 447

Query: 461 AKSIK---NKPQLGSIITKDILVKNIASEL 487
           AK+I     K ++ +   KD +++N+  +L
Sbjct: 448 AKNISLNVRKNEMDTSNEKDSIIQNLRKQL 477

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 73/138 (52%), Gaps = 13/138 (9%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  D VF        ++  + +P+ +   +GYN T+  YGMT +GKT+TM+G ++     
Sbjct: 145 FQFDHVFTKEVTNSEVYMALGQPIVDKLFQGYNATIFAYGMTGSGKTFTMSGTKQ----- 199

Query: 127 LSDSAGIIPRVLFKLFD-AMEFQNDD----YIIKCSFIELYNEELKDLLDECQAINSTAK 181
                G+IP  +  +FD  ME  +      Y +K S++E+YNE++ DLL   +A  + A 
Sbjct: 200 ---DPGLIPLCVGNMFDRVMEETSKSTEHKYEVKVSYLEIYNEKIYDLLSITEANGAVAS 256

Query: 182 KLRIFDSNASQIRKVSEY 199
           +    +S+  +IR  S+Y
Sbjct: 257 RQLGRNSSGLKIRDDSKY 274

>TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa]
           {ON} Anc_2.633 YKL079W
          Length = 644

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 63/181 (34%), Positives = 95/181 (52%), Gaps = 23/181 (12%)

Query: 299 KQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHDG 358
           K++ I I+NL+  ++TS  E +   ++G   R +AS       SRS  I  I + +  + 
Sbjct: 185 KKSSISIKNLRCVYVTSLLEALSYCEKG---RSLAS-------SRSSVIIRITVEQRDNV 234

Query: 359 K-IFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA--------- 408
           K +F+     LVDL  S+ I +        +    INQS++TL  V  SLA         
Sbjct: 235 KEVFKTGSFQLVDLGSSDKIDKQNNLGISPENTKKINQSMVTLENVARSLAGTEQSVKNG 294

Query: 409 ---DKNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIK 465
                N +IP++ES LT+LLQ+++GGN KT L+   S AK + EET +TL + A  K +K
Sbjct: 295 RPRSGNYYIPYKESCLTQLLQETIGGNCKTTLVLMCSTAKQDEEETLNTLNFGANMKLVK 354

Query: 466 N 466
           N
Sbjct: 355 N 355

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 64/121 (52%), Gaps = 22/121 (18%)

Query: 58  IAGQMNSKTYTVDKVFGPSANQR-----LIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGK 112
           +AGQ N K + VD++F P A  +     +I + VA+ LFN    GYN  ++ YG T +GK
Sbjct: 63  LAGQ-NLKLFRVDQIFNPGAQTKDTTSSIIGDSVAQ-LFN----GYNVAIMAYGQTDSGK 116

Query: 113 TYTMTGDERLYNGELSDSAGIIPRVLFKLFDAMEF---QNDDYIIKCSFIELYNEELKDL 169
           T TM G    YN       G+I  V  ++F  +E     N DY I  S IE+  E ++DL
Sbjct: 117 TSTMFG----YN----KGDGVINGVCKQIFTTVETGSENNIDYSISLSIIEVNCESIRDL 168

Query: 170 L 170
           L
Sbjct: 169 L 169

>TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON}
           Anc_8.678 YPL155C
          Length = 637

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 83/270 (30%), Positives = 131/270 (48%), Gaps = 40/270 (14%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKE-- 355
           D + G+ I  L E    S++E    +Q G + R+ + T  N  SSRSH I  + L     
Sbjct: 246 DLKYGVRITGLTEKRCESSEELSRWIQIGDKNRKTSETIYNTRSSRSHAIVLVRLNNTDL 305

Query: 356 HDGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI----------- 404
             G+    S ++L DLAGSE   ++ +Q +R KE   IN+SLL LG VI           
Sbjct: 306 RSGETVS-STLSLCDLAGSE---KAVSQYERRKEGAFINKSLLALGTVISKLSSESLSKN 361

Query: 405 -------NSLADKNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEY 457
                   +  + N HIP+R+SKLTR+LQ +L GN+    I TI      + ET +T+ +
Sbjct: 362 GPPTFTSTNPTEPNTHIPYRDSKLTRILQPALSGNSIITTICTIDTRNEAASETVNTIRF 421

Query: 458 AAKAKS----IKNKPQL--GSIITKDILVKNIASELAKVKADLLSTKSRDGVYMSQIHYK 511
           A++AK+    +  +P +  GS   KD  ++N+  +L K    ++  K R  +  S  H  
Sbjct: 422 ASRAKNVTLQVAKRPAVGTGSYNEKDQTIENLTQQLEKQHQLVMRLKQRTSM-TSSSHND 480

Query: 512 ELTNDLES---------YKTEVQECKRVID 532
           + T D  S          K ++  C++++D
Sbjct: 481 DSTVDPNSTLLKAENRVLKCKLSNCEKLLD 510

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 70/124 (56%), Gaps = 16/124 (12%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +T D+VF  +     I+E  + P+ +  ++G+N TV  YGMT +GKT+TMTG E      
Sbjct: 112 FTFDRVFPANCTNLDIYEASSRPMIDKLLQGFNATVFAYGMTGSGKTFTMTGTE------ 165

Query: 127 LSDSAGIIPRVLFKLFDAMEFQN----DDYIIKCSFIELYNEELKDLLDECQA---INST 179
             D AG+IP  +  LF  +   +      Y +  S++E+YNE++ DLLD C++    NST
Sbjct: 166 --DEAGLIPLSVTYLFSKILEHSMRGTSKYEVVVSYLEIYNEKIYDLLD-CESENKFNST 222

Query: 180 AKKL 183
             ++
Sbjct: 223 PSRM 226

>Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {ON}
           YPL155C (REAL)
          Length = 704

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 100/199 (50%), Gaps = 35/199 (17%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYK-EH 356
           D Q G+ +  L E    S++E ++ +  G + R++  T  N  SSRSH I  I L   + 
Sbjct: 298 DTQYGVKVIGLTERRCESSEELLKWIAIGDKSRKIGETDYNARSSRSHAIVLIRLTSTDL 357

Query: 357 DGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-ADK----- 410
           +    R S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK     
Sbjct: 358 ESGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKINPTG 414

Query: 411 -NIHIP------------------------FRESKLTRLLQDSLGGNTKTALIATISPAK 445
            NIH                          +R+SKLTRLLQ +L G++    I T+    
Sbjct: 415 SNIHTTPTNTGSSSSGTVTSNNNIPNNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRN 474

Query: 446 LNSEETCSTLEYAAKAKSI 464
             + ET +TL +A++AK++
Sbjct: 475 DAAAETINTLRFASRAKNV 493

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 74/135 (54%), Gaps = 16/135 (11%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  D VF        ++E  ++P+ +  + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FEFDHVFASHCTNLEVYERTSKPMIDKLLVGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 127 LSDSAGIIPRVLFKLF-DAMEFQ-NDD--YIIKCSFIELYNEELKDL----LDECQAINS 178
           L    G+IP  +  LF + ME   N D  + +  S++E+YNE + DL    L+E  +  S
Sbjct: 219 L----GLIPLSVSYLFSNVMELSMNGDKKFDVIISYLEIYNERIYDLLESGLEESLSRPS 274

Query: 179 TAKKLRIFDSNASQI 193
           T  +L +   N++ +
Sbjct: 275 TPSRLYMGKGNSNGL 289

>TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {ON} 
          Length = 672

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 84/151 (55%), Gaps = 13/151 (8%)

Query: 321 ELLQRGLQYRQVASTKMNDFSSRSHTIFTI------NLYKEHDGKIFRISKMNLVDLAGS 374
           +L++ G   R   ST MN+ SSRSH++F +       + +EH        ++NLVDLAGS
Sbjct: 526 QLIRNGNNTRNTKSTHMNNASSRSHSVFMMKITGHNRITQEHS-----TGRLNLVDLAGS 580

Query: 375 ENISRSG--AQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFRESKLTRLLQDSLGGN 432
           E + +       +  KE  SIN+SL  L  VI+S+  +  +IPFR SKLT LL++SL   
Sbjct: 581 ERLQQQEQITSQETLKETTSINKSLTCLADVIHSMKHRQPYIPFRNSKLTYLLKNSLINK 640

Query: 433 TKTALIATISPAKLNSEETCSTLEYAAKAKS 463
           +KT +   ISP   +  ET ++L  A K  +
Sbjct: 641 SKTLMYVNISPNINSIRETINSLRLARKVNT 671

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 77/169 (45%), Gaps = 28/169 (16%)

Query: 12  ELNIIVAVRCRGRNEREIKAKSS-----VVVSVPDV-AGSSEIAINTTEDVGIAGQMNSK 65
           EL   + V CR R   + +A +S     + +   D  AG   I +N  + +         
Sbjct: 331 ELRGNIRVYCRLRPYIKDEAATSNSDGYIFIKPFDANAGQQRIIVNDLKQL--------H 382

Query: 66  TYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNG 125
            +T DK+FG   +   +F+++   L    + GYN  +  YG T +GKTYTM         
Sbjct: 383 AFTFDKIFGMQDDNYEVFDDIKN-LVQSSLDGYNVCIFTYGQTGSGKTYTM--------- 432

Query: 126 ELSDSAGIIPRV---LFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLD 171
            L++  GII +    +      +     +Y ++  FIE+YNE ++DLL+
Sbjct: 433 -LNEKDGIIMQTIEYIVHFAGNLHKLGWEYELEVEFIEIYNETIRDLLN 480

>Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa]
           {OFF} YPR141C (KAR3) - kinesin-like nuclear fusion
           protein [contig 452] PARTIAL
          Length = 588

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 75/162 (46%), Gaps = 19/162 (11%)

Query: 12  ELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVDK 71
           EL   + V CR R   + + + S  +S+   +       N T+ + I  +     +T D+
Sbjct: 358 ELRGNIRVFCRLRPHLDNEKEDSSSISIDGFSDE-----NGTQCITIKREAKYHKFTFDR 412

Query: 72  VFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDSA 131
            FG   + + IF E+ + L    + GYN  +  YG T +GKTYTM          L+   
Sbjct: 413 CFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM----------LNPED 461

Query: 132 GIIPRVLFKLFDAMEFQND---DYIIKCSFIELYNEELKDLL 170
           GIIP  L  +F  +E   +    Y I   FIE+YNE +KDL 
Sbjct: 462 GIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLF 503

 Score = 33.1 bits (74), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINL 352
           D QT  +I N+    +T+ +    +L R ++ R  A+T  N  SSRSH++F I L
Sbjct: 526 DSQT-THITNITVCKLTNREMVNSILVRAMKMRSTAATSANARSSRSHSVFIIKL 579

>Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {ON}
           complement(20458..22401) [1944 nt, 648 aa]
          Length = 647

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 86/168 (51%), Gaps = 21/168 (12%)

Query: 336 KMNDFSSRSHTIFTINLYKEH--DGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSI 393
           + N+   RSHTI  +++ K +  D  I  +S + +VDLAGS+ I ++ +     ++A  I
Sbjct: 223 RHNNLIQRSHTIMEVSIEKRNKLDESI-TMSSLYIVDLAGSDPIGKNSSSGITTEDAKKI 281

Query: 394 NQSLLTLGRVINSLADKN------------IH-IPFRESKLTRLLQDSLGGNTKTALIAT 440
           N  + ++  VIN L   N            +H +P++ S LTRLL D LGGN KT  + T
Sbjct: 282 NHQIKSVNDVINGLVVMNREGGIMTDISTLMHKVPYKSSILTRLLLDPLGGNCKTTFLLT 341

Query: 441 ISPAKLNSEETCSTLEYAAKAKSIKNKPQ-----LGSIITKDILVKNI 483
            S  K +  ET STL++    KS    P+     L S  T DI + ++
Sbjct: 342 SSLKKNDWNETLSTLKFGYNCKSANTNPRINRFGLNSKATMDIFLTDM 389

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 70/128 (54%), Gaps = 20/128 (15%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           Y  DKVF  S +  +  +E  E      ++GYN +++ YG + TGK++ + G+++     
Sbjct: 73  YKFDKVFA-SNDTGVEHQEFIESNLESLLQGYNTSIVTYGQSGTGKSFELYGEQQ----- 126

Query: 127 LSDSAGIIPRVLFKLFDAM--EFQNDD----YIIKCSFIELYNEELKDLLDECQAINSTA 180
                G+I ++L KLF+ +  E  N++    Y +K SF+E+Y E++ DL+D      S  
Sbjct: 127 ----DGLIFQLLTKLFNRIDEEMGNNNKNIHYTVKFSFLEVYQEKMFDLMDSP----SVK 178

Query: 181 KKLRIFDS 188
           K L+I DS
Sbjct: 179 KHLKINDS 186

>Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)
           [1974 bp, 657 aa] {ON} ANNOTATED BY YGOB -
          Length = 657

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 75/162 (46%), Gaps = 19/162 (11%)

Query: 12  ELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVDK 71
           EL   + V CR R   + + + S  +S+   +       N T+ + I  +     +T D+
Sbjct: 358 ELRGNIRVFCRLRPHLDNEKEDSSSISIDGFSDE-----NGTQCITIKREAKYHKFTFDR 412

Query: 72  VFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDSA 131
            FG   + + IF E+ + L    + GYN  +  YG T +GKTYTM          L+   
Sbjct: 413 CFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM----------LNPED 461

Query: 132 GIIPRVLFKLFDAMEFQND---DYIIKCSFIELYNEELKDLL 170
           GIIP  L  +F  +E   +    Y I   FIE+YNE +KDL 
Sbjct: 462 GIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLF 503

 Score = 33.1 bits (74), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINL 352
           D QT  +I N+    +T+ +    +L R ++ R  A+T  N  SSRSH++F I L
Sbjct: 526 DSQT-THITNITVCKLTNREMVNSILVRAMKMRSTAATSANARSSRSHSVFIIKL 579

>YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Protein
           that interacts with Myo2p, proposed to be involved in
           exocytosis; N-terminal domain is related to the motor
           domain of kinesins
          Length = 656

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 59/109 (54%), Gaps = 12/109 (11%)

Query: 66  TYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNG 125
           T+  DKVF  +A Q  + + +  P+ ND + GYN TV+ YG + +GK+Y++ G +     
Sbjct: 74  TFQFDKVFDANATQEDVQKFLVHPIINDVLNGYNGTVITYGPSFSGKSYSLIGSK----- 128

Query: 126 ELSDSAGIIPRVLFKLFDAM----EFQNDDYIIKCSFIELYNEELKDLL 170
              +S GI+P +   LFD +    E + D + +     E+Y E+  DLL
Sbjct: 129 ---ESEGILPNICKTLFDTLEKNEETKGDSFSVSVLAFEIYMEKTYDLL 174

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 46/137 (33%), Positives = 67/137 (48%), Gaps = 13/137 (9%)

Query: 342 SRSHTIFTINL-YKEHDGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 400
           SRSH +F +++  +     I + S + LVDL G+E   +             +NQS+  L
Sbjct: 233 SRSHLVFQLHVEQRNRKDDILKNSSLYLVDLHGAEKFDKRTESTLSQDALKKLNQSIEAL 292

Query: 401 GRVINSLA---------DKNIHI-PFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEE 450
              + SL+          K  H   +RES+LT +L+DSLGGN KT +I T   +  N   
Sbjct: 293 KNTVRSLSMKERDSAYSAKGSHSSAYRESQLTEVLKDSLGGNRKTKVILTCFLS--NVPT 350

Query: 451 TCSTLEYAAKAKSIKNK 467
           T STLE+    + I NK
Sbjct: 351 TLSTLEFGDSIRQINNK 367

>TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {ON}
           Anc_2.633 YKL079W
          Length = 682

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 92/182 (50%), Gaps = 16/182 (8%)

Query: 302 GIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYK-EHDGKI 360
           G+ + NL++ H+ S KE +    + +    V ++K ++   R++TIF IN+ K +   + 
Sbjct: 208 GLPVDNLRQVHVASFKETLYYFNQAMS---VLNSKHDNSFPRTNTIFNINIEKLDKLDES 264

Query: 361 FRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD------KNIH- 413
              S + LVDLAGS+ I R  +    +++   IN S+ ++  +I SL+       KN   
Sbjct: 265 TTSSSIYLVDLAGSDLIDRKNSSGVNSEDVKRINSSIKSVQNIITSLSKLSYSDYKNYEF 324

Query: 414 -----IPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKP 468
                +P+  SKL +LL++ LGGN KT  + TIS      ++    L+     +  K  P
Sbjct: 325 SLENSVPYDSSKLGKLLKEPLGGNCKTNFLFTISMNPEQYDDIIEALQLGTILQDSKTVP 384

Query: 469 QL 470
           Q+
Sbjct: 385 QI 386

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 59/112 (52%), Gaps = 14/112 (12%)

Query: 66  TYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNG 125
           ++    +F   +N  LI   +   + ++ + GYN  ++ YG   +GKTY+      LY  
Sbjct: 83  SFEFTHIFDRDSNIDLIGNTIVTGMIDEAMEGYNTALVTYGPKYSGKTYS------LYGN 136

Query: 126 ELSDSAGIIPRVLFK-LFDAMEFQNDD------YIIKCSFIELYNEELKDLL 170
           ++ DS G + +++FK LF  +     D      +I+K SF+E++ +++ DLL
Sbjct: 137 DVDDSFG-LGQIIFKDLFSRINKSVTDSNAKYTFIVKISFLEVWLDKVVDLL 187

>Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079W
           (REAL)
          Length = 657

 Score = 68.2 bits (165), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 59/109 (54%), Gaps = 12/109 (11%)

Query: 66  TYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNG 125
           T+  DKVF  +A Q+ + + + +P  ND + GYN T+L YG + +GK+Y++ G +     
Sbjct: 75  TFQFDKVFDANATQKDVQDFLLDPTINDVLSGYNSTILTYGPSFSGKSYSLIGPQ----- 129

Query: 126 ELSDSAGIIPRVLFKLFDAME----FQNDDYIIKCSFIELYNEELKDLL 170
              D  GI+P +   LF  +E     + +++ +     E+Y E+  DLL
Sbjct: 130 ---DGGGILPNICKALFSTLEDREKNKGNNFSVSVLAFEIYMEKTYDLL 175

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 63/225 (28%), Positives = 105/225 (46%), Gaps = 40/225 (17%)

Query: 305 IQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFS-----SRSHTIFTINLY---KEH 356
           I++++  H+ S     E L+  +Q  Q  + +M  +S     SRSH +F +++    + H
Sbjct: 197 IKDIRPAHVNS----FEDLKSYIQSVQNPANRMG-YSGKAERSRSHVVFQLHVEQRNRRH 251

Query: 357 DGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNI---- 412
           D  I + S + L+DL G+E   +             +NQS+  L   + SL  K++    
Sbjct: 252 D--ILKNSSLYLIDLHGAEKFDKRIENTLSQDSLKKLNQSIEALKNTVQSLEIKSMDSVY 309

Query: 413 ------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKN 466
                    +RES+LT +L+DSLGGN KT +I T   +  N   T STL++    + I N
Sbjct: 310 SAKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLS--NVPTTLSTLKFGDSIRQINN 367

Query: 467 KPQLGSIITKDILVKNIASELAKVKADLL--STKSRDGVYMSQIH 509
           +           ++ N +    + K DL     K +D  Y+SQI+
Sbjct: 368 R-----------VMDNTSGLNLRKKMDLFVQDMKIKDDNYISQIN 401

>KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2.633
           YKL079W
          Length = 522

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 79/157 (50%), Gaps = 18/157 (11%)

Query: 40  PDVAGS----SEIAINTTEDVGIAGQM----NSKTYTVDKVFGPSANQRLIFEEVAEPLF 91
           PD  GS    SE ++       + G      + +T+++DKVF PSA+Q  +   +  P+ 
Sbjct: 9   PDSEGSALDISETSVTFRSHASVGGSHGVDPHERTFSLDKVFPPSASQADVTAVLLGPIV 68

Query: 92  NDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDSAGIIPRVLFKLFDAMEFQNDD 151
           ++   G N  +   G + TGKT+TM G + +       S G++ R+L K+F  M  +N+ 
Sbjct: 69  DNLAHGVNVQMASLGDSQTGKTHTMLGQQGV-------SQGLLQRILTKVFQLMN-ENEG 120

Query: 152 YIIKCSF--IELYNEELKDLLDECQAINSTAKKLRIF 186
             ++ S   +EL N+++ DLL++   +      L+ F
Sbjct: 121 VTVQYSLSAVELVNDKVYDLLNKRSPLGQNKNHLKGF 157

>Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 58/109 (53%), Gaps = 12/109 (11%)

Query: 66  TYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNG 125
           T+  DKVF  +A Q+ + + +  P   D + GYN T+L YG + +GK+Y++ G +  YN 
Sbjct: 74  TFQFDKVFDANATQKDVQDFLVNPTIKDILSGYNSTILTYGPSFSGKSYSLLGSQ--YN- 130

Query: 126 ELSDSAGIIPRVLFKLFDAM----EFQNDDYIIKCSFIELYNEELKDLL 170
                 G++P +   LF+ +    E +  ++ +     E+Y E+  DLL
Sbjct: 131 -----EGVLPNICQVLFETLEENEETKGTNFCVSVLAFEIYMEKSYDLL 174

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 110/218 (50%), Gaps = 30/218 (13%)

Query: 342 SRSHTIFTINLYKEHDGK-IFRISKMNLVDLAGSENISRSGAQNQRAKEA-GSINQSLLT 399
           S+SH +F +++ + +  + I + S + L+DL G+E   +   +N  +++A   +NQS+  
Sbjct: 233 SKSHLVFQLHVEQRNRREDILKNSSLYLIDLHGAEKFEKR-TENTLSQDALKKLNQSIEA 291

Query: 400 LGRVINSLADKNIHIPF----------RESKLTRLLQDSLGGNTKTALIATISPAKLNSE 449
           L  ++  LA KN    +          RES+LT +L+DSLGGN K  +I T   +  N  
Sbjct: 292 LKNIVQLLAVKNPDSAYSTKASHSSTYRESQLTEVLRDSLGGNRKMKVILTCFLS--NVP 349

Query: 450 ETCSTLEYAAKAKSIKNKPQLGS----------IITKDILVK--NIASELAKVKADLLST 497
            T STLE+    + I NK    +          +  +D+ +K  N  S++  +K++L S 
Sbjct: 350 TTISTLEFGDNIRQIINKVMSSTTGLNMKKKMDLFVQDMKIKDDNYVSQINILKSELDSL 409

Query: 498 KSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLT 535
           K       S+   +++  +LE+Y+ E  + K  +D +T
Sbjct: 410 KDLSNESSSR---EDMKTELENYEKENVKLKLQLDSIT 444

>NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633
          Length = 660

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 87/176 (49%), Gaps = 14/176 (7%)

Query: 302 GIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHDGKIF 361
           G +I++L + H+TS  E  + L+ G  Y+ ++   ++   S+    F +      D  + 
Sbjct: 196 GDHIRDLHQIHVTSPIEIKDTLKNG--YKNISP--LHHSKSQIFVRFEVQCIDRKDD-VT 250

Query: 362 RISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK----NIHIPFR 417
           R S +  +DL GS+ +++  A    + +    NQ +  L  +I +L ++    + H  F+
Sbjct: 251 RCSSITFIDLCGSDLLTKQNASKLSSDDIKKFNQMIYLLQNLIKTLPEEQSTNSSH--FK 308

Query: 418 ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSI 473
           +S L ++L D LGG+TK  L+  I       E+    ++  AKAK IKN P +  I
Sbjct: 309 DSSLNKILMDYLGGDTKMTLVVAIDGNTGGYED---AVKLGAKAKLIKNYPTMNKI 361

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 52/104 (50%), Gaps = 6/104 (5%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           Y  D +F   + +   ++ + + L +D  +GYN T++ YG TS+GK++ + GD       
Sbjct: 86  YQFDSIFDVDSKETEFYDSITDNLIDDISKGYNTTIMTYGPTSSGKSHALFGDPD----- 140

Query: 127 LSDSAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLL 170
            S + G+I  +  +L       N   +   S  ELY +++ DLL
Sbjct: 141 -STNDGLINHIADRLLFPQCEDNLKTLCSISMWELYIDKVYDLL 183

>Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 110/239 (46%), Gaps = 36/239 (15%)

Query: 305 IQNLKEFHITSAKEGIELLQRGLQYRQVASTKM----NDFSSRSHTIFTINL-YKEHDGK 359
           I+++   HI S K+    L+  +Q  Q    +M    N   S+SH +F +++  +  +  
Sbjct: 196 IKDICPAHIRSYKD----LKSYIQSVQNTDNRMGYSGNTERSKSHLVFQLHVEQRNRNAD 251

Query: 360 IFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPF--- 416
           I R S + L+DL G+E   +             +NQS+  L  ++  L+ K+    +   
Sbjct: 252 ILRKSSLYLIDLHGAERFDKRTEVTLSQDALKKLNQSIEALKNIVRLLSVKDRDSAYSVK 311

Query: 417 -------RESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQ 469
                  RES+LT +L+DSLGGN KT +I T   + +++  T STLE+    + I NK  
Sbjct: 312 ASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVST--TLSTLEFGECIRQITNK-- 367

Query: 470 LGSIITKDILVKNIASELAKVKADLL--STKSRDGVYMSQIHYKELTNDLESYKTEVQE 526
                    ++ N      K K DL     K RD  Y S+I+   L  +++S KT   E
Sbjct: 368 ---------VIDNTTGLNLKKKMDLFIEDMKIRDNNYASRINI--LKAEIDSLKTPSGE 415

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 59/109 (54%), Gaps = 12/109 (11%)

Query: 66  TYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNG 125
           T+  DKVF  +A Q  + + +  P  +D + GYN T++ YG + +GK+Y++ G +    G
Sbjct: 74  TFKFDKVFDTNATQEDVQDFLVRPSIDDVLSGYNGTIITYGPSFSGKSYSLLGSQE---G 130

Query: 126 ELSDSAGIIPRVLFKLFDAM----EFQNDDYIIKCSFIELYNEELKDLL 170
           E     GI+P +   LF+ +    E + +++ +     E++ E+  DLL
Sbjct: 131 E-----GILPNICKVLFETLEKNKETKGNNFSVSVLAFEIFMEKTYDLL 174

>TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.633
           YKL079W
          Length = 803

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/167 (28%), Positives = 81/167 (48%), Gaps = 18/167 (10%)

Query: 301 TGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEH-DGK 359
           + + I+NL++ ++ S +E    L  G   R      M   +SRS+ +  INL +   + +
Sbjct: 235 SSLEIENLRQVYVESFEELNSYLIEGRSNRN-----MKHLTSRSNIVIKINLEQVFLEDQ 289

Query: 360 IFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFRE- 418
           + + S + L+D+A S+ I ++ +    AKEA  +N  + +    IN LA+     P+ + 
Sbjct: 290 LMKCSSLILLDMAASDYIDKNDSLGISAKEAKKLNYPMESFTSYINLLAETGTS-PYDQQ 348

Query: 419 ----------SKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTL 455
                     S L  ++   +GGN KT  I+TISP   N  ET  TL
Sbjct: 349 INGKKSNDYNSNLVDIMSIPIGGNCKTLFISTISPLLANQNETFITL 395

 Score = 40.0 bits (92), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 50/104 (48%), Gaps = 16/104 (15%)

Query: 35  VVVSVPDVAGSSEIAIN-------TTEDVGIAGQ---MNSKT-----YTVDKVFGPSANQ 79
           VVV +     S EIA +       T ++ G  G      S+T     + VDKVF     Q
Sbjct: 4   VVVRIKPEPPSEEIAFSQYSIRDKTRDNDGATGTRIIFTSETTGNTEFQVDKVFDRFTKQ 63

Query: 80  R-LIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERL 122
             L+  ++ +   ++   G+N +++ +G + TGK++TM G+  L
Sbjct: 64  SDLLSSDIVKNKISELFDGFNSSIIAFGQSGTGKSFTMFGNNSL 107

>TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {ON}
           Anc_2.633 YKL079W
          Length = 693

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 72/130 (55%), Gaps = 5/130 (3%)

Query: 343 RSHTIFTINLYK-EHDGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLG 401
           RS TI  I L + + D  +   S +  VDLAGS+  S+   +    + A   N+ + +L 
Sbjct: 265 RSSTILRIKLLQLDEDEDLETQSTICFVDLAGSDRASKDIEKGITREAASKYNRVMDSLN 324

Query: 402 RVINSLAD-KNIHIP---FRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEY 457
            ++ +LA+ ++I I    +R S LTR+L D L GN KT LI + S  K +  ET STL +
Sbjct: 325 SMVYTLANSESISINKSIYRNSHLTRILYDLLAGNHKTNLIFSCSLNKDDEYETFSTLGF 384

Query: 458 AAKAKSIKNK 467
           ++ A S+ N+
Sbjct: 385 SSYASSMSNQ 394

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 69/169 (40%), Gaps = 50/169 (29%)

Query: 48  IAINTTEDVGIAGQMNSKTYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGM 107
           I +N++ + G  G  N   Y  DK+F P      I   ++    ND  +GYN T + YG 
Sbjct: 41  ITLNSSVNQGSLGGSNQ--YRFDKIFEPEKPDDEINSTLSFACINDLFKGYNSTYISYGQ 98

Query: 108 TSTGKTYTMTGDERLYNGELSD-------------------------------------- 129
           T TGKTYT+ G    +N   +D                                      
Sbjct: 99  TGTGKTYTLYG--TAFNDTPTDLDSKNINTNKNVKNDSNISSNSNIQTSASSNKSANSIL 156

Query: 130 ---SAGIIPRV---LFKLFDAMEF--QNDDYIIKCSFIELYNEELKDLL 170
              + G+I +V   LF++ D +    +   +++  SF+E+Y EE+ DLL
Sbjct: 157 QKKNYGLISKVGNDLFEMIDQIRAIRKGITFLVNISFVEVYKEEVYDLL 205

>CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa]
           {ON} similar to uniprot|P32364 Saccharomyces cerevisiae
           YKL079w SMY1 kinesin-related protein
          Length = 675

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 98/213 (46%), Gaps = 30/213 (14%)

Query: 299 KQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTIN---LYKE 355
           K+ G+Y Q     +I S KE   +++     ++ +  KM+   S SH +   +   L + 
Sbjct: 202 KKFGLYYQEANNEYINSIKEFDRVMKLIQDNKEASEKKMDSKRSTSHVVIRCSVEQLDRV 261

Query: 356 HDGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL---ADKN- 411
           H G I   S +   DL GS    +   Q    +    +N S+  L  V+NS+     KN 
Sbjct: 262 H-GTITS-SNIMFADLCGSNRFEKDVDQKLGVENIKKLNLSISNLESVVNSVLQNQQKNH 319

Query: 412 ----------------IHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTL 455
                             +P+++S+LT L+Q++LGGN++T ++      K + EET +TL
Sbjct: 320 LYIENKLVPSVNSSDLQRVPYKDSQLTGLIQEALGGNSRTRVVLNCFDDKSHHEETIATL 379

Query: 456 EYAAKAKSIKNKPQ-----LGSIITKDILVKNI 483
            +  + ++I N  +     L S  T D+L+ N+
Sbjct: 380 RFGVQLQNILNFVRADVTGLNSKKTLDLLIDNM 412

 Score = 39.3 bits (90), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 54/108 (50%), Gaps = 12/108 (11%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  +KV+        I + ++E +  D   GY+ +++ YG   +GK++T+ G+E      
Sbjct: 87  FNFEKVYDVGVPLVDIHKSLSESVLKDIYDGYDVSIISYGEAGSGKSFTLFGNE------ 140

Query: 127 LSDSAGIIP----RVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLL 170
             DS GII      ++ K  +  + QN    I+ S +E+  E++ D+L
Sbjct: 141 --DSDGIIALTFQDIIQKKRELEKDQNTIVNIQISALEISLEKVYDML 186

>ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar to
           uniprot|Q759X8 Ashbya gossypii ADR145C ADR145Cp and
           weakly similar to YKL079W uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a kinesin
           colocalizes with Myo2p kinesin heavy chain homolog
          Length = 668

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 55/108 (50%), Gaps = 12/108 (11%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           +  +KV+     Q+ + E++      + + G+N +++ +G   +GKTYTM G++      
Sbjct: 68  FRFNKVYDVGVRQQEVCEDIIGDNVMELLAGFNVSIMAFGSEGSGKTYTMFGNDH----- 122

Query: 127 LSDSAGIIPRVLFKLFDAMEFQNDD----YIIKCSFIELYNEELKDLL 170
                GI+ R+   +FD ++  ++D      I  +F EL+ E + DLL
Sbjct: 123 ---EEGIVQRMCQSIFDQLDKLHEDSGNESTISINFFELFAENVYDLL 167

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 72/303 (23%), Positives = 137/303 (45%), Gaps = 51/303 (16%)

Query: 342 SRSHTIFTINLYKEHDGK-IFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 400
           SRS     I + + +  +   + S + L+DLA S+ + ++   +    E  S N S+  L
Sbjct: 224 SRSSAFLNITVEQRNKKEETLKHSVLQLIDLASSDKLDKNLKYDISTDEMKSTNSSMQNL 283

Query: 401 GRVINSLAD-----------KNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSE 449
            +V+  L++           K+ H   R S+L + LQ ++GG++KT  +   S  K + E
Sbjct: 284 HQVVYGLSELESPSSKNHSSKHTH---RTSRLAKFLQQAIGGDSKTTAVMLSSTDKADRE 340

Query: 450 ETCSTLEYAAKAKSIKNKP-----QLGSIITKDILVKNIASELAKVKADLLSTKSRDGVY 504
            T  TL   ++ +SI N P      L S    D+ +KN++              +R+  Y
Sbjct: 341 NTVITLSLGSRLRSIHNFPVQNKMGLNSKALLDLRLKNMS--------------TREDSY 386

Query: 505 MSQIHYKELTNDLESYKTEVQECKRVID---GLTTQNGLLL----------KDKKASNEV 551
           +++I Y  L +++      +Q+ K  +     LT +N  L+          + +K+ +E 
Sbjct: 387 LTRIKY--LEDEVSKLGGTIQQNKNQVSTNKSLTEKNMKLMDQLELYRKSQQTQKSGSEE 444

Query: 552 HNLQKIKLQSMKDSISHLHDSI-EKQHRKEQTLVDLILKLKSKSIEMQATIKYHSEREQV 610
            NL   +   +++ +S + D++ EK  R  Q  + L  +L+ KS +M   + Y   + Q 
Sbjct: 445 ENLTSQQNGRIQNEMSEVLDNLMEKCERVIQLQMRLDEELRQKS-QMSQQLNYKESKAQA 503

Query: 611 TQA 613
            +A
Sbjct: 504 LEA 506

>NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}
           Anc_2.633
          Length = 598

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 70/326 (21%), Positives = 149/326 (45%), Gaps = 32/326 (9%)

Query: 304 YIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEH---DGKI 360
           +++NL    I S  +  +  + G Q              RS++I    ++ E      ++
Sbjct: 205 HVKNLSHIQIASLDDLQKWFKIGCQRSSAIINAGTAKEKRSNSIIISKIHLEQVNPKDQL 264

Query: 361 FRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPF---- 416
           +++S ++ +DL G +  ++   Q     E   +N  + +   +I +L+D    +P+    
Sbjct: 265 YKLSTLSFIDLYGIDKFTKKDIQ-LTNDEMKKLNTLMSSFQNLITTLSDPK-SLPYTSSL 322

Query: 417 -RESKLTRLLQDSLGGNTKTALIATI-SPAKLNSEETCSTLEYAAKAKSIKNKPQLGSII 474
            ++S L ++LQD +GGN+KT  I    SP+ +  EE    L++A   KSIKN       +
Sbjct: 323 YKDSALNKILQDYIGGNSKTTFIIPFPSPSIIQHEELIEMLKFAMGLKSIKNP------L 376

Query: 475 TKDILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGL 534
             ++   N+  ++      + S+K R+    ++I+Y          ++E+    ++++ +
Sbjct: 377 IMNVFGLNLQKQMLLF---IKSSKLREENCQTKINY---------LQSELALKNKLLEPV 424

Query: 535 TTQNGLL-LKDKKASNEVHNLQKIKL--QSMKDSISHLHDSIEKQHRKEQTLVDLILKLK 591
            T +      D+ + ++   + K+KL  +S++  + H+  S   + + E    D +LK  
Sbjct: 425 ATDHHEENYNDESSCSDKETIMKLKLKIESLEQVLEHISTSENPKSKTETNEHDELLKKL 484

Query: 592 SKSIEMQATIKYHSEREQVTQAKMKQ 617
               E  A ++   E E+ T +K+KQ
Sbjct: 485 MDKCEDVAKLQVEIEAEKNTNSKLKQ 510

>KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.633
           YKL079W
          Length = 667

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 107/237 (45%), Gaps = 20/237 (8%)

Query: 304 YIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDF--SSRSHTIFTINLYKEH-DGKI 360
           Y ++L    +TS  E I  +      R   S    ++   S+SH I  IN+ + + +  +
Sbjct: 179 YFKDLHVAFVTSRDELINYIMDAESNRFSGSCLHTNYVQRSKSHLITKINVEQRNLNEDV 238

Query: 361 FRISKMNLVDLAGSENISRSG--AQNQRAKEAGSINQSLLTLGRVINSLAD----KNIHI 414
            +   ++  DLA  + I +    +    + E   +N    TL   I S+++     N  I
Sbjct: 239 VKRGSISFFDLAAIDFIDKDSMVSLGLTSDEVKKLNLESTTLKNSIISMSELSENPNAVI 298

Query: 415 PFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIK-----NKPQ 469
           P++ S LT+LL     GN KT +I T S  K N  ET  TL+   K +SI      NK  
Sbjct: 299 PYKNSNLTKLLNQCFMGNMKTTVILTCSMLKSNEAETLETLKMGLKLESISSNVHMNKHA 358

Query: 470 LGSIITKDILVKNIASELAKV--KADLLSTKSRDGVYMSQIHYKELTNDLESYKTEV 524
           L S    D++V+++ S+ A    +  LL T+  D     +  Y E  ++  S+K E+
Sbjct: 359 LNSKKKLDLIVEDMKSKEANYMNRIRLLETELND----LRASYGEAISETSSFKEEM 411

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 49/106 (46%), Gaps = 11/106 (10%)

Query: 67  YTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGE 126
           Y  D V   S     ++  +   L N+   GY+  V+ YG   TGK+    G +  Y G 
Sbjct: 63  YQFDSVHEKSTE---LYNGIKGDLINNIFEGYHTGVITYGSAGTGKSSIFYGTDSTYEG- 118

Query: 127 LSDSAGIIPRVLFKLFDAMEFQNDD--YIIKCSFIELYNEELKDLL 170
                G++   +  L+D ++   +D  + +  S IE++ E++ DLL
Sbjct: 119 -----GVVLMFVQDLYDKIDSIGNDTHFTVSLSTIEIHLEKMYDLL 159

>KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633
           YKL079W
          Length = 681

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 57/114 (50%), Gaps = 4/114 (3%)

Query: 61  QMNSKTYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDE 120
           ++  ++++  KV    A +   F E+A  + +D + G NC V  YG      +  M G +
Sbjct: 84  KLGEQSFSFSKVLNDQATKTEQFTELASKVTDDVLSGINCCVTTYGSGLAADSLVMFGPQ 143

Query: 121 RLYNGELSDS---AGIIPRVLFKLFDAMEFQN-DDYIIKCSFIELYNEELKDLL 170
              + E  DS   +G++ +    +F+A++  +  +Y +  S  E+Y +++ DLL
Sbjct: 144 SGNSKEEQDSSRCSGLLQQTCKHIFNAIDSDSTSEYQVSLSLCEVYVDKVFDLL 197

>NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON}
           Anc_2.633 YKL079W
          Length = 572

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 48/90 (53%), Gaps = 16/90 (17%)

Query: 87  AEPL----FNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDSAGIIPRVLFKLF 142
            EPL     N+  RG +C+++ YG ++TGKT+ +    R          GIIP  + +L+
Sbjct: 65  PEPLVIDNINELTRGVDCSMVTYGQSATGKTHVLFDQVR----------GIIPLFIEQLY 114

Query: 143 DAMEFQND-DYIIKCSFIELYNE-ELKDLL 170
             +E Q+D  Y I  S  E  ++ +++DLL
Sbjct: 115 IYLEAQSDLQYQIGLSVWEADSKGKIRDLL 144

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 69/162 (42%), Gaps = 27/162 (16%)

Query: 305 IQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHDGKIFRIS 364
           ++ LKE  ++S  E        LQ    A+  + + +  +    ++ L   H+   FR  
Sbjct: 165 VKGLKEVFVSSRCE--------LQDYLNAACDLQNSTFHTFVKISLQLVNCHEDS-FRKC 215

Query: 365 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFRESKLTRL 424
            +  VDL   E++                 Q + +L  V+++  DK I     +S+  +L
Sbjct: 216 CIEFVDLCAQEDVL----------------QLVCSLVAVLSNDNDKKIGK--EKSQFCKL 257

Query: 425 LQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKN 466
           L +S+GGN KT  I   S  + N + +  TLE+  K   + N
Sbjct: 258 LSNSIGGNRKTTFILACSTLEQNEKISLETLEFGLKVSQVVN 299

>NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401
          Length = 874

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 41/72 (56%), Gaps = 6/72 (8%)

Query: 364 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHI---PFRESK 420
           S+  +VD+ G++++ +S  QN   K    +N SLLTLG+ IN+L    + I   P  E  
Sbjct: 427 SEFTIVDMNGTQHLGKS--QNVMPKTT-ELNSSLLTLGKSINNLNLDEMPIVISPLAEFL 483

Query: 421 LTRLLQDSLGGN 432
           + R L++S  GN
Sbjct: 484 IRRALKNSRLGN 495

>KNAG0I00630 Chr9 (107952..109073) [1122 bp, 373 aa] {ON} Anc_2.315
           YGL153W
          Length = 373

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 77/174 (44%), Gaps = 35/174 (20%)

Query: 468 PQLGSIITKDILVKNIASELAKVKADLLSTKSRDGVYMSQIHY------KELTNDLESYK 521
           P L     KD  V      +A V A L       GVY     Y       E  + LE  K
Sbjct: 86  PPLPQRDWKDYFV------MATVTAGLFY-----GVYEMTRRYVIPSILPESKSKLEQDK 134

Query: 522 TEVQE----CKRVIDGLTTQNGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQH 577
            E++E     ++++DG+          ++  +E    ++ KL  + D+I  L  S+E   
Sbjct: 135 DEIKEQFDKVQKLLDGI----------EQEQSEFKEQERRKLDELDDTIGLLQTSLEDST 184

Query: 578 RKEQTLVDLILKLKSKSIEMQATI-KYHSEREQVTQAKMKQIFNEELLRLKSLL 630
           R  + + D    LKS+   +Q+ I K+ S    V +  +K+I NEELL LK+L+
Sbjct: 185 RAREKMDDDFRLLKSEMTGLQSEIDKFVSNNGSVKE--LKKI-NEELLSLKNLI 235

>Ecym_1085 Chr1 complement(170657..172774) [2118 bp, 705 aa] {ON}
           similar to Ashbya gossypii AFR670W
          Length = 705

 Score = 33.5 bits (75), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 10/65 (15%)

Query: 855 DNTSRSTKLTENSKRIG-------QQFTEMMEKNSKLESHLNE---SITMNESSINAFDK 904
           D + R T+  E SKRI         Q  E ++K S+LE HLN+   +++  + SI+ FD 
Sbjct: 5   DESKRMTEQQEESKRISIQVSSLSTQLIESIDKQSRLEEHLNQAKKALSAQKDSISQFDS 64

Query: 905 LSESI 909
           L + +
Sbjct: 65  LKQQL 69

>Skud_6.33 Chr6 (59497..60870) [1374 bp, 457 aa] {ON} YFL037W (REAL)
          Length = 457

 Score = 33.1 bits (74), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 66/137 (48%), Gaps = 19/137 (13%)

Query: 811 INKCDSLNNKYFGDISALLSNMKTSVTSTSDLVDDHVSQMRKYTDNTSRSTKLTENSKRI 870
           ++K  S N+ YF  +  + +N++T+V S +    D  +         + ST + E  KR+
Sbjct: 330 MHKVQSKNSDYF--VEWIPNNVQTAVCSVAPQGLDMAATF------IANSTSIQELFKRV 381

Query: 871 GQQFTEMMEKNSKLESHLNES---ITMNESSINAFDKLSESIHSAFEKYNTANT--ISRL 925
           G QF+ M ++ + L  + +E    +  +E+  N  D +SE     +++Y  A       +
Sbjct: 382 GDQFSAMFKRKAFLHWYTSEGMDELEFSEAESNMNDLVSE-----YQQYQEATVEDDEEV 436

Query: 926 DESTNL-MKQNKDGDIS 941
           DE+ +    QN+D  I+
Sbjct: 437 DENGDFGAPQNQDEPIT 453

>Smik_6.41 Chr6 (71718..73091) [1374 bp, 457 aa] {ON} YFL037W (REAL)
          Length = 457

 Score = 33.1 bits (74), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 66/137 (48%), Gaps = 19/137 (13%)

Query: 811 INKCDSLNNKYFGDISALLSNMKTSVTSTSDLVDDHVSQMRKYTDNTSRSTKLTENSKRI 870
           ++K  S N+ YF  +  + +N++T+V S +    D  +         + ST + E  KR+
Sbjct: 330 MHKVQSKNSDYF--VEWIPNNVQTAVCSVAPQGLDMAATF------IANSTSIQELFKRV 381

Query: 871 GQQFTEMMEKNSKLESHLNES---ITMNESSINAFDKLSESIHSAFEKYNTANT--ISRL 925
           G QF+ M ++ + L  + +E    +  +E+  N  D +SE     +++Y  A       +
Sbjct: 382 GDQFSAMFKRKAFLHWYTSEGMDELEFSEAESNMNDLVSE-----YQQYQEATVEDDEEV 436

Query: 926 DESTNL-MKQNKDGDIS 941
           DE+ +    QN+D  I+
Sbjct: 437 DENGDFGAPQNQDEPIT 453

>YFL037W Chr6 (56336..57709) [1374 bp, 457 aa] {ON}
           TUB2Beta-tubulin; associates with alpha-tubulin (Tub1p
           and Tub3p) to form tubulin dimer, which polymerizes to
           form microtubules
          Length = 457

 Score = 33.1 bits (74), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 66/137 (48%), Gaps = 19/137 (13%)

Query: 811 INKCDSLNNKYFGDISALLSNMKTSVTSTSDLVDDHVSQMRKYTDNTSRSTKLTENSKRI 870
           ++K  S N+ YF  +  + +N++T+V S +    D  +         + ST + E  KR+
Sbjct: 330 MHKVQSKNSDYF--VEWIPNNVQTAVCSVAPQGLDMAATF------IANSTSIQELFKRV 381

Query: 871 GQQFTEMMEKNSKLESHLNES---ITMNESSINAFDKLSESIHSAFEKYNTANT--ISRL 925
           G QF+ M ++ + L  + +E    +  +E+  N  D +SE     +++Y  A       +
Sbjct: 382 GDQFSAMFKRKAFLHWYTSEGMDELEFSEAESNMNDLVSE-----YQQYQEATVEDDEEV 436

Query: 926 DESTNL-MKQNKDGDIS 941
           DE+ +    QN+D  I+
Sbjct: 437 DENGDFGAPQNQDEPIT 453

>Suva_6.20 Chr6 (29833..31206) [1374 bp, 457 aa] {ON} YFL037W (REAL)
          Length = 457

 Score = 32.7 bits (73), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 66/137 (48%), Gaps = 19/137 (13%)

Query: 811 INKCDSLNNKYFGDISALLSNMKTSVTSTSDLVDDHVSQMRKYTDNTSRSTKLTENSKRI 870
           ++K  S N+ YF  +  + +N++T+V S +    D  +         + ST + E  KR+
Sbjct: 330 MHKVQSKNSDYF--VEWIPNNVQTAVCSVAPQGLDMAATF------IANSTSIQELFKRV 381

Query: 871 GQQFTEMMEKNSKLESHLNES---ITMNESSINAFDKLSESIHSAFEKYNTANT--ISRL 925
           G QF+ M ++ + L  + +E    +  +E+  N  D +SE     +++Y  A       +
Sbjct: 382 GDQFSAMFKRKAFLHWYTSEGMDEMEFSEAESNMNDLVSE-----YQQYQEATVEDDEEV 436

Query: 926 DESTNL-MKQNKDGDIS 941
           DE+ +    QN+D  I+
Sbjct: 437 DENGDFGAPQNQDEPIT 453

>AFR352C Chr6 complement(1073984..1075912) [1929 bp, 642 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR045C
           (SSC1) and YEL030W (ECM10)
          Length = 642

 Score = 32.3 bits (72), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 59/242 (24%), Positives = 98/242 (40%), Gaps = 37/242 (15%)

Query: 381 GAQNQRAKEAGSINQSLL-----------TLGRVINSLADKNIHIPFRESKLTRLLQDSL 429
           GA  Q A  AG +   LL           TLG V   L  +N  IP ++S++      + 
Sbjct: 393 GAAIQGAVLAGEVTDVLLLDVTPLSLGIETLGGVFTRLIPRNTTIPTKKSQI---FSTAA 449

Query: 430 GGNTKTALIA------TISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKDILVKNI 483
            G T   +         +   KL    T S +  A K       PQ+   +T DI    I
Sbjct: 450 AGQTSVEIRVFQGERELVRDNKLIGNFTLSGIPPAEKGV-----PQIE--VTFDIDADGI 502

Query: 484 ASELAKVKAD----LLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQNG 539
            +  A+ K       ++     G  +S    +++ ND E YK + +  +R I+     + 
Sbjct: 503 INVSARDKGSNKDASITVAGSSG--LSDAEIEKMVNDAEKYKEQDESRRRAIETANKADQ 560

Query: 540 LLLKDKKASNEVHN-LQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEMQ 598
           L    +KA N+  + + K + Q +KD I+ L +   +    E+   D    LK+K+ E+Q
Sbjct: 561 LAHDTEKAVNDFEDKVDKAEAQKVKDQIAALKELTARALSGEEVNAD---DLKAKTDELQ 617

Query: 599 AT 600
           + 
Sbjct: 618 SA 619

>NCAS0F03160 Chr6 (633224..644422) [11199 bp, 3732 aa] {ON} Anc_5.402
            YHR099W
          Length = 3732

 Score = 32.3 bits (72), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 79/178 (44%), Gaps = 40/178 (22%)

Query: 684  ESPILLGSLNDDI-IKMQKISDLYN-------EQLSISISELNIEH-------NDLKQYL 728
            E P L+G+   +I I+ + +S L N       E+L   I + N E+       N   Q L
Sbjct: 2405 EQPFLVGTRTQNIKIRKRFMSILNNSLEKDIKERLYYVIRDQNWEYIADYPWLNQASQLL 2464

Query: 729  NGSFFKSDHEEILNEHIEKTYDNIRRASTGIV-EQLKTGLELYLEESRNII-------ID 780
             G+F +        EH    ++     + G++ E L T ++  +EE  +         I 
Sbjct: 2465 YGAFER--------EHSLSLHNTSYLVTPGVLKEFLPTNIKPDVEEDGSEFASFVSNHIS 2516

Query: 781  SLKN----TTSDIVKSEMELFA--PK--KKKWEDSFEMINKCDSLNNKYFGDISALLS 830
            +LK     TTSDI    +ELF   P+  KK W + F  + KC   N KY G + +L++
Sbjct: 2517 ALKKMCQITTSDIFDPLVELFYQNPETIKKAWVNLFPQVYKCIPRNEKY-GFVRSLIA 2573

>CAGL0D02420g Chr4 (247761..248318) [558 bp, 185 aa] {ON} weakly
           similar to uniprot|Q99176 Saccharomyces cerevisiae
           YLR119w SRN2 suppressor of RNA1-1 mutation
          Length = 185

 Score = 31.2 bits (69), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 48/114 (42%), Gaps = 11/114 (9%)

Query: 841 DLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLE-------SHLNESIT 893
           +L++ H  ++  +  +      +TE  KR+  QF E+ EK SKLE         + E + 
Sbjct: 43  ELINQHRDKLHWFCASMDSFEPITEEVKRLKNQFKELEEKFSKLEDGKVVIQDQIAELVI 102

Query: 894 MNESSINAFDKLSESIHSAFE----KYNTANTISRLDESTNLMKQNKDGDISLD 943
           +       +  L + I S +     K    N I   ++  + ++ N  G + LD
Sbjct: 103 LESEYTKKYQNLQQLIRSNYSKDVAKRTMLNKIKENEQKCDELEINAKGSLDLD 156

>KLLA0D05269g Chr4 complement(455261..456610) [1350 bp, 449 aa] {ON}
           highly similar to uniprot|P02557 Saccharomyces
           cerevisiae YFL037W TUB2 Beta-tubulin associates with
           alpha- tubulin (Tub1p and Tub3p) to form tubulin dimer
           which polymerizes to form microtubules
          Length = 449

 Score = 32.0 bits (71), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 48/100 (48%), Gaps = 11/100 (11%)

Query: 811 INKCDSLNNKYFGDISALLSNMKTSVTSTSDLVDDHVSQMRKYTDNTSRSTKLTENSKRI 870
           ++K  + N+ YF  +  + +N++T+V S      D  +           ST + E  +R+
Sbjct: 330 MHKVQTRNSSYF--VEWIPNNVQTAVCSVPPKDLDMSATF------IGNSTSIQELFRRV 381

Query: 871 GQQFTEMMEKNSKLESHLNES---ITMNESSINAFDKLSE 907
           G QF+ M +K + L  + NE    I  +E+  N  D +SE
Sbjct: 382 GDQFSVMFKKRAFLHWYTNEGMEEIEFSEAESNMNDLVSE 421

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.342 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 95,862,409
Number of extensions: 4309707
Number of successful extensions: 20692
Number of sequences better than 10.0: 1162
Number of HSP's gapped: 21282
Number of HSP's successfully gapped: 1661
Length of query: 1004
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 884
Effective length of database: 39,721,479
Effective search space: 35113787436
Effective search space used: 35113787436
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 71 (32.0 bits)