Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1032.56.14ON68050825840.0
SAKL0E01012g6.14ON54450615420.0
KLTH0C11396g6.14ON55051715000.0
Kwal_56.223876.14ON54350414980.0
Smik_5.276.14ON60849114980.0
YEL060C (PRB1)6.14ON63549014820.0
Suva_5.76.14ON66448714830.0
TDEL0G045506.14ON56448114710.0
Skud_5.296.14ON60848814740.0
KLLA0D00979g6.14ON56148214600.0
TBLA0A073006.14ON57347814580.0
NCAS0F002206.14ON69547714460.0
CAGL0B03619g6.14ON46847213690.0
ZYRO0C07942g6.14ON54848013760.0
NDAI0K028806.14ON70446913830.0
KNAG0E009206.14ON53150613610.0
ACR012C6.14ON54147313421e-179
Ecym_30186.14ON57547113301e-176
Kpol_1045.756.14ON47744913121e-175
KAFR0L003606.14ON50243813141e-175
TPHA0M002306.14ON58550413011e-172
Smik_15.1726.14ON47842511361e-148
Suva_15.1786.14ON47641811001e-143
Skud_15.1646.14ON48241610901e-141
YOR003W (YSP3)6.14ON47842410751e-139
CAGL0E02651g6.14ON48541610111e-130
KAFR0B065506.14ON4564129841e-126
NCAS0D026306.14ON4514079101e-115
KNAG0F02970singletonON4204008011e-99
NDAI0I022806.14ON4824247834e-96
CAGL0L13266gsingletonON5794397156e-85
SAKL0A02002g6.313ON4793884786e-52
Kpol_1028.616.313ON5183304702e-50
Suva_3.846.313ON5274644693e-50
NCAS0D043906.313ON4923884602e-49
Kpol_1018.56.313ON4653344583e-49
Smik_3.1496.313ON4914674568e-49
TDEL0A072806.313ON4363544502e-48
ZYRO0D08822g6.313ON4903174522e-48
Skud_3.1246.313ON5404674519e-48
YCR045C (RRT12)6.313ON4914674427e-47
TPHA0D037606.313ON6073524452e-46
KLTH0A06094g6.313ON4963434374e-46
AAR069W6.313ON7682984404e-45
TBLA0F039706.313ON7342644361e-44
Ecym_21056.313ON6103144311e-44
CAGL0L10802g6.313ON5173434219e-44
KNAG0I024706.313ON4754264153e-43
Kwal_23.61836.313ON4933404065e-42
KAFR0J024506.313ON4783294031e-41
NDAI0I005606.313ON4833193961e-40
KLLA0F06028g6.313ON5083243831e-38
Kwal_33.133721.78ON3773193451e-34
TBLA0A067006.313ON4972563378e-33
KLTH0F02288g1.78ON3803203193e-31
Kpol_2000.691.78ON3863043062e-29
ZYRO0F16764g1.78ON3863032602e-23
TDEL0C062301.78ON3643032522e-22
TPHA0B045201.78ON3882692495e-22
TBLA0A054101.78ON3822801962e-15
SAKL0G00440g2.6ON83663800.57
NCAS0A008802.6ON833254790.73
Skud_14.1012.6ON81969780.85
KNAG0F007702.6ON826254771.3
YNL238W (KEX2)2.6ON81466761.7
Suva_14.1062.6ON80966761.9
NDAI0F038902.6ON83368742.9
ZYRO0F15598g2.6ON79065742.9
Smik_14.972.6ON81466733.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1032.5
         (680 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   999   0.0  
SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...   598   0.0  
KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...   582   0.0  
Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...   581   0.0  
Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...   581   0.0  
YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...   575   0.0  
Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   575   0.0  
TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   571   0.0  
Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...   572   0.0  
KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...   566   0.0  
TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...   566   0.0  
NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   561   0.0  
CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   531   0.0  
ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...   534   0.0  
NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...   537   0.0  
KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...   528   0.0  
ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...   521   e-179
Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...   516   e-176
Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   509   e-175
KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...   510   e-175
TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...   505   e-172
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   442   e-148
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   428   e-143
Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   424   e-141
YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   418   e-139
CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   394   e-130
KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   383   e-126
NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     355   e-115
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              313   1e-99
NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   306   4e-96
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   280   6e-85
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   188   6e-52
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   185   2e-50
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   185   3e-50
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   181   2e-49
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   181   3e-49
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   180   8e-49
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   177   2e-48
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   178   2e-48
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   178   9e-48
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   174   7e-47
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   176   2e-46
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   172   4e-46
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   174   4e-45
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   172   1e-44
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   170   1e-44
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   166   9e-44
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   164   3e-43
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   160   5e-42
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   159   1e-41
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    157   1e-40
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   152   1e-38
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   137   1e-34
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   134   8e-33
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   127   3e-31
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   122   2e-29
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...   104   2e-23
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...   101   2e-22
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...   100   5e-22
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...    80   2e-15
SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar ...    35   0.57 
NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6...    35   0.73 
Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238...    35   0.85 
KNAG0F00770 Chr6 (137641..140121) [2481 bp, 826 aa] {ON} Anc_2.6...    34   1.3  
YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}  KEX2Subti...    34   1.7  
Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238...    34   1.9  
NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {O...    33   2.9  
ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]...    33   2.9  
Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W...    33   3.9  

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
           [2043 nt, 681 aa]
          Length = 680

 Score =  999 bits (2584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/508 (95%), Positives = 484/508 (95%)

Query: 173 PSDGRKHNPPKQPVYNIKEDDDIVDSVTQQIFESAEKSGEKVKYAPLHSMENTKYENLVI 232
           PSDGRKHNPPKQPVYNIKEDDDIVDSVTQQIFESAEKSGEKVKYAPLHSMENTKYENLVI
Sbjct: 173 PSDGRKHNPPKQPVYNIKEDDDIVDSVTQQIFESAEKSGEKVKYAPLHSMENTKYENLVI 232

Query: 233 PNKYIIVFKKDVSVKDMQIHKDLIARAQFQYASVSDETSSSILGGIEEAFNVANLFHGYI 292
           PNKYIIVFKKDVSVKDMQIHKDLIARAQFQYASVSDETSSSILGGIEEAFNVANLFHGYI
Sbjct: 233 PNKYIIVFKKDVSVKDMQIHKDLIARAQFQYASVSDETSSSILGGIEEAFNVANLFHGYI 292

Query: 293 GHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARISHRDGLNLGSYNKYLY 352
           GHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARISHRDGLNLGSYNKYLY
Sbjct: 293 GHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARISHRDGLNLGSYNKYLY 352

Query: 353 DDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYG 412
           DDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYG
Sbjct: 353 DDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYG 412

Query: 413 XXXXXXXXXXXXLRSDGSGTMSDVLKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKS 472
                       LRSDGSGTMSDVLKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKS
Sbjct: 413 VAKNAEVVAVKVLRSDGSGTMSDVLKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKS 472

Query: 473 RSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGASTLSDDRAYFSNWGKC 532
           RSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGASTLSDDRAYFSNWGKC
Sbjct: 473 RSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGASTLSDDRAYFSNWGKC 532

Query: 533 VDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLSYFLSMQPDADXXXXXXXXXXX 592
           VDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLSYFLSMQPDAD           
Sbjct: 533 VDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLSYFLSMQPDADSEFFSSGSNSI 592

Query: 593 XPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYNAGHNISDFWKPKSESSAEPNERAKEFEL 652
            PAQLKKKLIAYSTKNLFQDLPEKTPNLLVYNAGHNISDFWKPKSESSAEPNERAKEFEL
Sbjct: 593 SPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYNAGHNISDFWKPKSESSAEPNERAKEFEL 652

Query: 653 EDLVDSAQWIADTWLNGIQQVFERMDLF 680
           EDLVDSAQWIADTWLNGIQQVFERMDLF
Sbjct: 653 EDLVDSAQWIADTWLNGIQQVFERMDLF 680

 Score =  140 bits (353), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 69/69 (100%), Positives = 69/69 (100%)

Query: 1  MKLDKTLVSVATLATLGSSLVIPEFARDLDDKKLLAKVGNPKDEGVVLGSRRGGVECGTV 60
          MKLDKTLVSVATLATLGSSLVIPEFARDLDDKKLLAKVGNPKDEGVVLGSRRGGVECGTV
Sbjct: 1  MKLDKTLVSVATLATLGSSLVIPEFARDLDDKKLLAKVGNPKDEGVVLGSRRGGVECGTV 60

Query: 61 AVKLDFGSN 69
          AVKLDFGSN
Sbjct: 61 AVKLDFGSN 69

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 544

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/506 (58%), Positives = 381/506 (75%), Gaps = 25/506 (4%)

Query: 194 DIVDSVTQQIFESAEKSGEKVKYAPLHSMENTKYENLVIPNKYIIVFKKDVSVKDMQIHK 253
           +++ S  ++I  +A + GE+VK APL S         +IP++YIIVFKKD + +++  HK
Sbjct: 43  EVLASFAKEITRAAAEKGEEVKLAPLVSSPQPAN---IIPHRYIIVFKKDATPEEISFHK 99

Query: 254 DLIARAQFQYASVSDETSS-----------------SILGGIEEAFNVANLFHGYIGHFN 296
           ++I+ A  +  +  D   S                 S  GGI+E+F++AN+ +GYIG+F 
Sbjct: 100 EIISEAHAESVAKLDSKDSFFAATKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFT 159

Query: 297 EQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARISHRDGLNLGSYNKYLYDDVA 356
           +++V FIR++  V+F+E+DS+V A+E DTQN APWGL+RISHR+ LNLGS+NKYLYDD A
Sbjct: 160 DEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDA 219

Query: 357 GEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGXXXX 416
           G+GVT+YVIDTGIN+ HK+F GRAVWGKT+P+ND+D DGNGHGTHCAGTIAS++YG    
Sbjct: 220 GKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKN 279

Query: 417 XXXXXXXXLRSDGSGTMSDVLKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLD 476
                   LRS+GSGTMSDV+KGVE+AA SHQ+A ++ KKGFKGSTANMSLGGGKS +LD
Sbjct: 280 AEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALD 339

Query: 477 LAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGASTLSDDRAYFSNWGKCVDVF 536
           LAV+AAVK+GIHFAVAAGNENQDACN+SPAA+ENAITVGASTLSDDRAYFSNWGKCVD+F
Sbjct: 340 LAVNAAVKAGIHFAVAAGNENQDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIF 399

Query: 537 APGLNILSTYIGSDEATATLSGTSMASPHVAGLLSYFLSMQPDADXXXXXXXXXXXXPAQ 596
           APGLN+LSTYIGS+ ATATLSGTSMASPHVAGLL+YFLS+QPD+D            PAQ
Sbjct: 400 APGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSLQPDSD--SEFFQASGITPAQ 457

Query: 597 LKKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNISDFWKPKSESSAEPN--ERAKEFELE 653
           LKKKLIAYSTK++  +LPE TPN L+YN  G ++SDFW    E   E    +  K+F+L 
Sbjct: 458 LKKKLIAYSTKDVLYELPEDTPNYLIYNGGGQDLSDFWGKSEEQVKEEGSIQDFKDFKLS 517

Query: 654 DLVDSAQWIADTWLNGIQQVFERMDL 679
           +L++S     D     ++ VF+++++
Sbjct: 518 ELIESFDTKTDLLFEEVRSVFDKLNI 543

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 550

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/517 (56%), Positives = 375/517 (72%), Gaps = 32/517 (6%)

Query: 189 IKEDDDIVDSVTQQIFESAEKSGEKVKYAPLHSMENTKYENLVIPNKYIIVFKKDVSVKD 248
           I   + IV S ++Q+ + A   GE V+ +PL S  + KY  L IP++YI+VFK+++S ++
Sbjct: 39  ITAGESIVSSFSKQMTKDAASKGESVELSPLVS-SSGKY--LAIPHRYIVVFKQNLSPEE 95

Query: 249 MQIHKDLIARAQFQYASVSDET-------------------------SSSILGGIEEAFN 283
           +  HK +++ A  Q  +  + T                         + +  GGI+++F+
Sbjct: 96  VDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQRSFSAQTREGGIQDSFD 155

Query: 284 VANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARISHRDGLN 343
           V+ L  GYIG+F +++V FIR++P+VDFVEQDS+V A E  TQN APWGL+RISHR+ LN
Sbjct: 156 VSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQNGAPWGLSRISHREKLN 215

Query: 344 LGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDGNGHGTHCA 403
           LGS+NKYLYDD AG+GVT+YVIDTG+N+ HK+F GRA WGKTIP ND D DGNGHGTHCA
Sbjct: 216 LGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTIPTNDLDQDGNGHGTHCA 275

Query: 404 GTIASKNYGXXXXXXXXXXXXLRSDGSGTMSDVLKGVEYAAFSHQKALREKKKGFKGSTA 463
           GTIASK+YG            LRS+GSG+MSDV+KGVE+AA SHQ A++E KKGFKGSTA
Sbjct: 276 GTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAKSHQDAVKENKKGFKGSTA 335

Query: 464 NMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGASTLSDDR 523
           NMSLGGGKS +LD+AV+AAVK+GIHFAVAAGNENQDACNSSPA++ENA+TVGASTL+DDR
Sbjct: 336 NMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPASAENAVTVGASTLADDR 395

Query: 524 AYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLSYFLSMQPDADXX 583
           AYFSNWGKCVD+FAPGLN+LSTYIGSD ATATLSGTSMASPHVAGLL+YFLS+QPD+D  
Sbjct: 396 AYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPHVAGLLTYFLSLQPDSD-S 454

Query: 584 XXXXXXXXXXPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNISDFWKPKSESSAE 642
                     P+QLKKKLIAYSTKN+  D+P+ T N L++N  G  + DFW    ES  +
Sbjct: 455 EYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGGGEGLDDFW--GKESVVD 512

Query: 643 PNERAKEFELEDLVDSAQWIADTWLNGIQQVFERMDL 679
             E     E+E  +D+ +   D     I++VF+ M++
Sbjct: 513 EVEDTISSEIESFIDALEEKTDVLYEEIREVFDHMNI 549

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
           (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/504 (57%), Positives = 370/504 (73%), Gaps = 20/504 (3%)

Query: 193 DDIVDSVTQQIFESAEKSGEKVKYAPLHSMENTKYENLVIPNKYIIVFKKDVSVKDMQIH 252
           + I+ S ++++ + A +SG  V  +PL +  N  Y+   IP++YI+VFK  V  +++  H
Sbjct: 44  ESILSSFSKEVTKKAAESGAGVTLSPLVTARNM-YD--AIPHRYIVVFKDRVLPEEVDFH 100

Query: 253 KDLIARAQFQ-----------YASVSDE----TSSSILGGIEEAFNVANLFHGYIGHFNE 297
            ++++ A  Q           + +  DE     ++S  GGI ++F+V  +  GYIG+F +
Sbjct: 101 MEVVSEAHAQSVGKLDANDAFFEATMDEEMGIMATSREGGILDSFDVNGMLRGYIGYFTQ 160

Query: 298 QLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARISHRDGLNLGSYNKYLYDDVAG 357
           ++V FIR++P+V FVEQDS+V+ANE DTQN APWGL+RISHR+ LNLGS+NKYLYDD AG
Sbjct: 161 EIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLSRISHREKLNLGSFNKYLYDDAAG 220

Query: 358 EGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGXXXXX 417
           +GVT+YVIDTGINI HK+F GRA WGKT+P ND D DGNGHGTHCAGTIASK+YG     
Sbjct: 221 KGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGVAKNA 280

Query: 418 XXXXXXXLRSDGSGTMSDVLKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDL 477
                  LRS+GSG+MSDV+KGVE+AA SHQ A+++ KKGFKGSTANMSLGGGKS +LD+
Sbjct: 281 NVVAVKVLRSNGSGSMSDVVKGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDM 340

Query: 478 AVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGASTLSDDRAYFSNWGKCVDVFA 537
           AV+AAVK+GIHFAVAAGNENQDACNSSPAA+ENAITVGASTL+DDRAYFSNWGKCVD+FA
Sbjct: 341 AVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFA 400

Query: 538 PGLNILSTYIGSDEATATLSGTSMASPHVAGLLSYFLSMQPDADXXXXXXXXXXXXPAQL 597
           PGLN+LSTYIGS+ ATATLSGTSMASPHVAGLL+YFLS+QPD+D            P+QL
Sbjct: 401 PGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSLQPDSD-SEYFHAAGGITPSQL 459

Query: 598 KKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNISDFWKPKSESSAEPNERAKEFELEDLV 656
           KKKLIAYSTKN   DLPE T N L+YN  G ++ DFW    E      +     E E ++
Sbjct: 460 KKKLIAYSTKNALGDLPEDTVNYLIYNGGGQDLDDFWVKDLEEKVADAKDNTASEFESII 519

Query: 657 DSAQWIADTWLNGIQQVFERMDLF 680
           D+ +   D     I+++FE +++ 
Sbjct: 520 DALEEKTDGLYEEIREIFEGLNII 543

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/491 (59%), Positives = 363/491 (73%), Gaps = 20/491 (4%)

Query: 205 ESAEKSGEKVKYAPLHSME--NTKYENLVIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQ 262
           ++ EK     K APL S    N    + +IPN+YI+VFKK V  +++  HK+ + +AQ Q
Sbjct: 123 KTLEKGRPNNKLAPLVSTAQFNPDAISKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQ 182

Query: 263 -----------YASVSDE-TSSSILGGIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVD 310
                      + S  D   S+S  GGI+++FN+ N+F GYIG+F ++++  IR +P+VD
Sbjct: 183 SVENLSAEDAFFTSTRDTYLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVD 242

Query: 311 FVEQDSIVHANEVDTQNNAPWGLARISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGIN 370
           FVE+DS+V A E DTQN+APWGLARISHR+ LNLGS+NKYLYDD AG GVT+YVIDTG+N
Sbjct: 243 FVERDSVVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVN 302

Query: 371 IKHKEFGGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGS 430
           I HK+F  RA+WGKTIP ND+D+DGNGHGTHCAGTIASK+YG            LRS+GS
Sbjct: 303 INHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGS 362

Query: 431 GTMSDVLKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFA 490
           GTMSDV+KGVEYAA +HQK  +EKKKGFKGSTANMSLGGGKS +LDLAV+AAV++GIHFA
Sbjct: 363 GTMSDVVKGVEYAAKAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFA 422

Query: 491 VAAGNENQDACNSSPAASENAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSD 550
           VAAGNENQDACN+SPA+++ AITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSD
Sbjct: 423 VAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSD 482

Query: 551 EATATLSGTSMASPHVAGLLSYFLSMQPDADXXXXXXXXXXXXPAQLKKKLIAYSTKNLF 610
           EATATLSGTSMASPHVAGLL+YFLS+QP +D            P QLKKKLI YSTK++ 
Sbjct: 483 EATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDIL 542

Query: 611 QDLPEKTPNLLVYN-AGHNISDFWKPKSESSAEPNERAKEFELEDLVDSAQWIADTWLNG 669
            D+PE TPN L+YN  G ++S FW    +S   P+    E  +++ + S     D     
Sbjct: 543 FDIPEDTPNFLIYNGGGQDLSAFWNDTKKS--HPSGSKHELNMDEFIGSK---TDLLFEQ 597

Query: 670 IQQVFERMDLF 680
           ++ V +++++ 
Sbjct: 598 VRDVLDKLNII 608

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
           PRB1Vacuolar proteinase B (yscB), a serine protease of
           the subtilisin family; involved in protein degradation
           in the vacuole and required for full protein degradation
           during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/490 (59%), Positives = 363/490 (74%), Gaps = 24/490 (4%)

Query: 208 EKSGEKVKYAPLHSME--NTKYENLVIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQ--- 262
           EK     + APL S    N    + +IPN+YIIVFK+    +++  HK+ + +AQ Q   
Sbjct: 153 EKGRHHNRLAPLVSTAQFNPDAISKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVE 212

Query: 263 --------YASVSDET-SSSILGGIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVE 313
                   + S  D + S+S  GGI+++FN+ NLF GYIG+F +++V  IR +P+VDFVE
Sbjct: 213 NLSAEDAFFISTKDTSLSTSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVE 272

Query: 314 QDSIVHANEVDTQNNAPWGLARISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKH 373
           +DSIV A E DTQN+APWGLARISHR+ LNLGS+NKYLYDD AG GVT+YVIDTG+NI H
Sbjct: 273 RDSIVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINH 332

Query: 374 KEFGGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTM 433
           K+F  RA+WGKTIP ND+D+DGNGHGTHCAGTIASK+YG            LRS+GSGTM
Sbjct: 333 KDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTM 392

Query: 434 SDVLKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAA 493
           SDV+KGVEYAA +HQK  +EKKKGFKGSTANMSLGGGKS +LDLAV+AAV+ GIHFAVAA
Sbjct: 393 SDVVKGVEYAAKAHQKEAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAA 452

Query: 494 GNENQDACNSSPAASENAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEAT 553
           GNENQDACN+SPA+++ AITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSD+AT
Sbjct: 453 GNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDAT 512

Query: 554 ATLSGTSMASPHVAGLLSYFLSMQPDADXXXXXXXXXXXXPAQLKKKLIAYSTKNLFQDL 613
           ATLSGTSMASPHVAGLL+YFLS+QP +D            P QLKKKLI YSTK++  D+
Sbjct: 513 ATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDI 572

Query: 614 PEKTPNLLVYN-AGHNISDFWK--PKSESSAEPNERAKEFELEDLVDSAQWIADTWLNGI 670
           PE TPN+L+YN  G ++S FW    KS SS       +E  +++ + S     D   + +
Sbjct: 573 PEDTPNVLIYNGGGQDLSAFWNDTKKSHSSG----FKQELNMDEFIGSK---TDLIFDQV 625

Query: 671 QQVFERMDLF 680
           + + +++++ 
Sbjct: 626 RDILDKLNII 635

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON}
           YEL060C (REAL)
          Length = 664

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/487 (59%), Positives = 361/487 (74%), Gaps = 19/487 (3%)

Query: 209 KSGEKVKYAPLHSME--NTKYENLVIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQ---- 262
           K   + K APL S E  N      +IPN+YIIVFKKDV  ++   H++ + +AQ Q    
Sbjct: 182 KDHHRGKLAPLVSTEQFNPDAITKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVEN 241

Query: 263 -------YASVSDET-SSSILGGIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQ 314
                  + S  D   SSS  GGI+++FN+ +LF GYIG+F +++V  IR +P+VDFVE+
Sbjct: 242 LAAEDAFFISTRDAALSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEK 301

Query: 315 DSIVHANEVDTQNNAPWGLARISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHK 374
           DS+V A + DTQN+APWGLAR+SHR+ LNLGS+NKYLYDD AG GVT+YVIDTG+N+ HK
Sbjct: 302 DSVVEATDFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHK 361

Query: 375 EFGGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTMS 434
           +F  RA+WGKTIP ND+D+DGNGHGTHCAGTIASK+YG            LRS+GSGTMS
Sbjct: 362 DFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMS 421

Query: 435 DVLKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAG 494
           DVLKGVEYAA +HQK   EKKKGFKGSTANMSLGGGKS +LDLAV+AAV++GIHFAVAAG
Sbjct: 422 DVLKGVEYAAKAHQKQAEEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAG 481

Query: 495 NENQDACNSSPAASENAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATA 554
           NENQDACN+SPA+++ AITVGASTLSDDRAYFSN+GKCVDVFAPGLNILSTYIGSDEATA
Sbjct: 482 NENQDACNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATA 541

Query: 555 TLSGTSMASPHVAGLLSYFLSMQPDADXXXXXXXXXXXXPAQLKKKLIAYSTKNLFQDLP 614
           TLSGTSMASPHVAGLL+YFLS+QP +D            P QLKKKLI YSTK++  D+P
Sbjct: 542 TLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIP 601

Query: 615 EKTPNLLVYN-AGHNISDFWKPKSESSAEPNERAKEFELEDLVDSAQWIADTWLNGIQQV 673
           + TPN L+YN  G ++S FW    +S +    + +E  L++ + S     D     ++ V
Sbjct: 602 DDTPNALIYNGGGQDLSAFWNDTKKSHSSSGFK-QELNLDEFIGSK---TDLIFEQVRDV 657

Query: 674 FERMDLF 680
            +++++ 
Sbjct: 658 LDKLNII 664

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
           Anc_6.14 YOR003W
          Length = 564

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/481 (60%), Positives = 360/481 (74%), Gaps = 19/481 (3%)

Query: 208 EKSGEKVKYAPLHSMENTKYENLVIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYAS-- 265
            K GE V  APL    N        P++YI+V K   S +++ +H + I ++Q Q     
Sbjct: 95  HKMGEGV--APLSIPPN------AFPHRYIVVLKHS-SPEEIALHMEAITQSQLQSVGEL 145

Query: 266 VSDETSSS-----ILGGIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHA 320
             D+   S       GGI+++F+VA L +GY+G+F + +V+ IR SP+VDFVE DS VHA
Sbjct: 146 AQDDPFFSAQGVRTTGGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHA 205

Query: 321 NEVDTQNNAPWGLARISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRA 380
           +E DTQN APWGL+RISHR+ LNLGS+NKYL+DD AG+GVT+YVIDTGIN+KH++F GRA
Sbjct: 206 SEFDTQNGAPWGLSRISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRA 265

Query: 381 VWGKTIPENDQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTMSDVLKGV 440
            WGKTIP ND+D+DGNGHGTHCAGTIASK+YG            LRS+GSG+MSDV+KGV
Sbjct: 266 HWGKTIPTNDEDLDGNGHGTHCAGTIASKHYGVAKGADVVAVKVLRSNGSGSMSDVIKGV 325

Query: 441 EYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDA 500
           E+AA SHQKA+++KKKGFKGSTANMSLGGGKS +LDLAV+AAVK+GIHFAVAAGNENQDA
Sbjct: 326 EFAAQSHQKAVKDKKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDA 385

Query: 501 CNSSPAASENAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTS 560
           CN+SPAA+E A+TVGASTLSDDRAYFSN+GKCVD+FAPGLNILSTYIGSD+ATATLSGTS
Sbjct: 386 CNTSPAAAEQAVTVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTS 445

Query: 561 MASPHVAGLLSYFLSMQPDADXXXXXXXXXXXXPAQLKKKLIAYSTKNLFQDLPEKTPNL 620
           MASPHVAGLL+YFLS+QPD+D            P QLKKKLIAYSTK++  DLPE TPN 
Sbjct: 446 MASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNA 505

Query: 621 LVYN-AGHNISDFWKPKSESSAEPNERAKEFELEDLVDSAQWIADTWLNGIQQVFERMDL 679
           L+YN  GH +  FW        E N R ++ +L++L D+     D   + ++ V +R+++
Sbjct: 506 LIYNGGGHGLKGFW--DGHDKQEANTRFQDTDLQELSDNLGAKTDALFDQVRDVLDRLNI 563

Query: 680 F 680
            
Sbjct: 564 I 564

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/488 (58%), Positives = 360/488 (73%), Gaps = 20/488 (4%)

Query: 208 EKSGEKVKYAPLHSMENTKYENL--VIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQ--- 262
           EK+    K APL S        +  +IPN+YIIVFKK V  +    HK+ + +AQ Q   
Sbjct: 126 EKARHNEKLAPLVSTAQFDPAAMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVE 185

Query: 263 --------YASVSDET-SSSILGGIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVE 313
                   + S  D + S+S  GGI+++FN+ N+F GYIG+F ++++  IR +P+VDFVE
Sbjct: 186 NLSAEDAFFISTRDSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVE 245

Query: 314 QDSIVHANEVDTQNNAPWGLARISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKH 373
           +DS+V A + DTQN+APWGLARISHR+ LNLGS+NKYLYDD AG GVT+YVIDTG+N+ H
Sbjct: 246 RDSVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNH 305

Query: 374 KEFGGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTM 433
           K+F  RA+WGKTIP ND+D+DGNGHGTHCAGTIASK+YG            LRS+GSGTM
Sbjct: 306 KDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTM 365

Query: 434 SDVLKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAA 493
           SDV+KGVEYAA +HQK  +EKKKGFKGSTANMSLGGGKS +LDLAV+AAV++GIHFAVAA
Sbjct: 366 SDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAA 425

Query: 494 GNENQDACNSSPAASENAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEAT 553
           GNENQDACN+SPA+++ AITVGASTLSDDRAYFSNWGKCVD+FAPGLNILSTYIGSD+AT
Sbjct: 426 GNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDAT 485

Query: 554 ATLSGTSMASPHVAGLLSYFLSMQPDADXXXXXXXXXXXXPAQLKKKLIAYSTKNLFQDL 613
           ATLSGTSMASPHVAGLL+YFLS+QP +D            P QLK KLI YSTK++  D+
Sbjct: 486 ATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDV 545

Query: 614 PEKTPNLLVYN-AGHNISDFWKPKSESSAEPNERAKEFELEDLVDSAQWIADTWLNGIQQ 672
           PE TPN L+YN  G ++S FW    +S +  +   +E  +++ + S     D     ++ 
Sbjct: 546 PEDTPNALIYNGGGQDLSAFWNDTKKSHS--SRFKQELNMDEFIGSK---TDLIFEQVRD 600

Query: 673 VFERMDLF 680
           V +++++ 
Sbjct: 601 VLDKLNII 608

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 561

 Score =  566 bits (1460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/482 (58%), Positives = 358/482 (74%), Gaps = 23/482 (4%)

Query: 217 APLHSMENTKYENLVIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQ-----------YAS 265
           APL ++ +   +   IPN+YIIVFKKD S  +++ H++L++    +           + +
Sbjct: 85  APLSTVNDIANK---IPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTA 141

Query: 266 VSDETSS------SILGGIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVH 319
            S E S       S+ GGI+++F++A    GY+G+F ++++ FIR SP+V+FVE+DS+V 
Sbjct: 142 TSGEHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVF 201

Query: 320 ANEVDTQNNAPWGLARISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGR 379
           +N  +TQN+APWGLARISHR+ LNLGS+NKYLYDD AG+GVTAYV+DTG+N+ HK+F GR
Sbjct: 202 SNSFNTQNSAPWGLARISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGR 261

Query: 380 AVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTMSDVLKG 439
           AVWGKTIP++D DVDGNGHGTHCAGTI S +YG            LRS+GSGTMSDV+KG
Sbjct: 262 AVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKG 321

Query: 440 VEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQD 499
           VEY A +H+KA+ E+KKGFKGSTANMSLGGGKS +LDLAV+AAVK+G+HFAVAAGNENQD
Sbjct: 322 VEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQD 381

Query: 500 ACNSSPAASENAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGT 559
           ACN+SPAA+ENAITVGASTLSD+RAYFSNWGKCVD+F PGLNILSTYIGSD ATATLSGT
Sbjct: 382 ACNTSPAAAENAITVGASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGT 441

Query: 560 SMASPHVAGLLSYFLSMQPDADXXXXXXXXXXXXPAQLKKKLIAYSTKNLFQDLPEKTPN 619
           SMA+PHV GLL+YFLS+QPDAD            P+QLKKKLI +STKN+  DLPE T N
Sbjct: 442 SMATPHVVGLLTYFLSLQPDAD-SEYFHAAGGITPSQLKKKLIDFSTKNVLSDLPEDTVN 500

Query: 620 LLVYN-AGHNISDFWKPKSESSAEPNERAKEFELEDLVDSAQWIADTWLNGIQQVFERMD 678
            L+YN  G ++ D W        EP+    EF LE L++S     D   + ++Q+ ++ +
Sbjct: 501 YLIYNGGGQDLDDLWGKDYSIGKEPSAN-PEFSLESLINSLDSKTDAIFDDVRQLLDQFN 559

Query: 679 LF 680
           + 
Sbjct: 560 II 561

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa]
           {ON} Anc_6.14 YOR003W
          Length = 573

 Score =  566 bits (1458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/478 (59%), Positives = 352/478 (73%), Gaps = 20/478 (4%)

Query: 212 EKVKYAPLHSMENTKYENLVIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYASV--SDE 269
           E    APL+S   + +   +IP++YII FKKDV+ +++  H+  I   Q Q  +    D 
Sbjct: 107 ESPAIAPLYSQ--SLHPQNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDH 164

Query: 270 TSSSILGGIE------EAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEV 323
              + + G++      ++FN+ +L  GYIG+F + ++ FIRL+P+V FVEQDS V+ NE 
Sbjct: 165 PYFNSVEGLDLQQPIIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEF 224

Query: 324 DTQNNAPWGLARISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWG 383
           DTQN APWGLARISHR+ LNLGS+NKYL+DD AGEGVTAYVIDTG+N++H +F GRA WG
Sbjct: 225 DTQNGAPWGLARISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWG 284

Query: 384 KTIPENDQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTMSDVLKGVEYA 443
           KTIP ND+D+DGNGHGTHCAGTIASK+YG            LRS+GSG+MSDVLKGVEYA
Sbjct: 285 KTIPNNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVLKGVEYA 344

Query: 444 AFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNS 503
             SH   ++ KK GFKGSTANMSLGGGKS SLDLAV+AAVK+GIHFAVAAGNENQDACN+
Sbjct: 345 TASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNT 404

Query: 504 SPAASENAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMAS 563
           SPA+++ AITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSD+ATATLSGTSMAS
Sbjct: 405 SPASAKYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMAS 464

Query: 564 PHVAGLLSYFLSMQPDADXXXXXXXXXXXXPAQLKKKLIAYSTKNLFQDLPEKTPNLLVY 623
           PHVAGLLSYFLS+QP+ D            PAQLKK+LI+Y TK++  D+PE TPN+LV+
Sbjct: 465 PHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVF 524

Query: 624 N-AGHNISDFWKPKSESSAEPNERAKEFELEDLVDSAQWIADTWLNGIQQVFERMDLF 680
           N AG ++SDFW     +  E NE  K  +L         + D   +    +F++M+L 
Sbjct: 525 NGAGQDLSDFWNISKPADLESNEVYKNLDL---------VGDVLYDQFTGIFKKMNLL 573

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
           YEL060C
          Length = 695

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/477 (59%), Positives = 355/477 (74%), Gaps = 38/477 (7%)

Query: 194 DIVDSVTQQIFESAEKSGEKV------KYAPLHSMENTKY------------ENLVIPNK 235
           D+V   ++QI ESA K G+ V      K APL  +  T Y             + +IPN+
Sbjct: 45  DVVAKYSEQIIESARKIGKSVQDSVNLKMAPL--VTPTPYPVVSGASANSNANSNIIPNR 102

Query: 236 YIIVFKKDVSVKDMQIHKDLIARAQ-------------FQYASVSDETSSSILGGIEEAF 282
           YI+VFKK +  +++  HK+LI + Q             F  +++ DE+ +   GGI   F
Sbjct: 103 YIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFFSASAIEDESINQ--GGILTTF 160

Query: 283 NVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARISHRDGL 342
           N++NL +GY+G+F +++++ IR++P+V++VE+DS+V A E D QNNAPWGLARISHR+ L
Sbjct: 161 NISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHRERL 220

Query: 343 NLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDGNGHGTHC 402
           NLGS+NKYLYDD AG+GVT YVIDTGIN +H +F  RAVWGKTIP ND+D+DGNGHGTHC
Sbjct: 221 NLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHGTHC 280

Query: 403 AGTIASKNYGXXXXXXXXXXXXLRSDGSGTMSDVLKGVEYAAFSHQKALREKKKGFKGST 462
           AGTIAS +YG            LRS+GSG+MSDV+KGVE+AA SH KA +EKKKGFKGST
Sbjct: 281 AGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAESHIKAAKEKKKGFKGST 340

Query: 463 ANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGASTLSDD 522
           ANMSLGGGKS +LDLAV+AAV +GIHFAVAAGNENQDACN+SPA++E AITVGASTLSDD
Sbjct: 341 ANMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTLSDD 400

Query: 523 RAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLSYFLSMQPDADX 582
           RAYFSNWGKCVD+FAPGLNILSTYIG D+ATATLSGTSMASPHVAGLL+YFLS+QP +D 
Sbjct: 401 RAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPGSD- 459

Query: 583 XXXXXXXXXXXPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNISDFWKPKSE 638
                      PAQ+KKKLI YS+K++  DLPE TPN L++N AG N+ D W  KS+
Sbjct: 460 -SEFFDPTELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLWNKKSQ 515

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar
           to uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
           protease B or uniprot|P25036 Saccharomyces cerevisiae
           YOR003w YSP3
          Length = 468

 Score =  531 bits (1369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/472 (59%), Positives = 342/472 (72%), Gaps = 26/472 (5%)

Query: 231 VIPNKYIIVFKK------------DVSVKDMQIHKDLIARAQFQYASVSDETSSSILGGI 278
           ++P+KYI+V KK            DVS       +DL     F +  V+ E      GGI
Sbjct: 1   MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDF-FNFVNAEGLPR--GGI 57

Query: 279 EEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARISH 338
           ++ FN+ +LF G IG+F E +V+ +  S IV+FVE+DS+VHA+  DTQNNAPWGLARISH
Sbjct: 58  KDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISH 117

Query: 339 RDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDGNGH 398
           RD LNLG++NKYLYD+  GEGVTAYVIDTGIN+KH EF GRA WGKTIP ND D+DGNGH
Sbjct: 118 RDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGH 177

Query: 399 GTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTMSDVLKGVEYAAFSHQKALREKKKGF 458
           GTHCAGTIASK+YG            L+SDGSGTMSDV+KGVEYAA +H K  +  KK F
Sbjct: 178 GTHCAGTIASKHYGIAKKANVVAVKVLKSDGSGTMSDVIKGVEYAAQAHLKESKNNKK-F 236

Query: 459 KGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGAST 518
           KGSTANMSLGGGKS +LD+AV+AAV +GIHFAVAAGNENQDACN+SPA++E AITVGAST
Sbjct: 237 KGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGAST 296

Query: 519 LSDDRAYFSNWGKCVDVFAPGLNILSTYIG-SDEATATLSGTSMASPHVAGLLSYFLSMQ 577
           LSDDRAYFSNWGKCVD+FAPGLNILSTYIG ++  TA+LSGTSMASPHVAGLL+YFLS+Q
Sbjct: 297 LSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQ 356

Query: 578 PDADXXXXXXXXXXXXPAQLKKKLIAYSTKNLFQDLPEK-TPNLLVYN-AGHNISDFWKP 635
           PD+D            PAQLKKKLIAYSTKN+  DLP+  +PNLL+YN AG ++  FW  
Sbjct: 357 PDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFWNS 416

Query: 636 KS--ESSAE-PNER-AKEFELEDL---VDSAQWIADTWLNGIQQVFERMDLF 680
            S  E SAE P +R A E  L+ L   V       D+    ++ + ++M++ 
Sbjct: 417 TSADEQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 548

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/480 (56%), Positives = 342/480 (71%), Gaps = 20/480 (4%)

Query: 215 KYAPLHSMENTKYENLVIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYASVSDETSS-- 272
           ++APL   E+T     V+ N+YII+FKK V+ +++  H++LI +   Q  S   E  S  
Sbjct: 75  RFAPLVVPEDTLG---VLENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEEHSFF 131

Query: 273 ----------SILGGIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANE 322
                     S LGGI+  F++  +  GY G+F  +++  IR+SP+++ VEQDS+V+  +
Sbjct: 132 EGIRLDGVYDSPLGGIDHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVVYTQK 191

Query: 323 VDTQNNAPWGLARISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVW 382
            DT+N APWGLARISHR+ LNLGSYNKYLYD+  G GVT+YVIDTG+N+ H +FGGRA W
Sbjct: 192 ADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGGRAKW 251

Query: 383 GKTIPENDQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTMSDVLKGVEY 442
           GKTIP  D D DGNGHGTHCAGTI S  YG            LRS+GSG+MSDVLKGVE+
Sbjct: 252 GKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEW 311

Query: 443 AAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACN 502
           AA  HQ A+++KK GFKGSTANMSLGGGKS SLD AV+AAV +G++FAVAAGNE+QDACN
Sbjct: 312 AAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQAVNAAVAAGLNFAVAAGNEDQDACN 371

Query: 503 SSPAASENAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMA 562
           +SPA++   ITVGASTLSDDRAYFSN+GKCVDVFAPGLNILSTYIGSD +TATLSGTSMA
Sbjct: 372 TSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDSSTATLSGTSMA 431

Query: 563 SPHVAGLLSYFLSMQPDADXXXXXXXXXXXXPAQLKKKLIAYSTKNLFQDLPEKTPNLLV 622
           SPHVAGLL+YFLS+QP +D            P QLKKKL+A+STK++  D+P  TPNLL+
Sbjct: 432 SPHVAGLLAYFLSLQPGSD--SEFDAGSSISPDQLKKKLLAFSTKDVLSDIPSGTPNLLI 489

Query: 623 YN-AGHNISDFWKPKSESSA-EPNERAKEFELEDLVDSAQWIADTWLNGIQQVFERMDLF 680
           YN  G ++S FW  K  +   E NE+  + EL DLVD      D     I+ + +R+D+ 
Sbjct: 490 YNGGGGDLSGFWGSKEVAQELEFNEKV-DLELHDLVDELGSKTDAVFGQIRGLMDRLDII 548

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 20/25 (80%)

Query: 1  MKLDKTLVSVATLATLGSSLVIPEF 25
          MK  K+++ VATLA LGS+L+IPE 
Sbjct: 1  MKFQKSVIPVATLAGLGSALIIPEL 25

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
           Anc_6.14
          Length = 704

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/469 (59%), Positives = 345/469 (73%), Gaps = 21/469 (4%)

Query: 231 VIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYAS------------VSDETSSSILGGI 278
           ++PNKYIIVFK  +++ ++  HK+LI+  Q Q AS              +E  S   GGI
Sbjct: 238 ILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPHHHFFHSTSEEEEESFRNGGI 297

Query: 279 EEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARISH 338
             +FN+ N+  GY G+F ++++  IRL+P+V +VE+DSIV   E +TQNNAPWGL+RISH
Sbjct: 298 ISSFNINNILSGYSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLSRISH 357

Query: 339 RDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDGNGH 398
           R+ LNLGS+NKYLYDD AG+GVT +VIDTGIN+ H +FG RA+WGKTIP NDQD+DGNGH
Sbjct: 358 RERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDIDGNGH 417

Query: 399 GTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTMSDVLKGVEYAAFSHQKALREKKKGF 458
           GTHCAGTIAS +YG            LRS+GSG+MSDV+KGVE+AA +H     + KK +
Sbjct: 418 GTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAETHLNN-EKNKKDY 476

Query: 459 KGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGAST 518
           KGSTANMSLGGGKS +LDLAV+AAV++GIHF+VAAGNENQDACNSSPA++ENAITVGAST
Sbjct: 477 KGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITVGAST 536

Query: 519 LSDDRAYFSNWGKCVDVFAPGLNILSTYIGS-DEATATLSGTSMASPHVAGLLSYFLSMQ 577
           LSDDRAYFSNWG+CVDVFAPGLNILSTY+G  ++ TATLSGTSMASPHVAGLL+YFLS+Q
Sbjct: 537 LSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYFLSLQ 596

Query: 578 PDADXX-XXXXXXXXXXPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNISDFWKP 635
           PD+              P QLKKKLIAYST ++  DLP+ TPN L+YN AG +ISD W  
Sbjct: 597 PDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDISDLWNG 656

Query: 636 KSESSA--EPNERAKEFELEDLVDSAQWIA--DTWLNGIQQVFERMDLF 680
           K +  A  EP    K    E+LVDS       D + + I+ VFE+M++ 
Sbjct: 657 KVQEQAHEEPAHEDK-INFENLVDSDSMSGKTDLFFDQIRNVFEKMNII 704

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
           Anc_6.14 YOR003W
          Length = 531

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/506 (54%), Positives = 348/506 (68%), Gaps = 25/506 (4%)

Query: 176 GRKHNPPKQPVYNIKEDDDIVDSVTQQIFESAEKSGEKVKYAPLHSMENTKYENLVIPNK 235
           GR H+ PK       E D+       +  +  +++ ++ + APL++  +    +    NK
Sbjct: 50  GRPHHGPKH------EKDE------HRPCKHGKEAHDEEELAPLYTPGSALSASSSRSNK 97

Query: 236 YIIVFKKDVSVKDMQIHKDLIARAQFQYASVSDETSSSILGGIEEAFNVANLFHGYIGHF 295
           YII+FK+ V+ + +  HK L+ +   +    SD ++  I+  + ++F++  +  GY+   
Sbjct: 98  YIILFKEGVTAEQISAHKQLLQQVLLE---TSDVSAQGIVADVLDSFDLEGVLSGYVAEL 154

Query: 296 NEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARISHRDGLNLGSYNKYLYDDV 355
           +  +++ +R SP V  VEQDS VH NE DTQNNAPWGLARISHRD L+LGS+NKYLYDD 
Sbjct: 155 SPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPLSLGSFNKYLYDDA 214

Query: 356 AGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGXXX 415
           AGEGV +Y+IDTGIN+KHKEF GRA WGKTIP+ND D DGNGHGTHCAGTIASK+YG   
Sbjct: 215 AGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAK 274

Query: 416 XXXXXXXXXLRSDGSGTMSDVLKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSL 475
                    LRS+GSG+MSDV+ GVE+AA  H    +   K FKGSTANMSLGGGKS SL
Sbjct: 275 RANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSL 334

Query: 476 DLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGASTLSDDRAYFSNWGKCVDV 535
           D  VDAAVK G+HF+VAAGNENQDACN+SPAASE AITVGASTLSDDRAYFSNWG CVD+
Sbjct: 335 DRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSDDRAYFSNWGSCVDI 394

Query: 536 FAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLSYFLSMQPDADXXXXXXXXXXXXPA 595
           FAPGLNILSTY GSD+ATATLSGTSMASPHVAGLL+YFLS+QP  +            P 
Sbjct: 395 FAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQP--EKSSQFGTSAQITPE 452

Query: 596 QLKKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNISDFWKPKSESSAEPNERAKEFELED 654
           QLKKKL+ YSTK +  DLPE TPN L+YN  G ++SDFW  K + S +P   A E+    
Sbjct: 453 QLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWGDKGKKSHKP-LFAHEY---- 507

Query: 655 LVDSAQWIADTWLNGIQQVFERMDLF 680
             D+    +D     ++ +F ++++F
Sbjct: 508 --DNVWASSDAMFEQVRAMFGKLNIF 531

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL060C
           (PRB1) and YOR003W (YSP3)
          Length = 541

 Score =  521 bits (1342), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 263/473 (55%), Positives = 331/473 (69%), Gaps = 26/473 (5%)

Query: 232 IPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYASVSDE-----------------TSSSI 274
           IP+KYI+VF++ VS ++   H +L+  A  +  +  DE                  ++  
Sbjct: 71  IPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENNEFGIAATRA 130

Query: 275 LGGIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLA 334
            GGIE  F +     GY+G+F E +V  +R +P V FVE+DS+V A++  TQN APWGLA
Sbjct: 131 EGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPWGLA 190

Query: 335 RISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVD 394
           R+SHR+ LN GS+NKYLYDD +GEGVT+YVIDTGINI H +F  RA+WGKTIP ND D D
Sbjct: 191 RVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDADYD 250

Query: 395 GNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTMSDVLKGVEYAAFSHQKALREK 454
           GNGHGTHCAGTIASK YG            LRS+G+G+MSDVL+GVEYA  +H+KA  + 
Sbjct: 251 GNGHGTHCAGTIASKTYGVAKKANVVAVKVLRSNGTGSMSDVLRGVEYAVKAHRKAAEKA 310

Query: 455 KKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITV 514
            KGFKGSTANMSLGGG+S++LDLAVDAAV +GIHFAVAAGNENQDACN+SPAAS+ AITV
Sbjct: 311 DKGFKGSTANMSLGGGRSQALDLAVDAAVDAGIHFAVAAGNENQDACNTSPAASQKAITV 370

Query: 515 GASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLSYFL 574
           GASTL+DDRAYFSNWG+CVD+FAPG+NILSTYIGSD A ATLSGTSMASPHVAGLL+YFL
Sbjct: 371 GASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPHVAGLLTYFL 430

Query: 575 SMQPDADXXXXXXXXXXXXPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNISDFW 633
           S+QPD D            P  LKKK+I + TK+    LP +T N+L+YN  G ++SDFW
Sbjct: 431 SLQPDGD--SEFRNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGGGADLSDFW 488

Query: 634 --KPKSESSAE----PNERAKEFELEDLVDSAQWIADTWLNGIQQVFERMDLF 680
             KPK  S  +     +E A   +L+ L+   +   D   +G + + +RM++ 
Sbjct: 489 GNKPKKVSGPKFTYADDEEAMGSDLDRLIHELESSTDAMFSGFRTILDRMNII 541

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
           Ashbya gossypii ACR012C
          Length = 575

 Score =  516 bits (1330), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 261/471 (55%), Positives = 325/471 (69%), Gaps = 26/471 (5%)

Query: 232 IPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYASVSDE----------------TSSSIL 275
           IP++YI++FK  V+  D+ +H+DL+  A  +  +  D                 ++ S+ 
Sbjct: 109 IPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVE 168

Query: 276 GGIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLAR 335
           GGIEE F +A    GY G+F + ++  IR S +V  +EQDSIVHA++ +TQ  APWGLAR
Sbjct: 169 GGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLAR 228

Query: 336 ISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDG 395
           +SHR+ LNLGS+NKYLYDD AG+GVTAYVIDTGINI H EF GRA WGKTIP ND D DG
Sbjct: 229 VSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDG 288

Query: 396 NGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTMSDVLKGVEYAAFSHQKALREKK 455
           NGHGTHCAGTIASK YG            LR++G+GTMSDVL+GVEY    H+KA  +  
Sbjct: 289 NGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKASGDPN 348

Query: 456 KGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVG 515
             FKGSTANMSLGGGKS +L+LAVDAAV +GIHFAVAAGNENQDACN+SPA+S+  ITV 
Sbjct: 349 --FKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVA 406

Query: 516 ASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLSYFLS 575
           ASTLSDDRAYFSNWG CVD+FAPGLNILSTYIGSD A ATLSGTSMASPHVAGLL+YFLS
Sbjct: 407 ASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLS 466

Query: 576 MQPDADXXXXXXXXXXXXPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNISDFWK 634
           +QPD+             P  LKKK++AY +KNL  ++P +T N L++N  G ++  FW 
Sbjct: 467 LQPDS--GSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWN 524

Query: 635 PKS-----ESSAEPNERAKEFELEDLVDSAQWIADTWLNGIQQVFERMDLF 680
            K      E  +  + +A +FE E L+D     + +    I+   +R+DL 
Sbjct: 525 SKCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 575

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa]
           {ON} complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  509 bits (1312), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 251/449 (55%), Positives = 319/449 (71%), Gaps = 25/449 (5%)

Query: 231 VIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQ-------------YASVSDETSSSILGG 277
           VIP  YI+VF + V+  ++ +H + +++ Q Q              ++ SD  S+ +LGG
Sbjct: 34  VIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVNSNGLLGG 93

Query: 278 IEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARIS 337
           + + F + N  HGY G F +++V+F+RLSP+V F+E+DS+VH  E  TQ NAPWGLARIS
Sbjct: 94  VRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLARIS 153

Query: 338 HRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDGNG 397
           HR  LNL ++NKYLYDD+ G+GV AYVIDTGINI + +FGGRA WGKTIP  + +VDGNG
Sbjct: 154 HRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEANVDGNG 213

Query: 398 HGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTMSDVLKGVEYAAFSHQKALREKKKG 457
           HGTH AGTIAS +YG            LRS+G+G+MSDVLKGVEY   +HQ+ +     G
Sbjct: 214 HGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSMSDVLKGVEYVVGAHQRDV--GTAG 271

Query: 458 FKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGAS 517
           FKGS ANMSLGGGKSRSLDLAV+AAV +G+HFAVAAGNENQDACN+SPAA+E AITVGAS
Sbjct: 272 FKGSVANMSLGGGKSRSLDLAVNAAVGAGVHFAVAAGNENQDACNTSPAAAERAITVGAS 331

Query: 518 TLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLSYFLSMQ 577
           TLSD RAYFSNWG+CV +FAPGLNILSTYIGS +ATATLSGTSMASPH+AGL++YFLS+Q
Sbjct: 332 TLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVAYFLSLQ 391

Query: 578 PDADXXXXXX-XXXXXXPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNISDFWKP 635
           P                P QLKKK++A+ TKN  +DLP  TPN++ YN AG ++ DFW  
Sbjct: 392 PAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKSLEDFWN- 450

Query: 636 KSESSAEPNERAKEFELEDLVDSAQWIAD 664
                   N+  K ++   + +  Q+I +
Sbjct: 451 -------ANDYVKNYQSLVITEQLQFILN 472

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
           YOR003W
          Length = 502

 Score =  510 bits (1314), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 251/438 (57%), Positives = 324/438 (73%), Gaps = 21/438 (4%)

Query: 212 EKVKYAPLHSMENTKYENLVIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYASVSD--- 268
           +  K++ L  + N   EN +IP++YIIVFK  VS + +Q HK+LI     Q +S      
Sbjct: 39  DSAKFSSLAPVHNADAEN-IIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDF 97

Query: 269 -----------ETSSSILGGIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSI 317
                      E+    LGGI   F++++L  GYI + +++L+ FIRL+P++ F+E D++
Sbjct: 98  TEYLQTDINVPESMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTM 157

Query: 318 VHANEVDTQNNAPWGLARISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFG 377
           VH  + +TQNNAPWGLARISHR+ LNL ++NKYLYDD AG+ V AYVIDTG+++ H EF 
Sbjct: 158 VHTTDFNTQNNAPWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFH 217

Query: 378 GRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTMSDVL 437
            RA WGKTIP NDQD+DGNGHGTH AGTI S++YG            LRS+GSG+MSDV+
Sbjct: 218 SRAHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVV 277

Query: 438 KGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNEN 497
           KGVE+A  SH + ++ +K   KGS ANMSLGGGKS +LDLAV+AAVK+GIHFAVAAGNEN
Sbjct: 278 KGVEFAVSSHLERMKNEKN-LKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNEN 336

Query: 498 QDACNSSPAASENAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGS-DEATATL 556
           Q+ACNSSPA++E A+TVGAST+SD+RAYFSNWG+CVD+FAPGLNILSTYIG+ D+ TATL
Sbjct: 337 QNACNSSPASAEQAVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATL 396

Query: 557 SGTSMASPHVAGLLSYFLSMQPDADXXXXXXXXXXXXPAQLKKKLIAYSTKNLFQDLPEK 616
           SGTSMASPHVAGLL+Y+LS+QP+               +QLKKKLI Y+TK++ +DLPE 
Sbjct: 397 SGTSMASPHVAGLLAYYLSLQPE---KSSEFSTRAISTSQLKKKLIEYATKDVLEDLPEG 453

Query: 617 TPNLLVYN-AGHNISDFW 633
           TPN+L+YN  G ++SDFW
Sbjct: 454 TPNVLIYNGGGQDLSDFW 471

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
           YOR003W
          Length = 585

 Score =  505 bits (1301), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 274/504 (54%), Positives = 346/504 (68%), Gaps = 34/504 (6%)

Query: 196 VDSVTQQI---FESAEKSGEKVKYAPLHSMENTKYENLVIPNKYIIVFKKDVSVKDMQIH 252
           V  VT QI   ++ A  +   ++ A LH       ++    ++YIIVFKK V  + +  H
Sbjct: 97  VKDVTDQILAYYQHASPASRGLELAALHDNGVGTADH----DRYIIVFKKGVFKEQVDQH 152

Query: 253 KDLIA----RAQFQYASVSDETSSSILGGIE---EAFNVANLFHGYIGHF-NEQLVQFIR 304
             +++    R   +    +   +S++  G +   + F VA  F GYI    + ++V FIR
Sbjct: 153 LKMMSALFRRLSEEQRPAAAPGASALRDGFDRVMDTFEVAGAFSGYIATVASPKIVDFIR 212

Query: 305 LSPIVDFVEQDSIVHANEVDTQNNAPWGLARISHRDGLNLGSYNKYLY-DDVAGEGVTAY 363
           L+P+VD+VE+DS+VH+ + +TQNNAPWGLARISHR+GLNLG++NKYLY  + AG+GVTAY
Sbjct: 213 LNPLVDYVEKDSVVHSLD-ETQNNAPWGLARISHREGLNLGNFNKYLYASNSAGKGVTAY 271

Query: 364 VIDTGINIKHKEFGGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXX 423
           V+DTGI++ H EFG RA WGKTIP ND D+DGNGHGTHCAGTI S++YG           
Sbjct: 272 VVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVK 331

Query: 424 XLRSDGSGTMSDVLKGVEYAAFSHQKALREKKK----GFKGSTANMSLGGGKSRSLDLAV 479
            LRSDGSGTMSDVLKGVE+ A  H K L E +K     +KG+TANMSLGGGKS +LD AV
Sbjct: 332 VLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALDQAV 391

Query: 480 DAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGASTLSDDRAYFSNWGKCVDVFAPG 539
           +AAVK+G+HFAVAAGNENQDACNSSPAA+ENAITVGASTLSDDRAYFSN+GKCVD+FAPG
Sbjct: 392 NAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVGASTLSDDRAYFSNYGKCVDIFAPG 451

Query: 540 LNILSTYIGSDEATATLSGTSMASPHVAGLLSYFLSMQPDADXXXXXXXXXXXXPAQLKK 599
           LNILSTYIG+++ATATLSGTSMASPHVAGLL+Y LS+QPD              P Q+KK
Sbjct: 452 LNILSTYIGTNDATATLSGTSMASPHVAGLLTYLLSLQPD-KGSEFYVPNSELTPLQMKK 510

Query: 600 KLIAYSTKNLFQDLPEKTPNLLVYNAGHNISDFWKPKSESSAEPNE---RAKEFELEDLV 656
           K+I Y+TKN   DLP  TPN L+YN G N +DFW     S+A P     +   + L   +
Sbjct: 511 KIIDYATKNALADLPADTPNKLIYNGGFNSTDFW----ASAAAPQSHKVKTNRYSLGSFL 566

Query: 657 DSAQWIADTWLNGIQQVFERMDLF 680
           DS Q   + W N     F+ M++F
Sbjct: 567 DSIQDSNNHWFN-----FDNMNIF 585

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
           (REAL)
          Length = 478

 Score =  442 bits (1136), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 217/425 (51%), Positives = 293/425 (68%), Gaps = 17/425 (4%)

Query: 222 MENTKYENLVIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYASVSDE-------TSSSI 274
           ++NT ++  +IP +YI+VF +D+S+K ++ H+ ++  A     S   E        SSSI
Sbjct: 58  LDNT-HKTELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSI 116

Query: 275 -----LGGIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNA 329
                LGGI+ +F++  LF GY G+F ++++  +   P++ F+EQ+S V  +    Q +A
Sbjct: 117 APDLQLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDA 176

Query: 330 PWGLARISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPEN 389
           PWGL RISHR+    G   +YLY+D AG GVT+YV+DTGI+ +H++F GRAVWG  IP N
Sbjct: 177 PWGLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGN 236

Query: 390 DQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTMSDVLKGVEYAAFSHQK 449
           D+  D NGHGTHCAG I SK+YG            LRS+G GT+SDV+KG+EY A  H +
Sbjct: 237 DEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIE 296

Query: 450 ALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASE 509
           + R+K K FKGSTAN+SLG  KS ++++AVDAAV SG+HFA+AAGNEN+DAC SSPA ++
Sbjct: 297 SSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQ 356

Query: 510 NAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGL 569
            +ITVGAST SDDRA+FSNWG CVDVFAPG+NI+STYIGS  AT +LSGTSMA+PHVAG+
Sbjct: 357 KSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGM 416

Query: 570 LSYFLSMQPDADXXXXXXXXXXXXPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYNAGHNI 629
           LSYFLS+QP  D            P +LK+K++ +ST  +  D+ + TPN L+YN G  I
Sbjct: 417 LSYFLSLQPAPD---SEYFDNALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKI 473

Query: 630 -SDFW 633
             D W
Sbjct: 474 LDDLW 478

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score =  428 bits (1100), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 211/418 (50%), Positives = 284/418 (67%), Gaps = 14/418 (3%)

Query: 227 YENLVIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYAS---------VSDETSSSI-LG 276
           Y+   +P +YII F +D SV+ ++ HK +I   Q +  S         VS    S +  G
Sbjct: 62  YKAESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQFG 121

Query: 277 GIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARI 336
           GI+  F++  LF GY G+F E++++ +   PI+ F+EQ+S V       Q  APWGL RI
Sbjct: 122 GIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRI 181

Query: 337 SHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDGN 396
           SHR+    G   +YLY+D AG GVT+YV+DTGI+I H++F GRAVWG  IP+ND+  D N
Sbjct: 182 SHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDLN 241

Query: 397 GHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTMSDVLKGVEYAAFSHQKALREKKK 456
           GHGTHCAG I S+++G            LRS+G GT+SDV+KG+EY    H  + ++   
Sbjct: 242 GHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDSSKKGGP 301

Query: 457 GFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGA 516
            FKGSTAN+SLG  KS ++++AV+AAV+SG+HFA+AAGNE++DAC SSPA +E +ITVGA
Sbjct: 302 KFKGSTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGA 361

Query: 517 STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLSYFLSM 576
           ST SDDRA+FS+WG CVDVFAPG+NILSTYIGS  A+ +LSGTSMA+PHVAG+LSYFLS+
Sbjct: 362 STFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSL 421

Query: 577 QPDADXXXXXXXXXXXXPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNISDFW 633
           QP +D            P QLK+K+I +ST+ +  D+ E TPN L+YN  G  + +FW
Sbjct: 422 QPSSD---SEFFDSTVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
           (REAL)
          Length = 482

 Score =  424 bits (1090), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 205/416 (49%), Positives = 284/416 (68%), Gaps = 16/416 (3%)

Query: 232 IPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYASVSDETSSSI------------LGGIE 279
           +P +YIIVF +D++ + ++ H  +I +AQ    S   E  S +             GGI+
Sbjct: 69  LPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGGID 128

Query: 280 EAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARISHR 339
            +F++  LF GY G+F +++++ +   P+V F+E +S V  +    Q +APWGL RISHR
Sbjct: 129 ISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHR 188

Query: 340 DGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDGNGHG 399
           +    G   +YLY+D AG GVT+YV+DTGI+ +H++F GRA WG  IPEND+  D NGHG
Sbjct: 189 ERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHG 248

Query: 400 THCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTMSDVLKGVEYAAFSHQKALREKKKGFK 459
           THCAG I S+++G            LRS+G GT+SDV+KG+EY A +H  + +++   FK
Sbjct: 249 THCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIASSKKRGSKFK 308

Query: 460 GSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGASTL 519
           GSTAN+SLG  KS ++++AV+AAV  G+HFA+AAGNE++DAC SSPA +E +ITVGAST 
Sbjct: 309 GSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTF 368

Query: 520 SDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLSYFLSMQPD 579
           SDDRA+FSNWG CVDVFAPG+NI+STYIGS  AT +LSGTSMA+PHVAG+LSY LS+QP 
Sbjct: 369 SDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQPA 428

Query: 580 ADXXXXXXXXXXXXPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNISDFWK 634
            D            P QLK+K++ +ST+ +  D+ E+TPN LVYN  G  + +FW+
Sbjct: 429 QD---SEFFYDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFWR 481

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
           precursor to the subtilisin-like protease III
          Length = 478

 Score =  418 bits (1075), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 206/424 (48%), Positives = 286/424 (67%), Gaps = 16/424 (3%)

Query: 223 ENTKYENLVIPNKYIIVFKKDVSVKDMQIHKDLIARAQ------------FQYASVSDET 270
           ++  ++   +P +Y+IVF +D+S++ +Q H  ++ +              F     S  +
Sbjct: 58  QHVAHKTEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVISSSVS 117

Query: 271 SSSILGGIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAP 330
           S S  GGI+  F++  LF GY G+F +++++ I   PI+ FVEQ++ V  +    Q  AP
Sbjct: 118 SKSQFGGIDNFFDINGLFRGYTGYFTDEIIKIISQDPIIKFVEQETTVKISNSSLQEEAP 177

Query: 331 WGLARISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPEND 390
           WGL R+SHR+    G   +YLY+D AG+GVT+YV+DTGI+ +H++F GRA WG  IP ND
Sbjct: 178 WGLHRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPAND 237

Query: 391 QDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTMSDVLKGVEYAAFSHQKA 450
           +  D NGHGTHCAG I SK++G            LRS+G GT+SDV+KG+EY    H ++
Sbjct: 238 EASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIES 297

Query: 451 LREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASEN 510
            ++K K FKGSTAN+SLG  KS ++++AV+AAV SG+HFA+AAGNE++DAC SSPA +E 
Sbjct: 298 SKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEK 357

Query: 511 AITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLL 570
           +ITVGAST SDDRA+FSNWG CVDVFAPG+NI+STYIGS  AT +LSGTSMASPHVAG+L
Sbjct: 358 SITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGIL 417

Query: 571 SYFLSMQPDADXXXXXXXXXXXXPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNI 629
           SYFLS+QP  D            P +LK+K++ +ST+ +  D+ + TPN L+YN  G  +
Sbjct: 418 SYFLSLQPAPD---SEFFNDAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKL 474

Query: 630 SDFW 633
             FW
Sbjct: 475 DGFW 478

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar
           to uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3
           or uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  394 bits (1011), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 208/416 (50%), Positives = 273/416 (65%), Gaps = 14/416 (3%)

Query: 229 NLVIPNKYIIVFKKDVSVKDMQIHKDLIAR----------AQFQYASVSDETSSSILGGI 278
           +++IPN+YI++FK  V+ K++Q H   I            + F  A+  ++ S+  +G +
Sbjct: 71  DMIIPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSIFLQDSDFGKATQYNDISTRGIG-L 129

Query: 279 EEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARISH 338
           +  F++     GYIG+F E   +FI  SP+V+ VE DSIV  N    Q + PWGL RIS 
Sbjct: 130 QHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQ 189

Query: 339 RDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDGNGH 398
           R+ L +     Y YDD  G+    +VIDTGI + H++F GRA WGKTI END D D NGH
Sbjct: 190 REKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYDLNGH 249

Query: 399 GTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTMSDVLKGVEYAAFSHQKALREKKKGF 458
           GTHCAGTIASK+YG            LRSDGSG+MSDV++GVEY   ++   L++ K   
Sbjct: 250 GTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYND-LKKTKSNL 308

Query: 459 KGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGAST 518
           KG+  NMSLG  KS +L+ A+DAA  +GI FAVAAGNE+ DACNSSPA++ + ITVG ST
Sbjct: 309 KGAAGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESDDACNSSPASAWSPITVGGST 368

Query: 519 LSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLSYFLSMQP 578
           LSDD A+FSN+G+CVD+FAPG+NI+STYIGS  AT +LSGTSM+SPHVAG+L+Y+LS+QP
Sbjct: 369 LSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLSLQP 428

Query: 579 DADXXXXXXXXXXXXPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNISDFW 633
           D              P  LKKK++ Y+T      LP +T NLLVYN  G N+S FW
Sbjct: 429 D-HKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFW 483

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
           YOR003W
          Length = 456

 Score =  383 bits (984), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 195/412 (47%), Positives = 262/412 (63%), Gaps = 18/412 (4%)

Query: 228 ENLVIPNKYIIVFKKDVSVKDMQIH----KDLIARAQFQYASVSDETSSSILGGIEEAFN 283
           +N +I ++YI++FK    + + ++H    K+ I    +++    D  S+         F 
Sbjct: 56  QNDIIKDQYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDDHKSNL------NIFK 109

Query: 284 VANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARISHRDGLN 343
           +     GYI     + +Q +R  PIV  +E DS VHA ++  Q + PWGL+RIS R  + 
Sbjct: 110 IGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRPRVR 169

Query: 344 LGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDGNGHGTHCA 403
           +G    Y YDD     VTAYV+DTGI I H++F GRA WGKTI  ND D D +GHGTH A
Sbjct: 170 IGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHGTHVA 229

Query: 404 GTIASKNYGXXXXXXXXXXXXLRSDGSGTMSDVLKGVEYAAFSHQKALREKKKGFKGSTA 463
           G IAS  +G            LRS+G G MSDVLKG+E+    H K     K   KGS  
Sbjct: 230 GIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSK----NKNYSKGSVV 285

Query: 464 NMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGASTLSDDR 523
           N+SLG  KS +L LA+DAA+   IHFAVAAGNEN DAC +SPA +  AITVGAS  SD+R
Sbjct: 286 NLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIFSDER 345

Query: 524 AYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLSYFLSMQPDADXX 583
           A+FSNWG+CVDVFAPG+N++STYIGSD AT +LSGTS A+P+ AGL++Y+LS+QPD D  
Sbjct: 346 AFFSNWGECVDVFAPGMNVMSTYIGSDNATLSLSGTSAAAPYTAGLIAYYLSLQPDKD-- 403

Query: 584 XXXXXXXXXXPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNISDFWK 634
                     P++LK+K++A+ +K++  +LPE TPN+++YN AG N+S FWK
Sbjct: 404 -SGYFTGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFWK 454

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  355 bits (910), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 189/407 (46%), Positives = 253/407 (62%), Gaps = 15/407 (3%)

Query: 232 IPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYASVSDETSSSILGGIEEAFNVANLFHGY 291
           IPN+YI++FK D +  D+Q    L   A      ++ +   +IL     +F +A+   GY
Sbjct: 53  IPNQYIVLFKSDTT--DIQRETHL---ATLNSWLLNTDPQYTIL----HSFQLAHDLQGY 103

Query: 292 IGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARISHRDGLNLGSYNKYL 351
                EQL++ +   PI+  +EQDS VHA     Q ++PWGLARIS R+ L L     Y 
Sbjct: 104 TSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQRERLKLLQDQFYH 163

Query: 352 YDDV-AGEGVTAYVIDTGINIKHKEFGGRAVWGKTI-PENDQDVDGNGHGTHCAGTIASK 409
           YDD  A      Y++DTGIN  H EF GRA WG    P      D NGHGTHCAG I S 
Sbjct: 164 YDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENGHGTHCAGVIGSH 223

Query: 410 NYGXXXXXXXXXXXXLRSDGSGTMSDVLKGVEYAAFSHQKALREK-KKGFKGSTANMSLG 468
            YG            L + G G MS V++G+EY    H++ ++++ + GFKGS  N+SLG
Sbjct: 224 EYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQTGFKGSVINLSLG 283

Query: 469 GGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGASTLSDDRAYFSN 528
            GKS +L   ++AAVK G+HFAVAAGNE+ DAC++SPA S +A+TVGAS+ SDDR +FSN
Sbjct: 284 AGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGASSFSDDRVFFSN 343

Query: 529 WGKCVDVFAPGLNILSTYIGS-DEATATLSGTSMASPHVAGLLSYFLSMQPDADXXXXXX 587
           WG CVDVFAPG+NI+STYIG  +  T +LSGTSM++P V GL++YFLS+QPD        
Sbjct: 344 WGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLSLQPDTK-SQFYT 402

Query: 588 XXXXXXPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNISDFW 633
                 P QLK K+I++ST+ +  ++PE TPN +VYN  GH++ DFW
Sbjct: 403 GITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKDFW 449

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  313 bits (801), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 168/400 (42%), Positives = 242/400 (60%), Gaps = 31/400 (7%)

Query: 232 IPNKYIIVFKKDVSVKDMQIHKDLIA----RAQFQYASVSDETSSSILGGIEEAFNVANL 287
           I N+++++FK  V  +++++   ++A     AQF+   ++DE    ++G     F V N 
Sbjct: 41  ILNEFLVMFKPMVDREEVEVGLSVLAGRFPLAQFEQFHIADE----LIG-----FTVKNF 91

Query: 288 -FHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARISHRDGLNLGS 346
            FH          V F+   P V+ VE +S V+A  V  Q + PWGL R+S RD + +G 
Sbjct: 92  PFHN---------VYFLLQIPFVEMVETNSKVYALNVTVQEDVPWGLMRLSQRDRVRIGD 142

Query: 347 YNKYLYDDV-AGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDGNGHGTHCAGT 405
              Y YD   + + V  Y++DTGI + H+EF GRA WGKTI  ND D D NGHGTHCAG 
Sbjct: 143 EQVYRYDTRGSAKDVNVYILDTGIQVDHEEFEGRARWGKTIAWNDPDRDDNGHGTHCAGI 202

Query: 406 IASKNYGXXXXXXXXXXXXLRSDGSGTMSDVLKGVEYAAFSHQKALREKKKGFKGSTANM 465
           +    YG            L + G G MSDV++G+E+A   H   L   +   +GS  N+
Sbjct: 203 VGGATYGVAKEANLIAVKVLHATGDGEMSDVIRGIEFAVNEH---LTRNQDEVRGSIINL 259

Query: 466 SLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGASTLSDDRAY 525
           SLG G+S +L   V AA+  G+HFAVAAGNE+ +AC SSPA  +  +TVG ST SDDRA+
Sbjct: 260 SLGAGESPALQRVVTAALNKGVHFAVAAGNEDDNACYSSPANIDGVVTVGGSTFSDDRAF 319

Query: 526 FSNWGKCVDVFAPGLNILSTYIGSDE-ATATLSGTSMASPHVAGLLSYFLSMQPDADXXX 584
           FSNWG C+DVFAPG+N+ S+Y+G+ +  T +LSGTS ++PHVAGL++Y LS++PD     
Sbjct: 320 FSNWGPCIDVFAPGVNVKSSYVGAAKNKTLSLSGTSTSAPHVAGLMAYLLSLEPDTK--- 376

Query: 585 XXXXXXXXXPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYN 624
                    PAQLK+KL++ +T+    ++P+ T NL+++N
Sbjct: 377 SQFHTAWSNPAQLKQKLVSLATEGKLFEVPDDTANLMIFN 416

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  306 bits (783), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 188/424 (44%), Positives = 252/424 (59%), Gaps = 33/424 (7%)

Query: 232 IPNKYIIVFKKDVSVKDMQIHK------DLIARAQFQYASVSDETSSSILGGIEEAFNVA 285
           IP++YI++F+ D +  D+QI +       LI     +Y +V+D  S      +   F ++
Sbjct: 63  IPDQYIVLFENDTT--DLQISRFEQFLSSLIEEDNQKY-NVNDNYSK-----VLSRFQIS 114

Query: 286 N-----LFHGYIGHFNEQLVQFI-RLSPIVDFVEQDSIVHANEVDTQNNAPWGLARISHR 339
           N     +    I  F E +   I     I+  +E+DS VH N+  TQ ++ WGL+RIS R
Sbjct: 115 NDTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLSRISQR 174

Query: 340 DGLNLGSYNKYLYDDV-AGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDV-DGNG 397
           + L L     Y YDD  +G+GV  Y++DTGIN  H EF GRA WG ++P  +  + D NG
Sbjct: 175 NHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLEDSNG 234

Query: 398 HGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTMSDVLKGVEYAAFSHQKALREKKKG 457
           HGTHCAG I SK YG            L   G G+MSDV+ G+E+ A SH          
Sbjct: 235 HGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVANSHTNKTNNISSS 294

Query: 458 ------FKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENA 511
                 FKGS  N+SLG  KS SLD+A+++A K GIH  VAAGNE++DAC +SPA S   
Sbjct: 295 SSVHSEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPADSPAV 354

Query: 512 ITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIG-SDEATATLSGTSMASPHVAGLL 570
           ITVGAS+ SDDRA+FSNWG CVDVFAPG+NI STYIG ++  T +LSG+SM+SP V+GL 
Sbjct: 355 ITVGASSFSDDRAFFSNWGPCVDVFAPGINIKSTYIGPNNNETLSLSGSSMSSPFVSGLT 414

Query: 571 SYFLSMQPDADXXXXXXXXXXXXPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNI 629
           +Y+LS+QPD              P QLK+K+I +ST  + ++LP  T N LVYN  G ++
Sbjct: 415 AYYLSLQPDV---SSQFHDSLMTPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGGGKDL 471

Query: 630 SDFW 633
           S FW
Sbjct: 472 SGFW 475

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
           similarities with uniprot|P09232 Saccharomyces
           cerevisiae YEL060c or uniprot|P25036 Saccharomyces
           cerevisiae YOR003w YSP3
          Length = 579

 Score =  280 bits (715), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 155/439 (35%), Positives = 244/439 (55%), Gaps = 25/439 (5%)

Query: 217 APLHSMENTKYENLVIPNKYIIVFKKDVSVKDMQIHKDLIARAQ------------FQYA 264
           APL   EN + +N ++P +YI++FK      ++++H   +A+ Q            F + 
Sbjct: 56  APLG--ENDEIQNNIVPYRYIVMFKNFAYTNEIKLHIQTVAKLQLRGSISLAPNDPFFHH 113

Query: 265 SVSDETSSSILGGIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVD 324
           +   E S+  LGG+   F++ + F+GY+G+F +++V+FIR   IVD+VE DSI+  ++ +
Sbjct: 114 TRDKEFSTEELGGVLYTFDIGSGFNGYVGYFTDEVVEFIRKQSIVDYVEMDSILTIDDKE 173

Query: 325 TQNNAPWGLARISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGK 384
           T +N+ W LARISHR  L L ++N+Y +D   G+ + AY++DTG+   H  +  R + G 
Sbjct: 174 TDSNSHWHLARISHRPKLGLSNFNEYKFDPNGGQNIDAYILDTGVYQTHAYYIERTIRGI 233

Query: 385 TIPENDQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTMSDVLKGVEYAA 444
            I  N+ + D NGHGT  AG +  +  G            L   G GT+S+++KG+ +  
Sbjct: 234 VITPNEDERDMNGHGTEMAGLVGGREVGVARKATLIDVKVLNWQGRGTVSNIIKGLSFV- 292

Query: 445 FSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSS 504
            +H    R +K G  G+    S+ G KSRSL+ A D  V SGIH  V AG +  +ACNSS
Sbjct: 293 -NHHHPQRIEKNGVLGAVVLFSISGAKSRSLNTAFDKMVSSGIHVVVGAGTKGINACNSS 351

Query: 505 PAASENAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATAT----LSGTS 560
           PA+S   ITV   +++D+     NWG CVD++ PG  + +TY   +    T    ++G+S
Sbjct: 352 PASSSKPITVAGMSITDEPIDRGNWGSCVDIYGPGDRVRTTYPNLERNQFTNEISVTGSS 411

Query: 561 MASPHVAGLLSYFLSMQPDADXXXXXXXXXXXXPAQLKKKLIAYSTKNLFQDLPEKTPNL 620
            A+  VAGLL+YF S+QP               P +LK++LI + TK    +L   +PN+
Sbjct: 412 AAAAQVAGLLAYFASLQPGL----GTPDVIPLTPEELKERLIDFGTKGKLTNLERMSPNI 467

Query: 621 LVYN-AGHNISDFWKPKSE 638
           + +N AG N+  F+   SE
Sbjct: 468 IAFNGAGGNLDSFFNDGSE 486

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 479

 Score =  188 bits (478), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 134/388 (34%), Positives = 193/388 (49%), Gaps = 46/388 (11%)

Query: 288 FHGYIGHFNEQLVQFIRLSPIV------------DFVEQDSIVHANEVDTQNNAPWGLAR 335
           F G+   F +  V+ ++ +P+V            D  EQ +  ++     Q +AP  LAR
Sbjct: 61  FEGFTADFPKDFVEKLKKNPLVADVVPNSVFNVFDQKEQIAEEYSRRYKVQEDAPRHLAR 120

Query: 336 ISHRDGLNL----GSYNK--YLYDDV-AGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPE 388
           +S R  L      G Y +  Y YD    G+ V AY+IDTGI  +HK+ GGRA +G  +  
Sbjct: 121 LSRRGPLPYSEEDGWYQEFNYYYDRKHRGDSVNAYIIDTGIYKQHKDLGGRAYFGADM-V 179

Query: 389 NDQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTMSDVLKGVEYAAFSHQ 448
            +   D NGHGTH AG + S+ +G            L + G G ++ V+  +E++     
Sbjct: 180 GEGPGDYNGHGTHVAGIVGSRTFGVAKKVNLVEVKALNAKGQGNLTSVISSIEFS----- 234

Query: 449 KALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAAS 508
             +   KK      AN+SLG  ++  L+ AV+AAV+SG+   VAAGN N +AC +SPA++
Sbjct: 235 --VNHCKKSGMLCVANLSLGSLRNTVLNQAVEAAVESGLVVVVAAGNSNVNACWNSPASA 292

Query: 509 ENAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVA 567
            +AITVGA    +D  A FSNWG CVDVFA G+ ++S            SGTSMASP VA
Sbjct: 293 ISAITVGAFDDRTDTIAKFSNWGMCVDVFASGVKVMSLSNMPPFKPVAYSGTSMASPSVA 352

Query: 568 GLLSYFLSMQPDADXXXXXXXXXXXXPAQLKKKLIAYSTKNLFQD----LPEKTPNLLVY 623
           GL +  L    D              P  +K+K+I  +T+N+FQ         TPN + +
Sbjct: 353 GLAAVLLDSGID--------------PPDIKQKIIDLATENVFQKRTLVFKPGTPNRIAF 398

Query: 624 NAGHNISDFWKPKSESSAEPNERAKEFE 651
           N      D ++       + NE  KE E
Sbjct: 399 NGVRKEDDIFEEAVYPVVDINELVKELE 426

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
           (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  185 bits (470), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 128/330 (38%), Positives = 171/330 (51%), Gaps = 43/330 (13%)

Query: 323 VDTQNNAPWGLARISHRDGLNLGSYNK--------YLYDD-VAGEGVTAYVIDTGINIKH 373
           ++ Q  AP  L RIS R  L     N+        Y Y+D   G  + AY++DTGI  +H
Sbjct: 151 INVQYGAPRHLGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEH 210

Query: 374 KEFGGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTM 433
            +F  R + G  +   +   D NGHGTH AG + SK +G            L   GSG +
Sbjct: 211 PDFENRVIVGADM-TGEGPGDSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNL 269

Query: 434 SDVLKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAA 493
           + VL G+++A   H + +RE +   K   ANMSLG  ++  ++ A+  A K+G+   VAA
Sbjct: 270 TTVLSGIQFAV-DHCRLMRETQG--KQCVANMSLGTVRNNIINAAIHEAFKAGLIMVVAA 326

Query: 494 GNENQDACNSSPAASENAITVGASTLSDDR----AYFSNWGKCVDVFAPGLNI--LSTYI 547
           GN N  AC +SPA+++NAITVGA    DDR    AYFSNWG CVD+FAPG+ I  LS   
Sbjct: 327 GNSNVSACWTSPASAKNAITVGA---FDDRTETIAYFSNWGACVDIFAPGVKIRSLSNSP 383

Query: 548 GSDEATATLSGTSMASPHVAGLLSYFLSMQPDADXXXXXXXXXXXXPAQLKKKLIAYSTK 607
            S     T SGTSMASP VAGL +  L    +              P  +K KL+  STK
Sbjct: 384 ESHHKHVTHSGTSMASPVVAGLAAILLDKGVE--------------PFDVKDKLLHLSTK 429

Query: 608 NLFQDLP----EKTPNLLVYNAGHNISDFW 633
           ++F  L       TPN + YN    I DF+
Sbjct: 430 DVFNKLTLFFKYGTPNKIAYNG---IEDFF 456

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
           YCR045C (REAL)
          Length = 527

 Score =  185 bits (469), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 143/464 (30%), Positives = 215/464 (46%), Gaps = 75/464 (16%)

Query: 229 NLVIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYASVSDETSSSILGG-IEEAFNVANL 287
           NL +  +Y++ FK   + +              Q+ S S+ +    +   IE+ F++ + 
Sbjct: 53  NLALAEEYLVRFKNPTAFQ--------------QFTSTSNRSWRQFIDHRIEKKFSIGS- 97

Query: 288 FHGYIGHFNEQLVQFIRLSPIV--------------------------DFVEQDSIVHAN 321
           F G   + ++ LV  ++ SP++                           +  QD I  A 
Sbjct: 98  FRGVTMNLSKNLVNKLKKSPLIADIVPNFKFEAFDTDAELSYMFNTTAKYAYQD-IDEAQ 156

Query: 322 EVDTQNNAPWGLARISHRDGLNL---------GSYNKYLYDDVAGEGVTAYVIDTGINIK 372
            V  Q +AP  LARIS    L             +N Y  D+  G+GV AY++DTGI+ +
Sbjct: 157 NVTYQPDAPRHLARISRHHQLPFDLEDKDRYKSWFNYYYEDEYQGQGVNAYIMDTGIHAE 216

Query: 373 HKEFGGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGT 432
           H EF  R + G  + +     D NGHGTH AG + S+ +G            L  DGSG 
Sbjct: 217 HPEFEDRVIQGVDLTKEGFG-DENGHGTHVAGLVGSRTFGAAKKVSLVEVKVLGKDGSGE 275

Query: 433 MSDVLKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVA 492
            S+VL G+E+      K  R + K      AN+SLG  +S  +++AV+ A++ GI F  A
Sbjct: 276 ASNVLSGLEFIVEHCTKVSRPQGKK---CVANLSLGSFRSPIINMAVEGAIEEGIVFVAA 332

Query: 493 AGNENQDACNSSPAASENAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDE 551
           AGN N DA  +SPA++EN ITVGA     D  A FSNWG CV++FAPG+ I S    +D 
Sbjct: 333 AGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNDN 392

Query: 552 ATATLSGTSMASPHVAGLLSYFLSMQPDADXXXXXXXXXXXXPAQLKKKLIAYSTKNLFQ 611
            +  LSGTSM++P V G+ +  LS                  P  + +++   ST+N+F 
Sbjct: 393 ESLVLSGTSMSTPIVTGVAAVLLS--------------KGIEPELIAQEIEYLSTRNVFH 438

Query: 612 D----LPEKTPNLLVYNAGHNISDFWKPKSESSAEPNERAKEFE 651
                    TPN ++YN    + D +  ++         AKE E
Sbjct: 439 RRTLFFKPSTPNQILYNGVDKLDDPYDDETFPRLNVEAIAKELE 482

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
           Anc_6.313
          Length = 492

 Score =  181 bits (460), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 136/388 (35%), Positives = 192/388 (49%), Gaps = 65/388 (16%)

Query: 278 IEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANE--------------- 322
           I + F++ + F G+     + L++ I+ +P+V  V  +  VHA E               
Sbjct: 58  IGKTFSIGS-FKGFTVDLTDDLLEAIKKNPLVSDVVPNLRVHAFEDVKDEEGDDDGGQFD 116

Query: 323 ---------VDTQNNAPWGLARISHRDGLNLGSYNK--------YLYDDVA-GEGVTAYV 364
                    V  Q  AP  LAR+S R  L     +K        Y YD  + G  V AY+
Sbjct: 117 NKMQKGKCSVKVQYGAPRHLARLSRRKQLPYDFEDKEAYLDSLKYFYDKRSQGASVNAYI 176

Query: 365 IDTGINIKHKEFGGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXX 424
           ID+GI ++H+EF GRA+ G  +   +   D NGHGTH AG + SK+YG            
Sbjct: 177 IDSGIYLEHEEFNGRAIPGIDL-TGEGSGDYNGHGTHVAGIVGSKSYGVAKKVKLIEIKV 235

Query: 425 LRSDGSGTMSDVLKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVK 484
           L   G G+++ VL G+E+A    Q+     KKG     AN+SLG  ++  L+ A+ AA+ 
Sbjct: 236 LNRLGQGSLAMVLGGIEFAVKHCQET---SKKG--RCVANLSLGSMRTAILNKAIKAAID 290

Query: 485 SGIHFAVAAGNENQDACNSSPAASENAITVGASTLSDDR----AYFSNWGKCVDVFAPGL 540
           +G+   VAAGN N +AC  SPA++  AITVGA    DDR    A FSNWG+C+D+FAPG+
Sbjct: 291 AGLVVVVAAGNNNLNACWYSPASAPEAITVGAF---DDRIDAIAKFSNWGQCLDIFAPGV 347

Query: 541 NILSTYIGSDEATATLSGTSMASPHVAGLLSYFLSMQPDADXXXXXXXXXXXXPAQLKKK 600
            I S  I  D+   T SGTSMASP VAGL +  L     A+              ++K  
Sbjct: 348 VIKSLSIFKDKEDVTYSGTSMASPTVAGLAALTLDQGVSAE--------------EVKDY 393

Query: 601 LIAYSTKNLFQD----LPEKTPNLLVYN 624
           ++   T N+F          TPN + +N
Sbjct: 394 ILEMGTDNVFHRRSLLFKPGTPNKICFN 421

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
           (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  181 bits (458), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 126/334 (37%), Positives = 171/334 (51%), Gaps = 45/334 (13%)

Query: 317 IVHANEVDTQNNAPWGLARISHRDGL-----NLGSYNK---YLYD-DVAGEGVTAYVIDT 367
           + +++++  Q  AP  L+R+S R  L     N+  Y+    Y +D    G  V AY+IDT
Sbjct: 106 LTYSDKIIIQREAPRHLSRLSRRGQLPYDINNIDRYDNAFDYYFDAKYQGSSVNAYIIDT 165

Query: 368 GINIKHKEFGGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRS 427
           GI  +H EF GR  +   + +     D NGHGTH AG + SK +G            L  
Sbjct: 166 GIYKEHPEFEGRVKFAIDLTQEGPG-DENGHGTHIAGIVGSKTFGVAKKVNIIDVKALDK 224

Query: 428 DGSGTMSDVLKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGI 487
            G G +S +LK +E+    H K   +KK       AN+S G  ++  +D A+  A  +GI
Sbjct: 225 KGQGQLSTILKALEFT-IRHCKESVDKK-----CVANLSFGAIRTAIIDEAIKEAHNAGI 278

Query: 488 HFAVAAGNENQDACNSSPAASENAITVGASTLSDDR----AYFSNWGKCVDVFAPGLNI- 542
              VAAGN N DAC +SPA+S++ ITVGA    DDR    A FSNWG CVDVFAPG+ + 
Sbjct: 279 VLVVAAGNSNIDACWNSPASSKDVITVGAF---DDRTETIARFSNWGSCVDVFAPGVKVK 335

Query: 543 -LSTYIGSDEATATLSGTSMASPHVAGLLSYFLSMQPDADXXXXXXXXXXXXPAQLKKKL 601
            LS   GSD     LSGTSMASP V+G+ +  L                   P  +K K+
Sbjct: 336 SLSHINGSD--VLLLSGTSMASPSVSGIAAILLD--------------KGLNPKFVKSKI 379

Query: 602 IAYSTKNLFQD----LPEKTPNLLVYNAGHNISD 631
           I  STKN+F      +   TPNL+V+N    + D
Sbjct: 380 IESSTKNIFHQGTIMIKPNTPNLIVFNGIEKMDD 413

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
           YCR045C (REAL)
          Length = 491

 Score =  180 bits (456), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 146/467 (31%), Positives = 213/467 (45%), Gaps = 77/467 (16%)

Query: 229 NLVIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYASVSDETSSSIL-GGIEEAFNVANL 287
           NLV   +Y++ FK   + +              Q+ S S+ +    +   IE+ F++ + 
Sbjct: 13  NLVYAEEYLVRFKNPTAFQ--------------QFTSNSNRSWRQFIDNKIEKKFSIGS- 57

Query: 288 FHGYIGHFNEQLVQFIRLSPIV-DFV--------EQDS--------------------IV 318
           F G   + ++ LV  ++ SP+V D V        E DS                    + 
Sbjct: 58  FRGVTMNLSKNLVNKLKKSPLVADIVPNFRFEAFENDSARDVEYNYTFNATAKYSYENLD 117

Query: 319 HANEVDTQNNAPWGLARISHRDGLNL---------GSYNKYLYDDVAGEGVTAYVIDTGI 369
               +  Q++AP  LARIS    L             +N Y  DD  G+ V AY++DTGI
Sbjct: 118 EEQNITYQSDAPRHLARISRHYQLPFDIEDKERYKSWFNYYYEDDYQGQDVNAYIMDTGI 177

Query: 370 NIKHKEFGGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDG 429
              H EF  R + G  + +     D NGHGTH AG + SK YG            L  DG
Sbjct: 178 FADHPEFEDRVIQGIDLTKEGFG-DQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDG 236

Query: 430 SGTMSDVLKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHF 489
           SG  S+VL G+E+     +   R  +   K   AN+SLG  +S  +++AV+ A++ GI F
Sbjct: 237 SGEASNVLSGLEFIV---EHCTRVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGIVF 293

Query: 490 AVAAGNENQDACNSSPAASENAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIG 548
             AAGN N DA  +SPA++EN ITVGA     D  A FSNWG CV++FAPG+ I S    
Sbjct: 294 VAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHL 353

Query: 549 SDEATATLSGTSMASPHVAGLLSYFLSMQPDADXXXXXXXXXXXXPAQLKKKLIAYSTKN 608
           +   T  LSGTSM++P V G+ +  LS                  P  + ++L   ST+N
Sbjct: 354 NFNDTLVLSGTSMSTPIVTGVAAVLLS--------------KGIEPEMIAQELEYLSTRN 399

Query: 609 LFQD----LPEKTPNLLVYNAGHNISDFWKPKSESSAEPNERAKEFE 651
           +F          TPN ++YN    + D +  ++         A+E E
Sbjct: 400 VFHRRTLFFKPSTPNQILYNGVDKLDDRYDDETFPRLNIEAIARELE 446

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa]
           {ON} Anc_6.313 YCR045C
          Length = 436

 Score =  177 bits (450), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 125/354 (35%), Positives = 178/354 (50%), Gaps = 49/354 (13%)

Query: 299 LVQFIRLSPIV-------DFVEQDSI------VHANEVDTQNNAPWGLARISHRDGLNL- 344
           LV  IR SP+V        FV  D         ++  +  Q  AP  L+R+S R  L   
Sbjct: 74  LVDRIRRSPLVAEVVPNIQFVAYDEHDFEGWNFNSRFIRRQRGAPRHLSRLSRRSQLPYD 133

Query: 345 ---------GSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDG 395
                    GS+N Y  +   G+G+ AY+IDTGI  +H EFGGRAV+G+ +   +   DG
Sbjct: 134 FEEEDDNYEGSFNYYYDNKHRGDGINAYIIDTGIYKEHAEFGGRAVFGEDL-TGEGPGDG 192

Query: 396 NGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTMSDVLKGVEYAAFSHQKALREKK 455
           NGHGTH AG + S  YG            L + G G ++ V+  +E+A  +H ++     
Sbjct: 193 NGHGTHVAGIVGSSKYGVAKDITLVEVKALTAKGQGNLTTVISAMEFAV-NHCRS----S 247

Query: 456 KGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVG 515
           +G KG   N+SLG  ++  ++ AV AA ++GI   VAAGN N +AC +SPA++  AITVG
Sbjct: 248 EG-KGCVINLSLGAIRNSVINQAVKAAHEAGIVVVVAAGNSNINACLNSPASAPEAITVG 306

Query: 516 A-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLSYFL 574
           A    +D  A FSNWG CVD+FAPG+ + S            SGTSMASP + GL +  L
Sbjct: 307 AFDDRTDSIAKFSNWGSCVDIFAPGVRVKSLASAPHLKPILFSGTSMASPSITGLAAILL 366

Query: 575 SMQPDADXXXXXXXXXXXXPAQLKKKLIAYSTKNLFQD----LPEKTPNLLVYN 624
                 D              ++K  ++  +T ++FQ         TPN + +N
Sbjct: 367 DEGVPYD--------------KIKDYILKMATNDVFQRRTLVFKPGTPNRVAFN 406

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 490

 Score =  178 bits (452), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 116/317 (36%), Positives = 161/317 (50%), Gaps = 35/317 (11%)

Query: 322 EVDTQNNAPWGLARISHRDGLNLG---------SYNKYLYDDVAGEGVTAYVIDTGINIK 372
           +V  Q  AP  LAR+S R  L            S+N Y Y    G  + AY+IDTGI  +
Sbjct: 122 KVKVQGEAPRHLARLSRRAPLPYEFDDELRYEESFNYYYYKWHKGRNINAYIIDTGIYKE 181

Query: 373 HKEFGGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGT 432
           HK+F GRA++G+     +   D NGHGTH AG + S N+G            L + G G 
Sbjct: 182 HKDFCGRAIFGRDF-TGEGPGDRNGHGTHVAGIVGSSNFGVAKKVNLIEVKALNNRGQGN 240

Query: 433 MSDVLKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVA 492
           ++ V+  VE+A  +H K+      G KG  AN+SLG  ++  ++ A+ AA ++G+   VA
Sbjct: 241 LTTVISAVEFAV-NHCKS-----SGKKGCVANLSLGAVRNSVINQAIKAAHEAGLIIVVA 294

Query: 493 AGNENQDACNSSPAASENAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDE 551
           AGN N +AC +SPA++  AITVGA    +D  A FSNWG CVD+FA G+ + S       
Sbjct: 295 AGNSNINACWNSPASAPEAITVGAFDDRTDTIAKFSNWGPCVDIFASGVKVKSLSAFPPH 354

Query: 552 ATATLSGTSMASPHVAGLLSYFLSMQPDADXXXXXXXXXXXXPAQLKKKLIAYSTKNLFQ 611
                SGTSMASP V GL++  L                   P  +K KL+  +T +L Q
Sbjct: 355 KPIAFSGTSMASPSVTGLVAILLD--------------KGVEPENIKAKLVELATHDLLQ 400

Query: 612 D----LPEKTPNLLVYN 624
                    TPN + +N
Sbjct: 401 RRTLFFKPGTPNRIAFN 417

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
           YCR045C (REAL)
          Length = 540

 Score =  178 bits (451), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 145/467 (31%), Positives = 212/467 (45%), Gaps = 77/467 (16%)

Query: 229 NLVIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYASVSDETSSSIL-GGIEEAFNVANL 287
           NL    +Y++ FK   + +              Q+ S S+ +    +   IE+ F++ + 
Sbjct: 62  NLAYAEEYLVRFKNPTAFQ--------------QFTSNSNRSWRQFIDNKIEKKFSIGS- 106

Query: 288 FHGYIGHFNEQLVQFIRLSPIV-DFVEQ----------------------------DSIV 318
           F G   + ++ LV  ++ SP+V D V                              + I 
Sbjct: 107 FRGVTMNLSKNLVNKLKKSPLVADIVPNFRFEAFENDGTNDAELNYTFNATAKYLYEDID 166

Query: 319 HANEVDTQNNAPWGLARISHRDGLNL---------GSYNKYLYDDVAGEGVTAYVIDTGI 369
            A  +  Q++AP  LARIS    L             +N Y  DD  G+ V AY++DTGI
Sbjct: 167 EAQNITYQSDAPRHLARISRHYQLPFDIEDKNRYKSWFNYYYEDDYLGQDVNAYIMDTGI 226

Query: 370 NIKHKEFGGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDG 429
              H EF  R + G  + +     D NGHGTH AG + SK YG            L  DG
Sbjct: 227 FSDHPEFEDRVIQGIDLTKEGFG-DQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDG 285

Query: 430 SGTMSDVLKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHF 489
           SG  S+VL G+E+     +   R  +   K   AN+SLG  +S  +++AV+ A++ GI F
Sbjct: 286 SGEASNVLSGLEFIV---EHCTRVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGIVF 342

Query: 490 AVAAGNENQDACNSSPAASENAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIG 548
             AAGN N DA  +SPA++EN ITVGA     D  A FSNWG CV++FAPG+ I S    
Sbjct: 343 VAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHL 402

Query: 549 SDEATATLSGTSMASPHVAGLLSYFLSMQPDADXXXXXXXXXXXXPAQLKKKLIAYSTKN 608
           + E T  LSGTSM++P V G+ +  LS                  PA + +++   ST+N
Sbjct: 403 NYEDTLILSGTSMSTPIVTGVAAVLLS--------------KGIEPALIAQEIEYLSTRN 448

Query: 609 LFQD----LPEKTPNLLVYNAGHNISDFWKPKSESSAEPNERAKEFE 651
           +F          T N ++YN    + D +  ++         AKE E
Sbjct: 449 VFHRRTLFFKPSTANQILYNGVDKLDDPYNDETFPRLNIEAIAKELE 495

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
           RRT12Probable subtilisin-family protease with a role in
           formation of the dityrosine layer of spore walls;
           localizes to the spore wall and also the nuclear
           envelope and ER region in mature spores
          Length = 491

 Score =  174 bits (442), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 146/467 (31%), Positives = 211/467 (45%), Gaps = 77/467 (16%)

Query: 229 NLVIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYASVSDETSSSIL-GGIEEAFNVANL 287
           NL    +Y++ FK   + +              Q+ S S+ +    +   IE+ F++ + 
Sbjct: 13  NLAYAEEYLVRFKNPTAFQ--------------QFTSNSNRSWRQFIDNKIEKKFSIGS- 57

Query: 288 FHGYIGHFNEQLVQFIRLSPIV-DFV--------EQDSIVHA------------------ 320
           F G   + ++ LV  ++ SP+V D V        E DS+  A                  
Sbjct: 58  FRGVTMNLSKNLVNKLKKSPLVADIVPNFRFEAFEGDSVNSAESSYTFNATAKYSYEDVE 117

Query: 321 --NEVDTQNNAPWGLARISHRDGLNL---------GSYNKYLYDDVAGEGVTAYVIDTGI 369
               +  Q +AP  LARIS    L             +N Y   D  G+ V AY++DTGI
Sbjct: 118 EEQNITYQPDAPRHLARISRHYQLPFDVGDKDRYKSWFNYYYEHDYQGQDVNAYIMDTGI 177

Query: 370 NIKHKEFGGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDG 429
              H EF  R + G  + +     D NGHGTH AG + SK YG            L  DG
Sbjct: 178 FADHPEFEDRVIQGIDLTKEGFG-DQNGHGTHVAGLVGSKTYGAAKRVNLVEVKVLGKDG 236

Query: 430 SGTMSDVLKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHF 489
           SG  S+VL G+E+      K  R + K      AN+SLG  +S  +++AV+ A++ GI F
Sbjct: 237 SGEASNVLSGLEFIVEHCTKVSRPQGKK---CVANLSLGSFRSPIINMAVEGAIEEGIVF 293

Query: 490 AVAAGNENQDACNSSPAASENAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIG 548
             AAGN N DA  +SPA++EN ITVGA     D  A FSNWG CV++FAPG+ I S    
Sbjct: 294 VAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHL 353

Query: 549 SDEATATLSGTSMASPHVAGLLSYFLSMQPDADXXXXXXXXXXXXPAQLKKKLIAYSTKN 608
           +   T  LSGTSM++P V G+ +  LS                  P  + +++   ST+N
Sbjct: 354 NYNDTLILSGTSMSTPIVTGVAAILLS--------------KGIEPEMIAQEIEYLSTRN 399

Query: 609 LFQD----LPEKTPNLLVYNAGHNISDFWKPKSESSAEPNERAKEFE 651
           +F          TPN ++YN    + D +  ++         AKE E
Sbjct: 400 VFHRRTLFFKPSTPNQILYNGVDKLDDPYDDETFPRLNIEAIAKELE 446

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
           Anc_6.313 YCR045C
          Length = 607

 Score =  176 bits (445), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 130/352 (36%), Positives = 175/352 (49%), Gaps = 34/352 (9%)

Query: 323 VDTQNNAPWGLARISHRDGL--------NLGSYNKYLYDDV-AGEGVTAYVIDTGINIKH 373
           VD Q  AP  L ++S R  L            +  Y YD    G     Y+IDTG+  +H
Sbjct: 147 VDIQFGAPRHLGKLSSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVVYIIDTGVYKEH 206

Query: 374 KEFGGRAVWG-KTIPENDQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGT 432
           KEFG R  +G   I E   D   NGHGTH AG I SK +G            L   G G 
Sbjct: 207 KEFGNRVHFGGDFIGEGKGDY--NGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGFGN 264

Query: 433 MSDVLKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVA 492
           ++ VL+G+E+A   +   L+++  G K    NMSLG  ++  ++ A+  A  SGI   VA
Sbjct: 265 LTSVLEGIEFAV--NNCKLKQQPMG-KNCVINMSLGTIRNPIINEAIKEAFLSGITPVVA 321

Query: 493 AGNENQDACNSSPAASENAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDE 551
           AGN N  AC +SPA+S  AITVGA    +D  A FSNWG+CVD+FAPG+ I S      E
Sbjct: 322 AGNNNFSACWTSPASSNFAITVGAMDDRTDTIAVFSNWGQCVDIFAPGVRIKSLSNRMLE 381

Query: 552 ATATLSGTSMASPHVAGLLSYFLSMQPDADXXXXXXXXXXXXPAQLKKKLIAYSTKNLFQ 611
                SGTSMASP VAGL++  +      D              ++K+KLI  S+K++F 
Sbjct: 382 NGVIHSGTSMASPIVAGLVAILMEKGYKCD--------------EIKQKLIDDSSKSIFS 427

Query: 612 DL----PEKTPNLLVYNAGHNISDFWKPKSESSAEPNERAKEFELEDLVDSA 659
            L       TPN ++YN    + +  K       E +E  +   +ED+ DSA
Sbjct: 428 KLTLFFKYGTPNRVIYNGIEEVINVNKENIRQREETDESKEYDTIEDIDDSA 479

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 496

 Score =  172 bits (437), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 120/343 (34%), Positives = 168/343 (48%), Gaps = 42/343 (12%)

Query: 326 QNNAPWGLARISHRDGLNLGSYN--------KYLYDD-VAGEGVTAYVIDTGINIKHKEF 376
           Q  AP  LARIS R  L     N         Y YDD  +G  V AYVIDTGI  +H + 
Sbjct: 135 QKKAPRHLARISRRTALPYDPENISVPATNFSYYYDDEFSGTCVNAYVIDTGIYKEHPQL 194

Query: 377 GGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTMSDV 436
            GRA +G  +   +   D NGHGTH AG I S+ +G            L + G G ++ V
Sbjct: 195 EGRAKFGADL-VGEGPGDFNGHGTHVAGLIGSRKFGVAKDVSLIEVKALNAKGQGNLTSV 253

Query: 437 LKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNE 496
           +  +E+        +   +K  +G  AN+SLG  ++  L+ AV+AA+++G+   VAAGN 
Sbjct: 254 ISAIEFT-------VNHCRKSRRGCVANLSLGSFRNTVLNQAVEAALEAGVVIVVAAGNS 306

Query: 497 NQDACNSSPAASENAITVGASTLSDDR----AYFSNWGKCVDVFAPGLNILSTYIGSDEA 552
           N +AC SSPA+S +AITVGA    DDR    A FSNWG CVD+FAPG+ I S        
Sbjct: 307 NANACWSSPASSLSAITVGA---FDDRTDTIARFSNWGNCVDIFAPGVKIESLSNVPPFK 363

Query: 553 TATLSGTSMASPHVAGLLSYFLSMQPDADXXXXXXXXXXXXPAQLKKKLIAYSTKNLFQD 612
               SGTSMASP V+G+++  L                   P  +K +LI  +T ++F  
Sbjct: 364 PVAFSGTSMASPIVSGMVANLLD--------------SGIHPFDIKTELIDLATDSVFHK 409

Query: 613 ----LPEKTPNLLVYNAGHNISDFWKPKSESSAEPNERAKEFE 651
                   TPN + +       D ++     S + +   K+ +
Sbjct: 410 RTLLFKPGTPNRVAFTGIDKTDDVYEDAVYPSVDIDRLVKDLQ 452

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  174 bits (440), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 115/298 (38%), Positives = 158/298 (53%), Gaps = 36/298 (12%)

Query: 326 QNNAPWGLARISHRDGLNLG-------SYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGG 378
           Q +AP  LAR   R GL          ++N Y  ++  GEGV  YV+D+GI   H EF G
Sbjct: 428 QVDAPRHLARTCRRTGLPFDPSGDKEYTFNYYYDEEHLGEGVNVYVLDSGIYKSHPEFDG 487

Query: 379 RAVWG-KTIPENDQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTMSDVL 437
           RA +G  T  E   D+  NGHGTH AG + S+ +G            +  DG G+ S+++
Sbjct: 488 RAHFGIDTTKEGPGDL--NGHGTHVAGLVGSRTFGIAKKANIYEIKVMTVDGRGSTSNII 545

Query: 438 KGVEYAAFSHQKALREKKKGFKGSTANMSLGG---GKSRSLDLAVDAAVKSGIHFAVAAG 494
            GVE+A       ++  ++  K   ANMSLGG   G S +LD AV+AA++ G+ F VAAG
Sbjct: 546 AGVEFA-------VKHCQQSGKRCVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVVAAG 597

Query: 495 NENQDACNSSPAASENAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEAT 553
           N  + AC  SPA  + AITVGA    SD  A FSN+GKCVD+FAPG+ + S         
Sbjct: 598 NSKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVASLSNSPSNTM 657

Query: 554 ATLSGTSMASPHVAGLLSYFLSMQPDADXXXXXXXXXXXXPAQLKKKLIAYSTKNLFQ 611
             L+GTSM++P  AG+++  L                   P ++K  L++ STK LF 
Sbjct: 658 RVLNGTSMSAPITAGVVAVLLDQ--------------GIEPHEVKDHLLSISTKGLFH 701

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
           Anc_6.313 YCR045C
          Length = 734

 Score =  172 bits (436), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 112/264 (42%), Positives = 139/264 (52%), Gaps = 22/264 (8%)

Query: 325 TQNNAPWGLARISHRDGLNLGSYN--------KYLYDDV-AGEGVTAYVIDTGINIKHKE 375
            Q  AP  LARIS RD L     N         Y YDD   GEGV AYVIDTGI  +HK+
Sbjct: 286 VQRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAYVIDTGILKEHKD 345

Query: 376 FGGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTMSD 435
           F  R  +G  +   +   D NGHGTH AG I SK YG            +   GS  +S 
Sbjct: 346 FEDRVEFGTDLT-GEGAGDLNGHGTHVAGLIGSKTYGVDKKVKIIDVKAVSLTGSTQLSH 404

Query: 436 VLKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGN 495
           +++ +EY        + +K         NMSLG    + ++ AV++A+  G+ F VAAGN
Sbjct: 405 IIEAIEYTVNDCNSRVDKK-----ACVVNMSLGSFYVKVINEAVESAIAEGVVFVVAAGN 459

Query: 496 ENQDACNSSPAASENAITVGASTLSDDR----AYFSNWGKCVDVFAPGLNILSTYIGSDE 551
            N DAC SSP +S+NAITVGA    DDR    A FSNWG+CVD+FA G+ + S       
Sbjct: 460 NNIDACWSSPGSSKNAITVGA---FDDRLDVIAKFSNWGECVDIFASGVEVKSLSSQVPY 516

Query: 552 ATATLSGTSMASPHVAGLLSYFLS 575
                SGTSMASP V G +S  LS
Sbjct: 517 KYIKYSGTSMASPIVCGFVSILLS 540

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
           Ashbya gossypii AAR069W
          Length = 610

 Score =  170 bits (431), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 117/314 (37%), Positives = 165/314 (52%), Gaps = 37/314 (11%)

Query: 326 QNNAPWGLARISHRDGLNLGS-------YNKYLYDDVAGEGVTAYVIDTGINIKHKEFGG 378
           Q+ AP  LAR   R GL   +       +N Y   +  GE V  Y++D+GI+  H EF G
Sbjct: 270 QSGAPRHLARNCRRSGLPFDTSGSKDYEFNYYYDAEHLGETVNVYILDSGIHKSHPEFEG 329

Query: 379 RAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTMSDVLK 438
           RAV+G     N+   D NGHGTH AG + SK YG            +  DG G+ S+++ 
Sbjct: 330 RAVFGIDT-TNEGPGDLNGHGTHVAGLVGSKTYGAAKKATIYEVKVMTVDGRGSTSNIIA 388

Query: 439 GVEYAAFSHQKALREKKKGFKGSTANMSLGG---GKSRSLDLAVDAAVKSGIHFAVAAGN 495
           GVE+A       ++  ++  K   ANMSLGG   G S +LD AV+AA++ G+ F VAAGN
Sbjct: 389 GVEFA-------VKHCQQSGKKCVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVVAAGN 440

Query: 496 ENQDACNSSPAASENAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATA 554
             + AC  SPA  + AITVGA    SD  A FSN+GKCVD+FAPG+ + S          
Sbjct: 441 SKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVSSLSNSPYNTVR 500

Query: 555 TLSGTSMASPHVAGLLSYFLSMQPDADXXXXXXXXXXXXPAQLKKKLIAYSTKNLFQD-- 612
            L+GTSM++P  AG+++  L      +               +K++LI  STK +F    
Sbjct: 501 VLNGTSMSAPITAGVVAVLLDQGVKHE--------------DVKERLIDLSTKGVFHRRR 546

Query: 613 -LPEKTPNLLVYNA 625
            +  +TP+  ++N 
Sbjct: 547 LVSSRTPDRTLFNG 560

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
           {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045c
          Length = 517

 Score =  166 bits (421), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 117/343 (34%), Positives = 158/343 (46%), Gaps = 62/343 (18%)

Query: 323 VDTQNNAPWGLARISHRDGLNL---------GSYNKYLYDDVAGEGVTAYVIDTGINIKH 373
           + TQ+ AP  LAR+S R  L             +N Y Y    G  V AYV+D+G+ I H
Sbjct: 157 IKTQSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQGRSVNAYVLDSGVMIDH 216

Query: 374 KEFGGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTM 433
            +F GRA +G     +    D NGHGTH AG I SK YG            L S GSGT+
Sbjct: 217 CDFEGRAYYGADFIRSGNSGDQNGHGTHVAGLIGSKTYGVSKKVNIIDVKVLDSVGSGTL 276

Query: 434 SDVLKGVEYAAF-----------------------SHQKALREKKKGFKGSTANMSLGGG 470
             V+ G+E+ +                        SH   +  K+        N+SLG  
Sbjct: 277 DTVMSGLEFVSNHCNYKGKQGKQGKQGKPVWGSEDSHDDDVESKR-----CVINLSLGTF 331

Query: 471 KSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGASTLSDDR----AYF 526
           +S  ++ A++  +K GI   VAAGN N +AC +SPA+  + ITVGA    DDR    A F
Sbjct: 332 RSTIINEAIEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGA---FDDRIDSIAKF 388

Query: 527 SNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLSYFLSMQPDADXXXXX 586
           SNWG CVD+FAPG+ + S            +GTSMA+P V GL++  L            
Sbjct: 389 SNWGNCVDIFAPGVLVKSLSNKFPYYPIEQTGTSMATPIVTGLVALLLD----------- 437

Query: 587 XXXXXXXPAQLKKKLIAYSTKNLFQD----LPEKTPNLLVYNA 625
                  P Q+KK+L   +T N+F          TPN + +N 
Sbjct: 438 ---SGIKPTQIKKRLNELATDNIFPRRTLLFKPGTPNRIAFNG 477

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
           Anc_6.313 YCR045C
          Length = 475

 Score =  164 bits (415), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 137/426 (32%), Positives = 194/426 (45%), Gaps = 62/426 (14%)

Query: 260 QFQYASVSDETSSSILGGIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVH 319
           +F  + +S +    + G I + F +  L  G   + +  ++  I+  P V  V  + +V 
Sbjct: 34  RFMNSVLSKDLKWFMGGKINKRFQIGEL-KGLTMNLSHDVLDKIKRHPFVKEVVPNIMVK 92

Query: 320 ANEVDT------------QNNAPWGLARISHRDGLNLGSYNK--------YLYDDVA-GE 358
           A E D             Q  AP  LARIS R  L     NK        Y YD  A G 
Sbjct: 93  AFEGDAVEDESWLPKMKRQRGAPRHLARISRRMQLPYDMNNKTRYRDSFNYYYDRWAQGA 152

Query: 359 GVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGXXXXXX 418
              AY++DTG+   HKEF  R  +G T    + + D NGHGTH AG + SK +G      
Sbjct: 153 TTRAYILDTGVMRDHKEFEDRVEFG-TDCTGEGEGDLNGHGTHVAGLVGSKTFGVAKHVQ 211

Query: 419 XXXXXXLRSDGSGTMSDVLKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLA 478
                 L + G+GT+  +L  +E+A    Q+    +         NMSLG  KS  L+ A
Sbjct: 212 LVDVKCLDALGAGTLVSILSALEFAVQDCQEHEDSQ------CVLNMSLGSVKSNILNQA 265

Query: 479 VDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGASTLSDDR----AYFSNWGKCVD 534
           ++   K GI   VAAGN N +AC +SP+++  AITVGA    DDR    A FSNWG CVD
Sbjct: 266 INEVEKKGIVVVVAAGNFNMNACWTSPSSATGAITVGAF---DDRFDTIAKFSNWGPCVD 322

Query: 535 VFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLSYFLSMQPDADXXXXXXXXXXXXP 594
           +FAPG+N+ S       +    SGTSMASP V G+++  L                   P
Sbjct: 323 IFAPGVNVASLVNRDWPSFVKYSGTSMASPIVCGMVALLLD--------------DGVPP 368

Query: 595 AQLKKKLIAYSTKNLFQD----LPEKTPNLLVYNAGHNISDFWKPKSESSAEPNERAKEF 650
             ++  L   +T  +F+         TPN ++YN           K +   E + +  + 
Sbjct: 369 EDIRDYLQELATDGVFKKRTLVFKPGTPNSVLYNGNK--------KHDDEYEDDLQYPQV 420

Query: 651 ELEDLV 656
           EL+DLV
Sbjct: 421 ELDDLV 426

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa]
           {ON} YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  160 bits (406), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 120/340 (35%), Positives = 170/340 (50%), Gaps = 36/340 (10%)

Query: 326 QNNAPWGLARISHRDGLNLGSYN--------KYLYDD-VAGEGVTAYVIDTGINIKHKEF 376
           Q NAP  LARIS R  L     N         Y YDD   G  V AYVIDTGI  +H++F
Sbjct: 133 QKNAPRHLARISRRSALPYNPENIAPKTSNFSYYYDDSFPGTCVNAYVIDTGIFKEHRQF 192

Query: 377 GGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTMSDV 436
            GRA +G  +   +   D NGHGTH AG I S+ YG            L + G G ++ V
Sbjct: 193 QGRAKFGADL-VGEGPGDLNGHGTHVAGLIGSQKYGVAKDVSLIEVKALNAKGQGNLTSV 251

Query: 437 LKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNE 496
           +  +E+        +   +K  +G  AN+SLG  ++  L+ AV+AA+++G+   VAAGN 
Sbjct: 252 ISAIEFT-------VNHCRKSKRGCVANLSLGSFRNSVLNQAVEAALEAGVVVVVAAGNS 304

Query: 497 NQDACNSSPAASENAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATAT 555
           N +AC SSPA+S +AI+VGA    +D  A FSNWG CVD+FAPG+ I S        +  
Sbjct: 305 NANACWSSPASSLSAISVGAFDDRTDTIARFSNWGNCVDLFAPGVKIASLSNIPPFKSVA 364

Query: 556 LSGTSMASPHVAGLLSYFLSMQPDADXXXXXXXXXXXXPAQLKKKLIAYSTKNLFQD--- 612
            SGTSMASP V G+++  L                   P  +K++LI  +T ++F     
Sbjct: 365 YSGTSMASPLVTGMVAVLLD--------------SGIHPFDIKEELINTATDSVFHKRAL 410

Query: 613 -LPEKTPNLLVYNAGHNISDFWKPKSESSAEPNERAKEFE 651
                TPN + +       D ++       + ++  K+ E
Sbjct: 411 LFKPGTPNRVAFTGVEKEDDIFEDAVYPGVDIDQLVKDLE 450

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
           Anc_6.313 YCR045C
          Length = 478

 Score =  159 bits (403), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 121/329 (36%), Positives = 165/329 (50%), Gaps = 45/329 (13%)

Query: 325 TQNNAPWGLARISHRDGL-----NLGSYNK---YLY-DDVAGEGVTAYVIDTGINIKHKE 375
            Q+ AP  LARIS RD L     N+ SY K   Y Y  +  G  V AY++D+G++    +
Sbjct: 118 VQSEAPRHLARISRRDKLPYDFTNVSSYKKSFNYYYGKEHKGADVRAYILDSGVSRNLTD 177

Query: 376 FGGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTMSD 435
           F GR  +G      D + D NGHGTH AG + SK YG            L   G GT+  
Sbjct: 178 FEGRVEFGFDFT-GDGEGDSNGHGTHVAGLVGSKTYGVAKGVTMVDVKCLDEIGFGTLIT 236

Query: 436 VLKGVEYAAF-SHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAG 494
           VL  +E+A    H+    EK+       AN+SLG  K+  ++ A+ AA + G+   VAAG
Sbjct: 237 VLSAIEFAVNDCHEHP--EKR-----CVANLSLGSFKNAIINKAIQAATEDGVVMVVAAG 289

Query: 495 NENQDACNSSPAASENAITVGASTLSDDR----AYFSNWGKCVDVFAPGLNILSTYIGSD 550
           N N +AC +SPA++E AITVGA    DDR    A FSNWG CVD++APG+ + S      
Sbjct: 290 NFNINACWTSPASAEEAITVGA---FDDRIDTIAKFSNWGPCVDIYAPGVAVESLANFPM 346

Query: 551 EATATLSGTSMASPHVAGLLSYFLSMQ-PDADXXXXXXXXXXXXPAQLKKKLIAYSTKNL 609
               + SGTSMASP V G ++  L    P+ D               +K  LI  +T ++
Sbjct: 347 VKNISYSGTSMASPIVCGQVAILLDKGIPNDD---------------IKSTLIKMATDDV 391

Query: 610 FQD----LPEKTPNLLVYNAGHNISDFWK 634
           FQ         TPN +++N      D +K
Sbjct: 392 FQKRTLLFKPNTPNRVLFNGIEKEDDQYK 420

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  157 bits (396), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 120/319 (37%), Positives = 161/319 (50%), Gaps = 41/319 (12%)

Query: 323 VDTQNNAPWGLARISHRDGLNLGSYNKYLYDDV---------AGEGVTAYVIDTGINIKH 373
           V  QN AP  LAR+S R  L     +K  Y+D           G  V AY+ID+GI+I  
Sbjct: 126 VKVQNGAPRHLARLSRRMPLPYDFDDKDAYNDSLSYYYSKWHQGTDVNAYIIDSGIDINQ 185

Query: 374 KEFGGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTM 433
           +EF GRA  G  +   +   D NGHGTH AG + SK YG            L   GSG++
Sbjct: 186 EEFEGRATHGLDLT-GEGPGDRNGHGTHVAGLVGSKTYGVAKNVTLVEVKALDRQGSGSL 244

Query: 434 SDVLKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAA 493
             V+  +E+   +H    + KK       AN+SLG      L+ A+ A V SG+   VAA
Sbjct: 245 ITVISALEFVV-NHCGKSKSKK-----CVANLSLGAFMMPLLNEAIKATVDSGVVVVVAA 298

Query: 494 GNENQDACNSSPAASENAITVGASTLSDDR----AYFSNWGKCVDVFAPGLNILSTYIGS 549
           GN N DAC  SPA+ ++AITVGA    DDR    A FSNWG CVD+FAPG+ I S  I  
Sbjct: 299 GNGNIDACWCSPASEKSAITVGAF---DDRIDTIAKFSNWGSCVDIFAPGVAISSLSIKD 355

Query: 550 DEATATLSGTSMASPHVAGLLSYFLSMQPDADXXXXXXXXXXXXPAQLKKKLIAYSTKNL 609
           ++ +   SGTSMASP VAG++S  L    + +               ++  L   +T ++
Sbjct: 356 NQKSVEFSGTSMASPQVAGIVSILLDQGVENE--------------DIRDYLFELATDDV 401

Query: 610 FQD----LPEKTPNLLVYN 624
           FQ        +TPN + +N
Sbjct: 402 FQKRTLLFKPRTPNRITFN 420

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
           similarities with uniprot|P25036 Saccharomyces
           cerevisiae YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  152 bits (383), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 124/324 (38%), Positives = 170/324 (52%), Gaps = 45/324 (13%)

Query: 325 TQNNAPWGLARISHRDGL------NLGSYNKYLY-DDVAGEGVTAYVIDTGINIKHKEFG 377
           +Q+ AP  LARIS R  L      +  S  KY Y ++  GEGV  YV+D+G+N  H +F 
Sbjct: 153 SQSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNHDHPDFE 212

Query: 378 GRAVWG-KTIPENDQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTMSDV 436
           GRA+ G  T  E   D+   GHGTH AG I SK YG            L S G GT++++
Sbjct: 213 GRAMKGIDTTGEGSGDL--VGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGKGTVTNI 270

Query: 437 LKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRS-LDLAVDAAVKSGIHFAVAAGN 495
           ++G+EY      + + +K+K       NMSLG   + S LD AV A ++ G+   VA GN
Sbjct: 271 IEGLEYVV---NQCIGKKRK----CVINMSLGAPGTHSILDKAVSAVIEEGVVVVVAGGN 323

Query: 496 ENQDACNSSPAASENAITVGASTLSDDR----AYFSNWGKCVDVFAPGLNILSTYIGSDE 551
              +AC  SPA    AITV A    DDR    A FSNWG C+D++APG+N+ S       
Sbjct: 324 SGLNACWYSPAKVRKAITVAA---MDDRTDLMAPFSNWGACIDIWAPGVNVKSLS-NKGR 379

Query: 552 ATATLSGTSMASPHVAGLLSYFLSMQPDADXXXXXXXXXXXXPAQLKKKLIAYSTKNLFQ 611
            T  LSGTSMASP VAG  + +L    D              PA+++K L   +T+ +F+
Sbjct: 380 GTFVLSGTSMASPIVAGAAAIYLDQGAD--------------PAEVRKILSKTATRGVFK 425

Query: 612 D----LPEKTPNLLVYNAGHNISD 631
                +  +TPN ++Y  G+N  D
Sbjct: 426 KRAIAVRPRTPNKVLYT-GNNQED 448

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
           Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  137 bits (345), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 100/319 (31%), Positives = 163/319 (51%), Gaps = 19/319 (5%)

Query: 262 QYASVSDETSSSILGGIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHAN 321
           +YA +SD       GG+  A ++ N F    G F ++L++ +     +  +  D I+   
Sbjct: 36  RYAQMSDN------GGVG-AISLGNSFRAIYGDFPQRLLENLYYDGRITAMSMDHILTPA 88

Query: 322 EVDTQNNAPWGLARISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAV 381
           E   Q +AP  LAR+S +  L  GS   Y+Y    G GV  Y++DTGI+  H E  GR  
Sbjct: 89  EYIVQEHAPAHLARLSQKSTLR-GSDGTYIYHSNGGNGVDVYLLDTGIDDLHPELEGRVQ 147

Query: 382 WGKTIPEND-QDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTMSDVLKGV 440
               +  N     D +GHGT  AG I S  +G              S G+ T+  V++ +
Sbjct: 148 KIADLTSNPVSHGDPHGHGTAVAGVIGSATFGSAKKCNLFDVRVADSTGNATLIGVIRAL 207

Query: 441 EYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVK-SGIHFAVAAGNENQD 499
           E+A  S   ++ ++      S   +     K+  L+ A++A ++   +   VA GN NQ+
Sbjct: 208 EHA--SKLASVTQRP-----SVVVIPFTMRKNVILNSAIEAVIRDQSLPVVVAGGNFNQN 260

Query: 500 ACNSSPAASENAITVGA--STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLS 557
           AC+SSPA++  A+T+G+   T  D  A F+N+G C+D FA G+NI S   G  E+    S
Sbjct: 261 ACDSSPASAYGALTIGSIDVTKGDSLAPFTNYGDCIDTFAAGVNITSLTTGDYESNTQYS 320

Query: 558 GTSMASPHVAGLLSYFLSM 576
           GTS+++   +G+++Y++S+
Sbjct: 321 GTSISAGIASGVVAYYMSL 339

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON}
           Anc_6.313 YCR045C
          Length = 497

 Score =  134 bits (337), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 93/256 (36%), Positives = 126/256 (49%), Gaps = 13/256 (5%)

Query: 325 TQNNAPWGLARISHRDGLNLGS---YNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAV 381
           TQ NAP  L+R S    L   S   YN Y   D  G  VT YV+D+GI + H EF GR +
Sbjct: 144 TQFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGANVTVYVLDSGIRMDHPEFEGRIL 203

Query: 382 WGKTIPENDQDV-DGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTMSDVLKGV 440
             +     D  V D  GHGT  AG I SK YG            L + G G +  +L+G+
Sbjct: 204 --EAYDFTDSGVGDNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKGKGNVFSILQGL 261

Query: 441 EYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDA 500
           ++      K   E   G      N SLG    + L+ A +    +GI    AAGN   +A
Sbjct: 262 QFIT----KHCEENTNG--NCIINASLGAINIQILNKAFEEVHNAGIPVICAAGNNAVNA 315

Query: 501 CNSSPAASENAITVGASTLSDDR-AYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGT 559
           C  +PA S+   TVG+    DD  A FSNWG+CVD+ APG+ + +    + + +   SGT
Sbjct: 316 CWITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYVRTLLYTNQKGSRESSGT 375

Query: 560 SMASPHVAGLLSYFLS 575
           S+++P V GL +  LS
Sbjct: 376 SVSTPIVTGLAAILLS 391

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 380

 Score =  127 bits (319), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 100/320 (31%), Positives = 167/320 (52%), Gaps = 19/320 (5%)

Query: 266 VSDETSSSILGGIEEAFNVANLFHGYIGHFNEQLVQ-FIRLSPIVDFVEQDSIVHANEVD 324
           + ++ ++++ GG   A  + N F    G F +QL++ F R   IV  +  D  +   E  
Sbjct: 33  LGEQYAATVAGGGVGAITLGNSFRAIYGEFPQQLLEDFYRSGQIVA-MSMDRPLGVAEYM 91

Query: 325 TQNNAPWGLARISHRDGLNLGSYN---KYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAV 381
            Q +AP  LAR+S +  L  G+ +    Y+Y   AG GV  Y++DTGI+  H  F GR  
Sbjct: 92  VQQHAPNHLARLSQKSSLRGGNGSDNGAYIYHSNAGNGVDVYLLDTGIDGTHPAFEGRVQ 151

Query: 382 WGKTIPENDQDV-DGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTMSDVLKGV 440
                  +     D +GHGT  AG I S  +G              S G  ++  VL+ +
Sbjct: 152 KAADFSSDPVATGDPHGHGTAVAGVIGSSVFGVAKKCNLFDVRVANSTGHASLIGVLRAL 211

Query: 441 EYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKS-GIHFAVAAGNENQD 499
           E+A  S   A+ ++      S   + L   ++  L+ AV+A V+   I   VAAGNEN+ 
Sbjct: 212 EHA--SKLAAVTKRP-----SLITIPLEMPRNTILNSAVEAVVRDLSIPVVVAAGNENRS 264

Query: 500 ACNSSPAASENAITVGASTLS--DDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATA-TL 556
           AC+ SPA +  A+T+G+  ++  D  A F+N+ +CVD+F  G+++ +  +G D ++   L
Sbjct: 265 ACSVSPAGAYGALTIGSIDVARNDALAPFTNFAECVDLFTAGVDVAT--LGLDHSSEHHL 322

Query: 557 SGTSMASPHVAGLLSYFLSM 576
           SGTS+++   +GL++Y++S+
Sbjct: 323 SGTSISAGVASGLVAYYMSI 342

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa]
           {ON} complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score =  122 bits (306), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 92/304 (30%), Positives = 157/304 (51%), Gaps = 24/304 (7%)

Query: 288 FHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARISH---RDGLNL 344
           FHG+ G F ++++  +   P V  +  D +++  E   QN+AP  LAR+S+      ++ 
Sbjct: 61  FHGFSGEFEDEVMSELYGDPRVASISIDRMLYLQEYLRQNDAPEHLARLSNGVSNSRVSA 120

Query: 345 GSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDV---DGNGHGTH 401
            + N +++   AG GV  Y++D+GI+ +H  F  R +  K I   D  +   D +GHGT 
Sbjct: 121 KNENAFIFHSHAGIGVDVYIVDSGIDSQHPAFMNRHI-SKLIDLTDNPIPVGDPHGHGTA 179

Query: 402 CAGTIASKNYGXXXXXXXXXXXXLRSDGSGT-MSDVLKGVEYAAFSHQKALREKKKGFKG 460
            AG + S  +G            + ++ +G  +S +LK +E+   +H +A        + 
Sbjct: 180 IAGLVTSDTFGVMKKANLFDVRVVDAESNGVKLSKLLKSLEFIE-NHSRA------TMRP 232

Query: 461 STANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGASTLS 520
           S A +     K+  L+ A+++   S I   V AGN++  ACN SPA++ N+ ++ +    
Sbjct: 233 SVAVLPFSMSKNAILNSAIESMPNS-IAIVVPAGNQHHMACNFSPASARNSQSILSVGSL 291

Query: 521 DDR-----AYFSNWGKCVDVFAPGLNI--LSTYIGSDE-ATATLSGTSMASPHVAGLLSY 572
           D R     A FSN+G+CVDVF  G+ +  L     SDE   + +SGTSM+    AG + Y
Sbjct: 292 DYRSSIEIASFSNYGECVDVFTSGVQMDTLHATTNSDENYISKVSGTSMSCAIAAGTVGY 351

Query: 573 FLSM 576
           ++S+
Sbjct: 352 YMSL 355

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]
           {ON} conserved hypothetical protein
          Length = 386

 Score =  104 bits (260), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 87/303 (28%), Positives = 138/303 (45%), Gaps = 23/303 (7%)

Query: 288 FHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARISHRDGLNLGSY 347
           F  + G F+  ++Q +   P V  + +D  +   E+  QNNAP  L  +S    L   S+
Sbjct: 54  FRAFTGDFSGPILQKLYNDPNVLAISRDGSLKLQEIVLQNNAPSHLVGLSSISPL---SH 110

Query: 348 NKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGK---TIPENDQDVDGNGHGTHCAG 404
             ++Y    G GV  Y++DTGI+IKH       +      T     Q  D  GHGT  AG
Sbjct: 111 QPFIYRSNGGNGVDVYLLDTGIDIKHPNLSKLNILRMADLTQSPVPQGTDPQGHGTAMAG 170

Query: 405 TIASKNYGXXXXXXXXXXXXLRSDGSGTMSDVLKGVEYAAFSHQKALREKKKGFKGSTAN 464
            IAS+ +G              S+G   +S +L+ +       Q+ +   K+        
Sbjct: 171 IIASETFGVLKKCNLVDVRVADSNGDVKLSTILQALTLT----QRHIEGTKRP-SVVVIP 225

Query: 465 MSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPA----ASENAITVGASTLS 520
           + +  G +  L  A+ A+    +   + AGN  QDA N SPA      +N I VG+  ++
Sbjct: 226 LEVEDGNNPILTEAI-ASFDQSVPIIIPAGNNAQDALNFSPANVNPKPKNIIVVGSVDVN 284

Query: 521 DDRAYFSNWGKCVDVFAPGLNI-------LSTYIGSDEATATLSGTSMASPHVAGLLSYF 573
           ++   F+N+G  VDVF  G  I       L +   S+  T  +SGTS +S   AG++ Y+
Sbjct: 285 NNPTKFTNYGSNVDVFTVGEQITTLQSTDLDSQGLSNSLTRQVSGTSASSAITAGVIGYY 344

Query: 574 LSM 576
           +S+
Sbjct: 345 MSL 347

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa]
           {ON} Anc_1.78
          Length = 364

 Score =  101 bits (252), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 82/303 (27%), Positives = 137/303 (45%), Gaps = 21/303 (6%)

Query: 280 EAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARISHR 339
           E   V + F    G F+ + ++++     V  + +D  +   E   Q  +P  L+++S  
Sbjct: 45  EMITVGDQFKALAGEFSVEDLEYLYHDERVVAISRDRDLKLQEYKVQYGSPRHLSQLS-- 102

Query: 340 DGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKH---KEFGGRAVWGKTIPENDQDVDGN 396
                 S   + +D V+G  V  YV DTGI+ KH   +      +   T     +  D +
Sbjct: 103 ------SGGSFTFDPVSGNLVDVYVFDTGIDFKHPGLQNVNPHKLADFTSSPVPRGADPH 156

Query: 397 GHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGSGTMSDVLKGVEYAAFSHQKALREKKK 456
           GHGT  AG IAS+ +G               DG   +S ++KG+  A+ +H +  +    
Sbjct: 157 GHGTMMAGLIASETFGVLKSCSLVDVRVADKDGEVKLSTLMKGIS-ASVAHARFTK---- 211

Query: 457 GFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGA 516
             + S   + +  GK   +      A+   I   + AGN+  DAC+ SP    N + +G+
Sbjct: 212 --RPSVFVLPMTIGKKNHILDNFLQAIPKDIAIVLPAGNQQTDACDLSPPNDHNILVIGS 269

Query: 517 STLSDDRAYFSNWGKCVDVFAPGLNIL---STYIGSDEATATLSGTSMASPHVAGLLSYF 573
               +  A FSN+G CVDV+  G +IL   ST  G++    + +GTS +    AG++ Y 
Sbjct: 270 LDRDNRLADFSNYGNCVDVYTSGTDILTLRSTDSGNEVLLQSSNGTSASCAIGAGIVGYH 329

Query: 574 LSM 576
           +SM
Sbjct: 330 MSM 332

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa]
           {ON} Anc_1.78
          Length = 388

 Score =  100 bits (249), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 79/269 (29%), Positives = 130/269 (48%), Gaps = 29/269 (10%)

Query: 326 QNNAPWGLARISHRDGLNLGSY----NKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAV 381
           Q +AP  L R++ +D +    Y    N+Y++ D +G GV  Y++DTGI+I+H  +    +
Sbjct: 97  QTDAPKHLGRLT-KDSIKSSQYHYANNQYIFSDTSGNGVDIYIVDTGIDIQHPIYLQNNI 155

Query: 382 WGKTIPENDQDV---DGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRSDGS-GTMSDVL 437
             K I      +   D NGHGT  AG I S  +G            + ++    TMS VL
Sbjct: 156 H-KLIDLTTSPIPSGDFNGHGTAMAGIINSDPFGVLKSANLVDVRVVDANTKHATMSRVL 214

Query: 438 KGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNEN 497
             +       QK +R        S   +     K+  L+ A++   K  I   + AGN++
Sbjct: 215 SALSLIEKHEQKTMRP-------SIIVLPFQTEKNTILESAIENISKK-IPVIIPAGNKH 266

Query: 498 QDACNSSPAASE---NAITVGASTLSDDRAY-----FSNWGKCVDVFAPGLNILSTYIGS 549
           Q+AC  SP   +   N + VG+   S+++ Y     FSN+G CVD++  G++I +    S
Sbjct: 267 QNACKLSPMGIKKLSNVLVVGSLEYSEEQNYLDIAKFSNYGSCVDIYTSGVDISTLKTSS 326

Query: 550 D---EATATLSGTSMASPHVAGLLSYFLS 575
           +   E    ++GTS +   VAG++ Y++S
Sbjct: 327 NGGKELIHNVTGTSYSCGIVAGVVGYYMS 355

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 76/280 (27%), Positives = 121/280 (43%), Gaps = 30/280 (10%)

Query: 312 VEQDSIVHANEVDTQNNAPWGLARISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINI 371
           +  D  +   E+  Q +AP  L ++   +  +    N+++YD  AG GV  Y+ DTGI  
Sbjct: 83  ISIDRQLEPQEMIVQKDAPRHLTKLLETEAGD----NEFVYDSTAGNGVDIYIFDTGIAR 138

Query: 372 KHKEFGGRAVWGKT----IPENDQDVDGNGHGTHCAGTIASKNYGXXXXXXXXXXXXLRS 427
                    +         P  DQ++    HGT  +G I S  +G               
Sbjct: 139 NSPGLSASRIHDMPGMPGPPIRDQEIL--EHGTAMSGLIGSPAFGVLKKCNLIDVNVGDE 196

Query: 428 DGSGTMSDVLKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGI 487
           +G   MS VLKG+           +  K   + S  N S    K+  L+ A D   +  +
Sbjct: 197 NGKVFMSKVLKGLNLVQ-------QHVKHTNRPSVINFSYCTLKNAILNSAFDNFPRD-V 248

Query: 488 HFAVAAGNENQDACNSSPAASE---NAITVGASTLSDD---RAYFSNWGKCVDVFAPGLN 541
             AVAAGN  Q  C+ SP   +   + +  G+  ++DD    + FSN+G CV  +APG  
Sbjct: 249 PIAVAAGNYKQPGCSFSPVGCQRNKSLLAFGSLLMNDDGITLSDFSNYGSCVGSYAPGEG 308

Query: 542 ILSTYI------GSDEATATLSGTSMASPHVAGLLSYFLS 575
           +L+  I       S +    +SGTS +S   AG++ Y+++
Sbjct: 309 LLTFGIPDTSRPNSRDTVIIISGTSGSSALGAGVIGYYMA 348

>SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 836

 Score = 35.4 bits (80), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 6/63 (9%)

Query: 352 YDDVAGEGVTAYVIDTGINIKHKE----FGGRAVW--GKTIPENDQDVDGNGHGTHCAGT 405
           Y+++ G GV A ++D G++ ++++    F     W      P     +  + HGT CAG 
Sbjct: 185 YENITGHGVVAAIVDDGLDYENRDLKDNFCAEGSWDFNDNTPLPKPRLRDDYHGTRCAGE 244

Query: 406 IAS 408
           IA+
Sbjct: 245 IAA 247

>NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6
           YNL238W
          Length = 833

 Score = 35.0 bits (79), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 67/254 (26%), Positives = 96/254 (37%), Gaps = 36/254 (14%)

Query: 352 YDDVAGEGVTAYVIDTGI-----NIKHKEFGGRAVW--GKTIPENDQDVDGNGHGTHCAG 404
           Y++V G G+ A ++D G+     NIK   F     W      P     +  + HGT CAG
Sbjct: 186 YENVTGTGIVAAIVDDGVDYDNDNIK-DNFSREGSWDFNDNGPLPKPKLKDDYHGTRCAG 244

Query: 405 TI-ASKNYGXXXXXXXXXXXXLRSDGSGTMSDVLKGVEYAA-----------FSHQKALR 452
            I ASKN G             +  G   +S  L   + AA           +S     R
Sbjct: 245 EIAASKNNGICGVGVAYDA---KVAGIRILSGELTAEDEAASLVHALDVNDIYSCSWGPR 301

Query: 453 EKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQ--DACN-SSPAASE 509
           +     +G T  +     K   +    +   + G  +  A+GN     D CN      S 
Sbjct: 302 DDGTHLQGPTDLV-----KKAMIRGVTEGRDQKGALYVFASGNGGAYGDNCNYDGYTNSI 356

Query: 510 NAITVGASTLSDDRAYFSNWGKCVDVFA----PGLNILSTYIGSDEATATLSGTSMASPH 565
            +ITVGA         +S     V V       G  I +T IG D+ + T  GTS A+P 
Sbjct: 357 YSITVGAIDHKGLHPPYSESCSAVMVVTCSSGSGEFIHTTDIG-DKCSNTHGGTSAAAPL 415

Query: 566 VAGLLSYFLSMQPD 579
            AG+ +  L   P+
Sbjct: 416 AAGVYTLVLQANPE 429

>Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238W
           (REAL)
          Length = 819

 Score = 34.7 bits (78), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 36/69 (52%), Gaps = 10/69 (14%)

Query: 349 KYLYDDVAGEGVTAYVIDTGINIKHKE----FGGRAVW----GKTIPENDQDVDGNGHGT 400
           K  Y+++ G GV A ++D G++ ++++    F     W       +P+    +  + HGT
Sbjct: 158 KLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPK--PRLSDDYHGT 215

Query: 401 HCAGTIASK 409
            CAG IA+K
Sbjct: 216 RCAGEIAAK 224

>KNAG0F00770 Chr6 (137641..140121) [2481 bp, 826 aa] {ON} Anc_2.6
           YNL238W
          Length = 826

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 65/254 (25%), Positives = 99/254 (38%), Gaps = 36/254 (14%)

Query: 352 YDDVAGEGVTAYVIDTGINIKHKE----FGGRAVW----GKTIPENDQDVDGNGHGTHCA 403
           Y +V G GV   ++D G++ ++ +    F     W      T+P+    +  + HGT CA
Sbjct: 165 YGNVTGSGVVVAIVDDGVDYENPDIADNFCAEGSWDFNDNTTLPK--PRLADDYHGTRCA 222

Query: 404 GTI-ASKNYGXX--XXXXXXXXXXLRS-DGSGTMSDVLKGVEYA-----AFSHQKALREK 454
           G I ASKN G              LR   G  T  D    + YA      FS     ++ 
Sbjct: 223 GEIAASKNNGFCGIGVAYNSKVSGLRILSGPLTPEDEAASLMYALDVNDIFSCSWGPQDD 282

Query: 455 KKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQ--DACN-SSPAASENA 511
            +  +G +  +     +   +    +   K G  +  A+GN     D CN      S  +
Sbjct: 283 GRHLQGPSELV-----RKALIKGVTEGRQKKGSVYVFASGNGGHFGDNCNYDGYTNSIYS 337

Query: 512 ITVGASTLSDDRAYFSNWGKCVDVFA------PGLNILSTYIGSDEATATLSGTSMASPH 565
           IT+GA         +S    C  V A       G  I ST I +D+ +    GTS A+P 
Sbjct: 338 ITIGAIDHKGLHPPYSE--SCSAVMAVTYSSGSGEFIHSTDI-NDQCSDRHGGTSAAAPL 394

Query: 566 VAGLLSYFLSMQPD 579
            AG+ +  L   P+
Sbjct: 395 AAGIYALLLEANPE 408

>YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}
           KEX2Subtilisin-like protease (proprotein convertase), a
           calcium-dependent serine protease involved in the
           activation of proproteins of the secretory pathway
          Length = 814

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 10/66 (15%)

Query: 352 YDDVAGEGVTAYVIDTGINIKHKE----FGGRAVW----GKTIPENDQDVDGNGHGTHCA 403
           Y+++ G GV A ++D G++ ++++    F     W       +P+    +  + HGT CA
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPK--PRLSDDYHGTRCA 218

Query: 404 GTIASK 409
           G IA+K
Sbjct: 219 GEIAAK 224

>Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238W
           (REAL)
          Length = 809

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 10/66 (15%)

Query: 352 YDDVAGEGVTAYVIDTGINIKHKE----FGGRAVW----GKTIPENDQDVDGNGHGTHCA 403
           Y+++ G GV A ++D G++ ++++    F     W       +P+    +  + HGT CA
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPK--PRLSDDYHGTRCA 218

Query: 404 GTIASK 409
           G IA+K
Sbjct: 219 GEIAAK 224

>NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {ON}
           Anc_2.6 YNL238W
          Length = 833

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 34/68 (50%), Gaps = 10/68 (14%)

Query: 349 KYLYDDVAGEGVTAYVIDTGINIKHKE----FGGRAVW----GKTIPENDQDVDGNGHGT 400
           K  Y+++ GEG+   ++D G++ ++ +    F     W       +P+    +  + HGT
Sbjct: 172 KLWYENITGEGIVVAIVDDGLDYENPDLKDNFSAEGSWDFNDNTQLPK--PRLADDYHGT 229

Query: 401 HCAGTIAS 408
            CAG IA+
Sbjct: 230 RCAGEIAA 237

>ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]
           {ON} similar to uniprot|P13134 YNL238W Saccharomyces
           cerevisiae KEX2 Subtilisin-like protease (proprotein
           convertase)
          Length = 790

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 10/65 (15%)

Query: 352 YDDVAGEGVTAYVIDTGINIKHKE----FGGRAVW----GKTIPENDQDVDGNGHGTHCA 403
           Y+++ G GV A ++D G++ + ++    F     W       +P+    +D + HGT CA
Sbjct: 154 YENITGHGVVAAIVDDGLDYESEDLKDNFCKEGSWDFNDNTKLPK--PRLDDDYHGTRCA 211

Query: 404 GTIAS 408
           G IA+
Sbjct: 212 GEIAA 216

>Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W
           (REAL)
          Length = 814

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 10/66 (15%)

Query: 352 YDDVAGEGVTAYVIDTGINIKHKE----FGGRAVW----GKTIPENDQDVDGNGHGTHCA 403
           Y+++ G GV A ++D G++ ++++    F     W       +P+    +  + HGT CA
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPK--PRLLDDYHGTRCA 218

Query: 404 GTIASK 409
           G IA+K
Sbjct: 219 GEIAAK 224

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,549,930
Number of extensions: 2491849
Number of successful extensions: 5655
Number of sequences better than 10.0: 79
Number of HSP's gapped: 5557
Number of HSP's successfully gapped: 83
Length of query: 680
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 564
Effective length of database: 40,180,143
Effective search space: 22661600652
Effective search space used: 22661600652
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)