Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1032.46.13ON46746724860.0
Kpol_1045.766.13ON48546221780.0
KLTH0C11462g6.13ON49245921600.0
Kwal_56.223626.13ON49346021560.0
SAKL0E00946g6.13ON49346021450.0
KLLA0D00902g6.13ON49246021320.0
TPHA0J002706.13ON49646121290.0
Ecym_30166.13ON48946121210.0
TDEL0G045806.13ON48446021110.0
CAGL0A01045g6.13ON48346120950.0
ACR013C6.13ON48846320910.0
Skud_16.166.13ON48846020300.0
YPL262W (FUM1)6.13ON48846020280.0
Smik_6.4706.13ON48846020250.0
Suva_16.436.13ON48846020180.0
NCAS0D026206.13ON49346019910.0
ZYRO0C07964g6.13ON50545919790.0
KNAG0E027506.13ON49846019670.0
KAFR0B065206.13ON49546519400.0
TBLA0G010006.13ON46546019120.0
NDAI0I024706.13ON47546018980.0
TBLA0A071306.13ON50046218940.0
AEL019W1.354ON4692341161e-05
TBLA0A083204.197ON4822101115e-05
CAGL0B02794g4.197ON4821861115e-05
Suva_10.4594.197ON4821861107e-05
YLR359W (ADE13)4.197ON4821861107e-05
Smik_12.4464.197ON4821861098e-05
NCAS0A090101.354ON4622071099e-05
CAGL0I08987g1.354ON4612081072e-04
NDAI0G059401.354ON4622121072e-04
Kpol_1042.164.197ON4821891062e-04
TPHA0A021901.354ON4632261053e-04
TPHA0B010404.197ON4821841053e-04
Ecym_24524.197ON4821941053e-04
KNAG0I015601.354ON4622301053e-04
Ecym_27491.354ON4702091053e-04
KLLA0A08404g1.354ON4612121044e-04
Skud_12.4434.197ON4821861035e-04
SAKL0D09746g1.354ON4642251035e-04
Kwal_47.180664.197ON4821831035e-04
NDAI0J019504.197ON4821911035e-04
Skud_8.701.354ON4632071026e-04
TBLA0F034801.354ON4662241018e-04
NCAS0J012004.197ON4821891019e-04
KLLA0B13189g4.197ON4821921019e-04
Suva_15.2011.354ON4632571010.001
KNAG0B058404.197ON4821891000.001
ZYRO0B07964g4.197ON482189990.001
SAKL0B04972g4.197ON482191990.002
KAFR0A062304.197ON482186980.002
KLTH0G19338g1.354ON465288960.004
ZYRO0G00748g1.354ON462217960.004
TDEL0D022201.354ON465224960.004
TDEL0E017604.197ON482191940.006
KLTH0A03344g4.197ON482189920.010
Kwal_27.127821.354ON465244910.014
Smik_8.831.354ON463207900.021
Kpol_1018.1251.354ON460228890.023
ABL006C4.197ON482190840.095
YHR018C (ARG4)1.354ON463225830.13
KLLA0D15081g3.438ON101057732.5
ACR072C5.271ON990179723.6
KNAG0D034804.117ON116248713.9
Ecym_44523.426ON122171705.0
AAR086W3.438ON80757688.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1032.4
         (467 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..516...   962   0.0  
Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa] ...   843   0.0  
KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {...   836   0.0  
Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W ...   835   0.0  
SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly s...   830   0.0  
KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly s...   825   0.0  
TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13...   824   0.0  
Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to ...   821   0.0  
TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {O...   817   0.0  
CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {...   811   0.0  
ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON} S...   810   0.0  
Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W (...   786   0.0  
YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumaras...   785   0.0  
Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON...   784   0.0  
Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W (...   781   0.0  
NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {O...   771   0.0  
ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {...   766   0.0  
KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.1...   762   0.0  
KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6...   751   0.0  
TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.1...   741   0.0  
NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {O...   735   0.0  
TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6...   734   0.0  
AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic ho...    49   1e-05
TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa] ...    47   5e-05
CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {...    47   5e-05
Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359...    47   7e-05
YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}  ADE13Aden...    47   7e-05
Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359...    47   8e-05
NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa] ...    47   9e-05
CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {...    46   2e-04
NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON} Anc_1...    46   2e-04
Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON} (40749....    45   2e-04
TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.3...    45   3e-04
TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {O...    45   3e-04
Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar t...    45   3e-04
KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.3...    45   3e-04
Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {O...    45   3e-04
KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {...    45   4e-04
Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359...    44   5e-04
SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {...    44   5e-04
Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359...    44   5e-04
NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4....    44   5e-04
Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}...    44   6e-04
TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.3...    44   8e-04
NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4....    44   9e-04
KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]...    44   9e-04
Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {...    44   0.001
KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON} Anc_4...    43   0.001
ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {...    43   0.001
SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly...    43   0.002
KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa] ...    42   0.002
KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]...    42   0.004
ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly s...    42   0.004
TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.3...    42   0.004
TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {O...    41   0.006
KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly...    40   0.010
Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]...    40   0.014
Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}...    39   0.021
Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]...    39   0.023
ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON} S...    37   0.095
YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}  ...    37   0.13 
KLLA0D15081g Chr4 (1271696..1274728) [3033 bp, 1010 aa] {ON} som...    33   2.5  
ACR072C Chr3 complement(489699..492671) [2973 bp, 990 aa] {ON} S...    32   3.6  
KNAG0D03480 Chr4 complement(625236..628724) [3489 bp, 1162 aa] {...    32   3.9  
Ecym_4452 Chr4 complement(923429..927094) [3666 bp, 1221 aa] {ON...    32   5.0  
AAR086W Chr1 (496601..499024) [2424 bp, 807 aa] {ON} Syntenic ho...    31   8.7  

>Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..5164)
           [1404 nt, 468 aa]
          Length = 467

 Score =  962 bits (2486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/467 (100%), Positives = 467/467 (100%)

Query: 1   MSFPNGFRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSA 60
           MSFPNGFRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSA
Sbjct: 1   MSFPNGFRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSA 60

Query: 61  AIVNEEFGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAI 120
           AIVNEEFGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAI
Sbjct: 61  AIVNEEFGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAI 120

Query: 121 ELKGGIMGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSK 180
           ELKGGIMGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSK
Sbjct: 121 ELKGGIMGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSK 180

Query: 181 EFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGL 240
           EFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGL
Sbjct: 181 EFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGL 240

Query: 241 NTKIGFAERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIR 300
           NTKIGFAERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIR
Sbjct: 241 NTKIGFAERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIR 300

Query: 301 YLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQF 360
           YLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQF
Sbjct: 301 YLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQF 360

Query: 361 ELNVFKPVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKI 420
           ELNVFKPVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKI
Sbjct: 361 ELNVFKPVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKI 420

Query: 421 GYDSATKVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGPS 467
           GYDSATKVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGPS
Sbjct: 421 GYDSATKVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGPS 467

>Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa]
           {ON} complement(177449..178906) [1458 nt, 486 aa]
          Length = 485

 Score =  843 bits (2178), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/462 (87%), Positives = 433/462 (93%)

Query: 6   GFRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNE 65
           GFR+ETDGFGEIKVPA+KYWGAQT+RS+ENFKIGG RERMPE VV+AFGVLKK AAIVN 
Sbjct: 23  GFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAAIVNT 82

Query: 66  EFGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGG 125
           E G LD   SKLIQQAADEV  GKLN+HFPLVVFQTGSGTQSNMNANEVISNRAIELKGG
Sbjct: 83  ELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELKGG 142

Query: 126 IMGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHI 185
           ++GSKEIHPNNHCNMAQSSNDTFPTVMHIAAVT+I+ HL+P++T L+DALA KS EFEHI
Sbjct: 143 VLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHI 202

Query: 186 VKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIG 245
           VKIGRTHLQDATPLTLGQEFSGYVQQL NGI RIE +  NL+FLAQGGTAVGTGLNTK G
Sbjct: 203 VKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNG 262

Query: 246 FAERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSG 305
           +AERIA ++SKETG+ FKTAPNKFEALAAHDAIVE+SGALNTVACSLFKIAQDIRYLGSG
Sbjct: 263 WAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSG 322

Query: 306 PRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVF 365
           PRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA+TFAGASGQFELNVF
Sbjct: 323 PRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFELNVF 382

Query: 366 KPVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSA 425
           KPV+ISNLLSS++LLGDA  SF +HCVEGI+ANE KI++LLH SLMLVTALNPKIGYD+A
Sbjct: 383 KPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIGYDAA 442

Query: 426 TKVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGPS 467
           TKVAKNAHKKGITLKESALELGVLTE EFDEWVVPEKMLGPS
Sbjct: 443 TKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGPS 484

>KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 492

 Score =  836 bits (2160), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/459 (86%), Positives = 426/459 (92%)

Query: 8   RLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEEF 67
           R+ETD FGEI VPADKYWGAQTQRS ENFKIGG RERMPEPVV+AFG+LKKSAAIVNE  
Sbjct: 33  RVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEPVVRAFGILKKSAAIVNESL 92

Query: 68  GILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGIM 127
           G LD  ISK IQQAADEVI GKL +HFPLVVFQTGSGTQSNMNANEVISNRAIE+ GG M
Sbjct: 93  GTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNANEVISNRAIEIVGGKM 152

Query: 128 GSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIVK 187
           G+K IHPNNHCN AQSSNDTFP+VMHIAAVTEITH L+P++T L+D+ A KSKEFE IVK
Sbjct: 153 GTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFATKSKEFESIVK 212

Query: 188 IGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGFA 247
           IGRTHLQDATPLTLGQEFSGYVQQL NGI+R+E SLI+LKFLAQGGTAVGTGLNTK+GF 
Sbjct: 213 IGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQGGTAVGTGLNTKVGFG 272

Query: 248 ERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGPR 307
           E+IAEQVSKETGI+FKTAPNKFEALAAHDAIVE SGALNT+ACSLFKIA DIRYLGSGPR
Sbjct: 273 EKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPR 332

Query: 308 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKP 367
           CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKP
Sbjct: 333 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKP 392

Query: 368 VMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSATK 427
           VMISNLLSS+RLLGDAC+SF +HCV+GI+AN DKI KLLHESLMLVTALNPKIGYD+A+K
Sbjct: 393 VMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHESLMLVTALNPKIGYDAASK 452

Query: 428 VAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466
           VAKNAHKKGITLKESALEL VLT  EFD+WVVPE M+GP
Sbjct: 453 VAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGP 491

>Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W
           (FUM1) - mitochondrial and cytoplasmic fumarase
           (fumarate hydralase) [contig 186] FULL
          Length = 493

 Score =  835 bits (2156), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/460 (86%), Positives = 427/460 (92%)

Query: 7   FRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEE 66
           +R+ETD FGEIKVP DK WGAQTQRS ENFKIGG RERMPEP+VKAFG+LKKSAAIVNE 
Sbjct: 32  YRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGILKKSAAIVNES 91

Query: 67  FGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGI 126
            G LD  +SK IQ AADEVI GKL +HFPLVVFQTGSGTQSNMNANEVISNRAI+L GG 
Sbjct: 92  LGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNRAIQLVGGE 151

Query: 127 MGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIV 186
           +GSK IHPNNHCN AQSSNDTFP+VMHIAAVTE+TH L+P++  L+DA A K++EF+ IV
Sbjct: 152 VGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDSIV 211

Query: 187 KIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGF 246
           KIGRTHLQDATPLTLGQEFSGYVQQL NGI+R+EHSL NLKFLAQGGTAVGTGLNTK+GF
Sbjct: 212 KIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKVGF 271

Query: 247 AERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGP 306
           AE+IAEQVSKETGI+FKTAPNKFEALAAHDA+VE SGALNT+ACSLFKIA DIRYLGSGP
Sbjct: 272 AEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGP 331

Query: 307 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 366
           RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK
Sbjct: 332 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 391

Query: 367 PVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSAT 426
           PVMISNLLSSIRLLGDAC+SF +HCVEGIQANEDKI KLLHESLMLVTALNPKIGYD+A+
Sbjct: 392 PVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTALNPKIGYDAAS 451

Query: 427 KVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466
           KVAKNAHKKGITLKESALELGVL+  EFDEWVVPE M+GP
Sbjct: 452 KVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGP 491

>SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 493

 Score =  830 bits (2145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/460 (85%), Positives = 428/460 (93%)

Query: 7   FRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEE 66
           +R+ETD FGEIKVPADKYWGAQTQRS+ENFKIGG RERMPE VV+AFGVLKKSAAIVNE 
Sbjct: 32  YRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAIVNES 91

Query: 67  FGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGI 126
            G LD  ISK IQ+AADEVI+GKL +HFPLVVFQTGSGTQSNMNANEVISNRAIE+ GG 
Sbjct: 92  LGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEIIGGE 151

Query: 127 MGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIV 186
            GSK++HPNNHCN AQSSNDTFP+VMHIAAVTEITH L+P++T L+D+   KS EF  IV
Sbjct: 152 KGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSSIV 211

Query: 187 KIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGF 246
           KIGRTHLQDATPLTLGQEFSGYVQQL NGIAR+E SL +LKFLAQGGTAVGTGLNTK+GF
Sbjct: 212 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTKVGF 271

Query: 247 AERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGP 306
           AE+IAEQVSKETGI+FKTAPNKFEALAAHDA+VE SGALNT+ACSLFKIA DIRYLGSGP
Sbjct: 272 AEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGP 331

Query: 307 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 366
           RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK
Sbjct: 332 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 391

Query: 367 PVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSAT 426
           PVMISNLLSS+RLL DA +SF +HCV+GI+ANED+I+KLLHESLMLVTALNPKIGYD+A+
Sbjct: 392 PVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGYDAAS 451

Query: 427 KVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466
           KVAKNAHKKGITLKESAL+LGVL E EFDEWV+PEKM+GP
Sbjct: 452 KVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGP 491

>KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 492

 Score =  825 bits (2132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/460 (85%), Positives = 430/460 (93%)

Query: 7   FRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEE 66
           +R+ETD FGEI+VP+DKYWGAQTQRS +NFKIGGPRERMPEP+VKAFGVLKKSAA+VNE 
Sbjct: 31  YRVETDAFGEIQVPSDKYWGAQTQRSLQNFKIGGPRERMPEPIVKAFGVLKKSAAVVNER 90

Query: 67  FGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGI 126
            G LD  I+K I+QAADEV +GKL EHFPLVVFQTGSGTQSNMNANEVISNRAIEL GG 
Sbjct: 91  LGTLDPEIAKPIKQAADEVAQGKLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 150

Query: 127 MGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIV 186
           +GSK+IHPNNHCN AQSSNDTFP+VMHIAAVTEITHHL+P++  LK AL  KS EF+HIV
Sbjct: 151 LGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELEGLKVALKQKSDEFQHIV 210

Query: 187 KIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGF 246
           KIGRTHLQDATPLTLGQEFSGYVQQ+ NGIAR++ SL +LKFLAQGGTAVGTGLNTK+GF
Sbjct: 211 KIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFLAQGGTAVGTGLNTKVGF 270

Query: 247 AERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGP 306
           AE IAEQVSKETGI+FKTAPNKFEALAAHDA+VE+SGALNT+A SLFKIA DIRYLGSGP
Sbjct: 271 AEDIAEQVSKETGIDFKTAPNKFEALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGP 330

Query: 307 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 366
           RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN+AAITFAGASGQFELNVFK
Sbjct: 331 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVFK 390

Query: 367 PVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSAT 426
           PVMISNLLSSIRLLGDA +SF IHCVEGI+ANED+I KLLHESLMLVTALNPKIGYD+A+
Sbjct: 391 PVMISNLLSSIRLLGDASNSFRIHCVEGIKANEDRIAKLLHESLMLVTALNPKIGYDAAS 450

Query: 427 KVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466
           KVAKNAHKKGITLKESALEL VL+ +EFD+WV+PEKM+GP
Sbjct: 451 KVAKNAHKKGITLKESALELKVLSSEEFDQWVIPEKMIGP 490

>TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13
           YPL262W
          Length = 496

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/461 (84%), Positives = 428/461 (92%)

Query: 6   GFRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNE 65
           GFR+ETDGFGEIKVPA+KYWGAQT+RS+ENF+IGGPRERMP+PVVKAFGVLKKSAAIVNE
Sbjct: 35  GFRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKKSAAIVNE 94

Query: 66  EFGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGG 125
            +G LD  ISK+IQ+AADEVI+GKLN+HFPLVVFQTGSGTQSNMNANEVISNRAIEL GG
Sbjct: 95  GYGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGG 154

Query: 126 IMGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHI 185
            +GSK++HPNNH N AQSSND+FPTVMHIAAVTEIT HLIP++  L+DAL +KSK+F HI
Sbjct: 155 TLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHI 214

Query: 186 VKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIG 245
           VKIGRTHLQDATPLTLGQEFSGYVQQL NGI RIEHSLINLKFLAQGGTAVGTGLNT+IG
Sbjct: 215 VKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIG 274

Query: 246 FAERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSG 305
           FAE+IAEQ+SKETG+ FKTAPNKFEALAAHDAIVE+SGA+ TVA SLFKIAQDIRYLGSG
Sbjct: 275 FAEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSG 334

Query: 306 PRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVF 365
           PRCGYGELSLPENEPGSSIMPGK+NPTQNEA+TQVC Q++GNN  I FAG  GQFELNVF
Sbjct: 335 PRCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQGQFELNVF 394

Query: 366 KPVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSA 425
           KPVMISNLLSSIRLLGD   SF IHCVEGI+ANE++I  L+++SLMLVTALNPKIGYD A
Sbjct: 395 KPVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNPKIGYDEA 454

Query: 426 TKVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466
           TKVAKNAHKKGITLKESA++LG LTE EFDEWVVPEKM+GP
Sbjct: 455 TKVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGP 495

>Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to
           Ashbya gossypii ACR013C
          Length = 489

 Score =  821 bits (2121), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/461 (84%), Positives = 425/461 (92%)

Query: 7   FRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEE 66
           FR+ETD FGEIKVPA+KYWGAQTQRS ENFKIGGPRERMPEP++KAFG+LKKSAAIVNE 
Sbjct: 28  FRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPEPIIKAFGILKKSAAIVNES 87

Query: 67  FGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGI 126
            G LD  ISK IQQAADEVIEGKL +HFPLVVFQTGSGTQSNMNANEVISNRAIEL GG 
Sbjct: 88  LGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 147

Query: 127 MGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIV 186
           +G+K+IHPNNHCN AQSSNDTFP+VMHIAAVTEIT+ L+P++T L+D+   K++EF HIV
Sbjct: 148 LGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALRDSFQKKTEEFSHIV 207

Query: 187 KIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGF 246
           KIGRTHLQDATPLTLGQEF GY QQ+ NGI R+E SL +LKFLAQGGTAVGTGLNTK+GF
Sbjct: 208 KIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQGGTAVGTGLNTKVGF 267

Query: 247 AERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGP 306
           AE+IAEQVSKET IEFKTAPNKFEALAAHDA+VE SGALNTVACSLFKIA DIRYLGSGP
Sbjct: 268 AEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVACSLFKIANDIRYLGSGP 327

Query: 307 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 366
           RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ CVQVMGNN+ ITFAGASGQFELNVFK
Sbjct: 328 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNSTITFAGASGQFELNVFK 387

Query: 367 PVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSAT 426
           PVMISNLL+SIRLL DA +SF +HCV+GI+ANEDKI K+LHESLMLVTALNPKIGYDSA 
Sbjct: 388 PVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILHESLMLVTALNPKIGYDSAC 447

Query: 427 KVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGPS 467
           KVAKNAHKK ITLKESALELGVL+E+EF EWVVPEKM+GP+
Sbjct: 448 KVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGPT 488

>TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {ON}
           Anc_6.13 YPL262W
          Length = 484

 Score =  817 bits (2111), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/460 (83%), Positives = 425/460 (92%)

Query: 7   FRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEE 66
           FR+ETD FGEIKV AD+YWGAQTQRS ENF+IGGPRERMPEP+V+AFGVLKKSAA+VNE 
Sbjct: 23  FRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVLKKSAAVVNES 82

Query: 67  FGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGI 126
            G LD  +++ I+QAADEV +GKL  HFPLVVFQTGSGTQSNMNANEVISNRAIEL GG 
Sbjct: 83  LGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 142

Query: 127 MGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIV 186
           +GSK+IHPNNHCN AQSSNDTFP+VMHIAAVTEIT HL+P++  L+D+L  KSKEF  IV
Sbjct: 143 LGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAKSKEFSDIV 202

Query: 187 KIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGF 246
           KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+E SL  LK+LAQGGTAVGTGLNTKIGF
Sbjct: 203 KIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGTGLNTKIGF 262

Query: 247 AERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGP 306
           AE+IAEQVSKETG++FKTAPNKFEALAAHDA+VE+SGALNTVACSLFKIAQDIRYLGSGP
Sbjct: 263 AEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSGP 322

Query: 307 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 366
           RCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAAITFAGASGQFELNVFK
Sbjct: 323 RCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGASGQFELNVFK 382

Query: 367 PVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSAT 426
           PVMISNLLSS+RLL DA +SF +HCV+GI AN D+I KL+HESLMLVTALNPKIGYD+A+
Sbjct: 383 PVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALNPKIGYDAAS 442

Query: 427 KVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466
           KVAKNAHKKGITLK+SAL+LGVLTE EFDEWVVPE M+GP
Sbjct: 443 KVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGP 482

>CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262w FUM1 fumarate hydratase
          Length = 483

 Score =  811 bits (2095), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/461 (83%), Positives = 429/461 (93%)

Query: 7   FRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEE 66
           +R+ETD FGEIKVPADKYWGAQTQRS++NFKIGG RERMPEP+V+AFGVLKKSAAIVNE+
Sbjct: 22  YRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERMPEPIVRAFGVLKKSAAIVNEK 81

Query: 67  FGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGI 126
            G LD+ I+  IQQAADEV +GKLN+HFPLVVFQTGSGTQSNMNANEVISNRAIEL GG 
Sbjct: 82  LGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 141

Query: 127 MGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIV 186
           +GSK+IHPNNHCN AQSSNDTFP+VMHIAAVTEIT+ L+P++T+LKDAL  K++EF+ IV
Sbjct: 142 LGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAEEFQDIV 201

Query: 187 KIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGF 246
           KIGRTHLQDATPLTLGQEFSGYVQQL+NGIARIE++L +LK+LAQGGTAVGTGLNTK GF
Sbjct: 202 KIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGLNTKEGF 261

Query: 247 AERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGP 306
            + IAEQ+SKETGI+FKTAPNKFEALAAHDAIVE+SGALNTVACSLFKIAQDIRYLGSGP
Sbjct: 262 DKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGP 321

Query: 307 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 366
           RCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA+TFAGA+GQFELNVFK
Sbjct: 322 RCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGANGQFELNVFK 381

Query: 367 PVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSAT 426
           PVMISNLLSSIRLL DACHSF +HCVEGI+AN +KIN  LH SLMLVTALNPKIGYD+A+
Sbjct: 382 PVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHNLHNSLMLVTALNPKIGYDAAS 441

Query: 427 KVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGPS 467
           K+AKNA KK ITLKESALEL  LT +EFDEWV+PE M+GP+
Sbjct: 442 KIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVGPT 482

>ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL262W
           (FUM1)
          Length = 488

 Score =  810 bits (2091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/463 (81%), Positives = 422/463 (91%)

Query: 4   PNGFRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIV 63
           P  FR+ETD FGEI+VPADKYWGAQTQRS ENF+IGG RERMPEPVV+AFGVLKKSAA+V
Sbjct: 24  PQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFGVLKKSAAVV 83

Query: 64  NEEFGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELK 123
           NE+ G L+ GI+K IQQAADEV +G+L EHFPLVVFQTGSGTQSNMNANEVISNRAIEL 
Sbjct: 84  NEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELL 143

Query: 124 GGIMGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFE 183
           GG +GSK++HPNNHCN AQSSNDTFP+VMHIAAVTEIT  L+P++  L+ +   K+ EF 
Sbjct: 144 GGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRKTDEFA 203

Query: 184 HIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTK 243
           HIVKIGRTHLQDATPLTLGQEFSGY QQ+ NGIAR+EH+  +L+FLAQGGTAVGTGLNT+
Sbjct: 204 HIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTR 263

Query: 244 IGFAERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLG 303
            GFAE+IA QVS+ETG+EF+TAPNKFEALAAHDA+VE+SGALNT+ACSLFKIA DIRYLG
Sbjct: 264 RGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLG 323

Query: 304 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELN 363
           SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQ CVQVMGNNAAITFAGASGQFELN
Sbjct: 324 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFAGASGQFELN 383

Query: 364 VFKPVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYD 423
           VFKPVMI+NLLSS+RLL DA  SF +HCV+GIQ NED+I KLLHESLMLVTALNPKIGYD
Sbjct: 384 VFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVTALNPKIGYD 443

Query: 424 SATKVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466
           +A+ VAKNAHKKGITL+ SALELGVLT+ EFDEWVVPEKM+GP
Sbjct: 444 AASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGP 486

>Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  786 bits (2030), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/460 (81%), Positives = 416/460 (90%)

Query: 7   FRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEE 66
           FR+ETD FGEI VPADKYWGAQTQRS++NFKIGG RERMP P+V AFGVLKKSAA+VNE 
Sbjct: 28  FRIETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAVVNES 87

Query: 67  FGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGI 126
            G LD  ISK IQQAADEV  GKL++HFPLVVFQTGSGTQSNMNANEVISNRAIE+ GG 
Sbjct: 88  LGGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGK 147

Query: 127 MGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIV 186
           +GSKE+HPNNHCN +QSSNDTFPTVMHIAA  +I + LIP++T LK+AL  KSKEFEHIV
Sbjct: 148 IGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFEHIV 207

Query: 187 KIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGF 246
           KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+ HSL  L FLAQGGTAVGTGLNTK GF
Sbjct: 208 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGF 267

Query: 247 AERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGP 306
             +IAEQ+S ETG++F+TAPNKFEALAAHDAIVE SGALNT+ACSLFKIAQDIRYLGSGP
Sbjct: 268 DIKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGP 327

Query: 307 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 366
           RCGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAAITFAG+ GQFELNVFK
Sbjct: 328 RCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFK 387

Query: 367 PVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSAT 426
           PVMI+NLL+SIRL+ D+ +SF +HCVEGI+ANE +I++LL +SLMLVTALNPKIGYD+A+
Sbjct: 388 PVMIANLLNSIRLITDSAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAAS 447

Query: 427 KVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466
           KVAKNAHKKGITLKESALELGVLTE EFDEWVVPE MLGP
Sbjct: 448 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGP 487

>YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumarase,
           converts fumaric acid to L-malic acid in the TCA cycle;
           cytosolic and mitochondrial distribution determined by
           the N-terminal targeting sequence, protein conformation,
           and status of glyoxylate shunt; phosphorylated in
           mitochondria
          Length = 488

 Score =  785 bits (2028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/460 (82%), Positives = 416/460 (90%)

Query: 7   FRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEE 66
           FR ETD FGEI VPADKYWGAQTQRS++NFKIGG RERMP P+V AFGVLKKSAAIVNE 
Sbjct: 28  FRTETDAFGEIHVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNES 87

Query: 67  FGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGI 126
            G LD  ISK IQQAADEV  GKL++HFPLVVFQTGSGTQSNMNANEVISNRAIE+ GG 
Sbjct: 88  LGGLDPKISKAIQQAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGK 147

Query: 127 MGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIV 186
           +GSK++HPNNHCN +QSSNDTFPTVMHIAA  +I + LIP++T LK+AL  KSKEF+HIV
Sbjct: 148 IGSKQVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFDHIV 207

Query: 187 KIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGF 246
           KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+ HSL  L FLAQGGTAVGTGLNTK GF
Sbjct: 208 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGF 267

Query: 247 AERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGP 306
             +IAEQ+SKETG++F+TAPNKFEALAAHDAIVE SGALNT+ACSLFKIAQDIRYLGSGP
Sbjct: 268 DVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGP 327

Query: 307 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 366
           RCGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAAITFAG+ GQFELNVFK
Sbjct: 328 RCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFK 387

Query: 367 PVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSAT 426
           PVMI+NLL+SIRL+ DA +SF +HCVEGI+ANE +I++LL +SLMLVTALNPKIGYD+A+
Sbjct: 388 PVMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAAS 447

Query: 427 KVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466
           KVAKNAHKKGITLKESALELGVLTE EFDEWVVPE MLGP
Sbjct: 448 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEHMLGP 487

>Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON}
           YPL262W (REAL)
          Length = 488

 Score =  784 bits (2025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/460 (81%), Positives = 415/460 (90%)

Query: 7   FRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEE 66
           FR ETD FGEI VPADKYWGAQTQRS++NFKIGG RERMP P+V AFGVLKKSAAIVNE 
Sbjct: 28  FRTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNES 87

Query: 67  FGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGI 126
            G LD  ISK IQ+AADEV  GKL++HFPLVVFQTGSGTQSNMNANEVISNRAIE+ GG 
Sbjct: 88  LGGLDPKISKAIQEAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGK 147

Query: 127 MGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIV 186
           +GSKE+HPNNHCN +QSSNDTFPTVMHIAA  +I + LIP++  LK+AL  KSKEF+HIV
Sbjct: 148 IGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELANLKNALEAKSKEFDHIV 207

Query: 187 KIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGF 246
           KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+ HSL  L FLAQGGTAVGTGLNTK GF
Sbjct: 208 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGF 267

Query: 247 AERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGP 306
             +IAEQ+SKETG++F+TAPNKFEALAAHDAIVE SGALNT+ACSLFKIAQDIRYLGSGP
Sbjct: 268 DVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGP 327

Query: 307 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 366
           RCGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAAITFAG+ GQFELNVFK
Sbjct: 328 RCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFK 387

Query: 367 PVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSAT 426
           PVMI+NLL+SIRL+ DA +SF +HCVEGI+ANE +I++LL +SLMLVTALNPKIGYD+A+
Sbjct: 388 PVMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAAS 447

Query: 427 KVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466
           KVAKNAHKKGITLKESALELGVLTE EFDEWVVPE MLGP
Sbjct: 448 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGP 487

>Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  781 bits (2018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/460 (81%), Positives = 412/460 (89%)

Query: 7   FRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEE 66
           FR ETD FGEI VPADKYWGAQTQRS++NFKIGG RERMP P+V AFGVLKKSAAIVNE 
Sbjct: 28  FRTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNES 87

Query: 67  FGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGI 126
            G LD  +SK IQQAADEV  GKL++HFPLVVFQTGSGTQSNMNANEVISNRAIE+ GG 
Sbjct: 88  LGGLDPKVSKAIQQAADEVAAGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGK 147

Query: 127 MGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIV 186
           +GSK++HPNN CN +QSSNDTFPTVMHIAA  +I   LIP++T LK+AL  KSKEFEHIV
Sbjct: 148 IGSKQVHPNNDCNQSQSSNDTFPTVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIV 207

Query: 187 KIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGF 246
           KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+ H+L  L FLAQGGTAVGTGLNTK GF
Sbjct: 208 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGF 267

Query: 247 AERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGP 306
             +IAEQ+SKETG++F+TAPNKFEALAAHDAIVE SGALNT+ACSLFKIAQDIRYLGSGP
Sbjct: 268 DVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGP 327

Query: 307 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 366
           RCGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAAITF G+ GQFELNVFK
Sbjct: 328 RCGYNELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFGGSQGQFELNVFK 387

Query: 367 PVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSAT 426
           PVMI+NLL+SIRL+ DA  SF IHCVEGI+ANE +I++LL +SLMLVTALNPKIGYD+A+
Sbjct: 388 PVMIANLLNSIRLIADASRSFRIHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAAS 447

Query: 427 KVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466
           KVAKNAHKKGITLKESALELGVLTE EFDEWVVPE MLGP
Sbjct: 448 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGP 487

>NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {ON}
           Anc_6.13 YPL262W
          Length = 493

 Score =  771 bits (1991), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/460 (79%), Positives = 415/460 (90%)

Query: 7   FRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEE 66
           +R+ETD FGEIKVPADKYWGAQTQRS++NFKIGG RER+P+P++ AFG+LKKSAAIVNE 
Sbjct: 32  YRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERIPDPIITAFGILKKSAAIVNES 91

Query: 67  FGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGI 126
            G LD  ++  I++AADEV++GKL +HFPLVVFQTGSGTQ+NMN NEVISNRAIEL GG 
Sbjct: 92  LGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTNMNVNEVISNRAIELVGGK 151

Query: 127 MGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIV 186
           +GSK+IHPNNHCN +QSSNDTFP+VMHIAAV EIT+ LIP++T+LKDAL  K+KEF  IV
Sbjct: 152 LGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDVKAKEFADIV 211

Query: 187 KIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGF 246
           KIGRTHLQDATPLTLGQEFSGYVQQL NGI RIE SL +LKFLAQGGTAVGTGLNTKIGF
Sbjct: 212 KIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVGTGLNTKIGF 271

Query: 247 AERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGP 306
            + IAE+VSKETGIEFKTAPNKFEALAAHDAIV +SGALNTVA SLFKIAQDIRYLGSGP
Sbjct: 272 DKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQDIRYLGSGP 331

Query: 307 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 366
           RCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQVCVQ+MGNN  I+ AG+ GQFELNV+K
Sbjct: 332 RCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNNQTISIAGSQGQFELNVYK 391

Query: 367 PVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSAT 426
           P+MI+NLL+SIRL+ DAC SF IHC++ ++AN+DKIN+ L++SLMLVTALNPKIGYD+A+
Sbjct: 392 PLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNKSLMLVTALNPKIGYDAAS 451

Query: 427 KVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466
           K+AKNAH K ITLKESALEL  LT +EFDEWVVPE M+GP
Sbjct: 452 KIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIGP 491

>ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 505

 Score =  766 bits (1979), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/459 (79%), Positives = 408/459 (88%)

Query: 8   RLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEEF 67
           R+ETD FGEIKVPADKYWGAQTQRS+ENF+IGG RERMPE VV AFG+LKK+ A VNE  
Sbjct: 45  RVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEAN 104

Query: 68  GILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGIM 127
           G LD  ++  I+QAADEV  GKL +HFPLVVFQTGSGTQSNMNANEVISNRAIEL GG +
Sbjct: 105 GQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKL 164

Query: 128 GSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIVK 187
           GSK +HPNNH NM+QSSNDTFPTVMHIAAV  IT  L+P +T LKD+L  KS+EF  IVK
Sbjct: 165 GSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVK 224

Query: 188 IGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGFA 247
           IGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+E +L +LK LAQGGTAVGTGLNTKIG+A
Sbjct: 225 IGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWA 284

Query: 248 ERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGPR 307
           E +A +V+KETGI+F+TAPNKFEALAAHDA+VE+SGALNT+A SLFKIAQDIRYLGSGPR
Sbjct: 285 ENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPR 344

Query: 308 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKP 367
           CGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVCVQV GN++AITFAGASGQFELNVFKP
Sbjct: 345 CGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKP 404

Query: 368 VMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSATK 427
           VMISNLLSSI LL DA +SF +HCV+GIQAN + I KLLHESLMLVTALNPKIGYD+A+K
Sbjct: 405 VMISNLLSSINLLSDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASK 464

Query: 428 VAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466
           VAKNAHK GITLKESAL+L +LT +EFD WVVPE M+GP
Sbjct: 465 VAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGP 503

>KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.13
           YPL262W
          Length = 498

 Score =  762 bits (1967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/460 (78%), Positives = 409/460 (88%)

Query: 7   FRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEE 66
           FR+ETD FGEI VPAD+YWGAQTQRS++NFKIGG RE++PEPVV+AFG+LKKSAA VNE 
Sbjct: 37  FRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIPEPVVRAFGILKKSAATVNEN 96

Query: 67  FGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGI 126
            G LD  I+  I+ AADEV EGKL++HFPLVVFQTGSGTQSNMNANEVISNRAIEL GG 
Sbjct: 97  LGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGE 156

Query: 127 MGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIV 186
           +GSK++HPNNH N +QSSNDTFPTVMHIAA TEI + LIP++  LKDAL +K +EF  IV
Sbjct: 157 LGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDALQHKVEEFSSIV 216

Query: 187 KIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGF 246
           KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R++ SL +L FLAQGGTAVGTGLNTK+GF
Sbjct: 217 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGTAVGTGLNTKVGF 276

Query: 247 AERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGP 306
            + +AE+VSKETG+ F+TAPNKFEALAAHDAIVE+SGALNT+ACSLFKIAQDIRYLGSGP
Sbjct: 277 DKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALNTLACSLFKIAQDIRYLGSGP 336

Query: 307 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 366
           RCGYGEL LP NEPGSSIMPGKVNPTQNEAMTQVCVQVMGNN+ ITFAG+ GQFELNV+K
Sbjct: 337 RCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNSTITFAGSQGQFELNVYK 396

Query: 367 PVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSAT 426
           P+MISNLLSSIRLL DA  SF IHC+  ++AN+DKI++ L++SLMLVTALNPKIGYD+A 
Sbjct: 397 PLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENLNKSLMLVTALNPKIGYDAAA 456

Query: 427 KVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466
           KVAKNAH K ITLKESALELGVLTE EFDEWV+PE M+ P
Sbjct: 457 KVAKNAHHKNITLKESALELGVLTEKEFDEWVIPENMISP 496

>KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6.13
           YPL262W
          Length = 495

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/465 (76%), Positives = 410/465 (88%)

Query: 2   SFPNGFRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAA 61
           S  + FR ETD FGEI VP DKYWGAQTQRS +NFKIGG RE++P P+++AFG+LKKSAA
Sbjct: 29  SIKSSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPIIEAFGILKKSAA 88

Query: 62  IVNEEFGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIE 121
           IVNE  G LD+ ++K I  AADEV +GKLN+HFPLVVFQTGSGTQSNMNANEVISNRAIE
Sbjct: 89  IVNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIE 148

Query: 122 LKGGIMGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKE 181
           L GG +GSK +HPNNH N +QSSNDTFPTVMHIAA+ EIT  L+P++  LK++L  KS E
Sbjct: 149 LMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKKSNE 208

Query: 182 FEHIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLN 241
           F  IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RIE +L +LKFLAQGGTAVGTGLN
Sbjct: 209 FNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGTGLN 268

Query: 242 TKIGFAERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRY 301
           TK GF + IAEQ+S+ETGI F+TAPNKFEALAAHDAIVE SGALNT+ACSLFKIAQDIRY
Sbjct: 269 TKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQDIRY 328

Query: 302 LGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFE 361
           LGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVC+QVMGN++ ITFAG+ GQFE
Sbjct: 329 LGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHSTITFAGSQGQFE 388

Query: 362 LNVFKPVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIG 421
           LNV+KP++ISNLLSSIRLL DA +SF +HC++G++AN + I + L++SLMLVTALNP IG
Sbjct: 389 LNVYKPLLISNLLSSIRLLTDASYSFRVHCIDGLKANRENITENLNKSLMLVTALNPYIG 448

Query: 422 YDSATKVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466
           YD+A+K+AKNAH K ITLKESALELG+LTE++F EWV+PEKM+GP
Sbjct: 449 YDNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGP 493

>TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.13
           YPL262W
          Length = 465

 Score =  741 bits (1912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/460 (75%), Positives = 406/460 (88%)

Query: 8   RLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEEF 67
           R+E DGFGE++VPA+KYWGAQTQR+  NF IGG RERMPEP++ A+G+LKKS AIVNE  
Sbjct: 5   RIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESL 64

Query: 68  GILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGIM 127
           G LD  ISK IQ+AADEV +G LNEHFPLVVFQTGSGTQ+NMN NEVISNRAIE+ GG +
Sbjct: 65  GTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQL 124

Query: 128 GSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIVK 187
           GSK +HPNNH N +QS+ND+FPT MHI+AV E+   L+P++ +L+DAL +KS EF  IVK
Sbjct: 125 GSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVK 184

Query: 188 IGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGFA 247
           IGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+++SL NLKF+AQGGTAVGTG+NTK  F 
Sbjct: 185 IGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFD 244

Query: 248 ERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGPR 307
             +A+Q+S ETGIEFKTAPNKFEALA+HDAIVE SGALNT+ACSLFKI+QDIR+LGSGPR
Sbjct: 245 ILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPR 304

Query: 308 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKP 367
           CGYGELSLPENEPGSSIMPGKVNPTQNEAM Q C+QVMGNN+AITFAGASGQFELN +KP
Sbjct: 305 CGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKP 364

Query: 368 VMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSATK 427
           +MISNLL+SIRLL D+C+SF IHC+ GI+ANEDKINKLL+ESLMLVTALNPKIGYD+AT 
Sbjct: 365 LMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATA 424

Query: 428 VAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGPS 467
           +AK+AHK G+TLKE+AL+  +LT ++FDEW+VPE M+ PS
Sbjct: 425 IAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHPS 464

>NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {ON}
           Anc_6.13 YPL262W
          Length = 475

 Score =  735 bits (1898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/460 (76%), Positives = 415/460 (90%)

Query: 7   FRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEE 66
           FR+ETD FGEIKVP++KYWGAQTQRS++NFKIGG RE++P P++KAFG+LKKSAAIVN+ 
Sbjct: 14  FRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIVNQS 73

Query: 67  FGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGI 126
            G LD  I+  I +A+DEVI+GKLN+HFPLVVFQTGSGTQ+NMNANEVISNRA EL G  
Sbjct: 74  LGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIGAE 133

Query: 127 MGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIV 186
           +GSK+IHPNNH N +QSSNDTFP+VMHIAAV E+ ++LIP++TELK++L NK+KE+ +IV
Sbjct: 134 LGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYANIV 193

Query: 187 KIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGF 246
           KIGRTHLQDATPLTLGQEFSGYVQQL NGI RI+ SL +LKFLAQGGTAVGTGLNTK+GF
Sbjct: 194 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKVGF 253

Query: 247 AERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGP 306
            + IA++VSKETGI+F+TAPNKFEALAAHDAIV +S A+ TVA SLFKIAQDIRYLGSGP
Sbjct: 254 DKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGP 313

Query: 307 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 366
           RCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQV +Q+MGNN  I  AG+ GQFELNV+K
Sbjct: 314 RCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELNVYK 373

Query: 367 PVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSAT 426
           P+MI+NLL+SIRL+ DACHSF IHCV+G++AN DKIN+ LH+SLMLVTALNPKIGYD+A+
Sbjct: 374 PLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYDAAS 433

Query: 427 KVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466
           K+AKNAH K ITLKESALELG+LTE+EFD+WV+PE M+GP
Sbjct: 434 KLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGP 473

>TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6.13
           YPL262W
          Length = 500

 Score =  734 bits (1894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/462 (74%), Positives = 397/462 (85%)

Query: 6   GFRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNE 65
           G R ETD FGEI+VPA+KYWGAQTQRS+ NFKIGG RERMPEP+++AFG  KK+AAIVN 
Sbjct: 39  GTRTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAAIVNN 98

Query: 66  EFGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGG 125
             G LD  +   I QAA+EV +G LNEHFPLVVFQTGSGTQSNMNANEVISNRAIEL GG
Sbjct: 99  SLGTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGG 158

Query: 126 IMGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHI 185
            +GSK++HPNNH N +QSSNDTFPTVMHIAA+TEIT+ L+P +  L++ L +K+KEFE I
Sbjct: 159 TLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEFEKI 218

Query: 186 VKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIG 245
           +KIGRTHLQDATPLTLGQEFSGY QQL N I RIE +L  L+++AQGGTAVGTGLNTKIG
Sbjct: 219 IKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNTKIG 278

Query: 246 FAERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSG 305
           FAE+ A Q+S +T + F T+PNKFE+LAAHDAIV    +LNT+ACSLFKI+QDIRYL SG
Sbjct: 279 FAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASG 338

Query: 306 PRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVF 365
           PRCGYGELS+PENEPGSSIMPGKVNPTQNEAM Q CVQVMGNN+ I+FAGASGQFELN +
Sbjct: 339 PRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTY 398

Query: 366 KPVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSA 425
           KP+MI+NLLSS RLL DA  SF +HC  GIQAN+DKI++LLHESLMLVT+LNPKIGYD+A
Sbjct: 399 KPLMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDAA 458

Query: 426 TKVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGPS 467
           +KVAKNAH KGITLK+SALEL +L+  +FDEWV PE MLGP+
Sbjct: 459 SKVAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGPN 500

>AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR018C (ARG4)
          Length = 469

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 95/234 (40%), Gaps = 18/234 (7%)

Query: 124 GGIMGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFE 183
           G I+G    H +   +  +S ND   T M +     +   + P + EL   L ++++E  
Sbjct: 97  GEIIGR---HISGKVHTGRSRNDQVATDMRLYCREMLQDKVEPALFELIKVLLHRAREEI 153

Query: 184 HIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVG---TGL 240
            ++  G THLQ A P+      S Y    +    R++  +  L     G  A+     G+
Sbjct: 154 DVLMPGYTHLQRAQPIRWSHWLSCYATYFVEDFKRLKEVIARLNQSPLGAGALAGHPYGI 213

Query: 241 NTKIGFAERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIR 300
           +          E ++ E G +     N   A++  D +VE     +     + ++A+D+ 
Sbjct: 214 DR---------EYLACELGFD-GVIGNSMTAVSDRDFVVEIMSWGSLFMNHISRLAEDL- 262

Query: 301 YLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFA 354
            + S    G+ +L+      GSS+MP K NP   E +     +V G  A    +
Sbjct: 263 IIYSTAEFGFVKLA-DAYSTGSSLMPQKRNPDSLELLRGKSGRVFGQLAGFLMS 315

>TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 97/210 (46%), Gaps = 27/210 (12%)

Query: 164 LIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSL 223
           +IPK+  + + LAN + E++ +  +G TH Q A   TLG+  + ++Q+L+  +   E + 
Sbjct: 128 VIPKLVNVINRLANFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 224 INLKFLAQGGT--------AVGTGLNTKI-GFAERIAEQVSKET--GIEFKTAPNKFEAL 272
            ++      GT        A+  G + K+    ER+ E +  +T   +  +T   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEELDERVVELLGFDTVYPVTGQTYSRKID-- 245

Query: 273 AAHDAIVESSGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPT 332
                 ++    L + A +  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVVSPLVSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPM 296

Query: 333 QNEAMTQVC--VQVMGNNAAITFAGASGQF 360
           + E   +VC   + +G+  + T   AS Q+
Sbjct: 297 RCE---RVCSLARHLGSLLSDTVQTASVQW 323

>CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359w ADE13
          Length = 482

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 86/186 (46%), Gaps = 19/186 (10%)

Query: 164 LIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSL 223
           +IPK+  + + LA  + E++ +  +G TH Q A   TLG+  + ++Q+L+  +   E + 
Sbjct: 128 VIPKLVNVINRLAKFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 224 INLKFLAQGGT--------AVGTGLNTKIGFAERIAEQVSKETGIEFKTAPNKFEALAAH 275
            ++      GT        A+  G + K+   E + E+V++  G  F T         + 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EELDERVTELLG--FDTVYPVTGQTYSR 242

Query: 276 DAIVESSGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 335
              ++    L++ A S  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 336 AMTQVC 341
              +VC
Sbjct: 300 ---RVC 302

>Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 88/186 (47%), Gaps = 19/186 (10%)

Query: 164 LIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSL 223
           +IPK+  + + LA  + E++ +  +G TH Q A   TLG+  + ++Q+L+  +   E + 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFERAR 187

Query: 224 INLKFLAQGGT--------AVGTGLNTKIGFAERIAEQVSKETGIEFKTAPNKFEALAAH 275
            ++      GT        A+  G + K+   E + E+V++  G + K  P   +   + 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDERVTELLGFD-KVYPVTGQTY-SR 242

Query: 276 DAIVESSGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 335
              ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 336 AMTQVC 341
              +VC
Sbjct: 300 ---RVC 302

>YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}
           ADE13Adenylosuccinate lyase, catalyzes two steps in the
           'de novo' purine nucleotide biosynthetic pathway;
           expression is repressed by adenine and activated by
           Bas1p and Pho2p; mutations in human ortholog ADSL cause
           adenylosuccinase deficiency
          Length = 482

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 88/186 (47%), Gaps = 19/186 (10%)

Query: 164 LIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSL 223
           +IPK+  + + LA  + E++ +  +G TH Q A   TLG+  + ++Q+L+  +   E + 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 224 INLKFLAQGGT--------AVGTGLNTKIGFAERIAEQVSKETGIEFKTAPNKFEALAAH 275
            ++      GT        A+  G + K+   E + E+V++  G + K  P   +   + 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDERVTELLGFD-KVYPVTGQTY-SR 242

Query: 276 DAIVESSGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 335
              ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 336 AMTQVC 341
              +VC
Sbjct: 300 ---RVC 302

>Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 87/186 (46%), Gaps = 19/186 (10%)

Query: 164 LIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSL 223
           +IPK+  + + LA  + E++ +  +G TH Q A   TLG+  + ++Q+L+  +   E + 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 224 INLKFLAQGGT--------AVGTGLNTKIGFAERIAEQVSKETGIEFKTAPNKFEALAAH 275
            ++      GT        A+  G + K+   E + E+V++  G + K  P   +   + 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDERVTELLGFD-KVYPVTGQTY-SR 242

Query: 276 DAIVESSGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 335
              ++    L++ A +  K+A DIR L +       E    + + GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPMRCE 299

Query: 336 AMTQVC 341
              +VC
Sbjct: 300 ---RVC 302

>NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa]
           {ON} Anc_1.354 YHR018C
          Length = 462

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 51/207 (24%), Positives = 81/207 (39%), Gaps = 11/207 (5%)

Query: 142 QSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTL 201
           +S ND   T + I     +   L P +T L   L  + +E   I+  G THLQ A P+  
Sbjct: 112 RSRNDQCVTDLRIYCRDVLNEKLFPALTSLIQVLIKRGEEEIDILMPGYTHLQRAQPIRW 171

Query: 202 GQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGFAERIAEQVSKETGIE 261
               S Y       + R++  L+       G  A+        G    I  +   E G+E
Sbjct: 172 SHWLSSYATYFTEDLNRLKQILVRFNKSPLGAGALA-------GHPYGIDREFLAE-GLE 223

Query: 262 FK-TAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEP 320
           F     N   A++  D +VE           + + A+D+  + S    G+ +L+      
Sbjct: 224 FNGVIGNSLVAVSDRDFVVELMFWSTLFMNHISRFAEDL-IIYSTAEFGFIKLN-DAYST 281

Query: 321 GSSIMPGKVNPTQNEAMTQVCVQVMGN 347
           GSS+MP K N    E +     +V G+
Sbjct: 282 GSSLMPQKKNADSLELLRGKSGRVFGD 308

>CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018c ARLY
          Length = 461

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 81/208 (38%), Gaps = 15/208 (7%)

Query: 142 QSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTL 201
           +S ND   T M I     +   + P M  L + L N++++   I+  G THLQ A P+  
Sbjct: 113 RSRNDQVVTDMRIYCREILNEKIFPAMKSLINVLVNRAEKEIDILMPGYTHLQRAQPIRW 172

Query: 202 GQEFSGYVQQLINGIARIEH--SLINLKFLAQGGTAVGTGLNTKIGFAERIAEQVSKETG 259
               S Y       + R+E     +N   L  G  A         G    I  Q   E G
Sbjct: 173 AHWLSSYATYFTEDLKRLEQIAERLNKSPLGSGALA---------GHPYGIDRQFLAE-G 222

Query: 260 IEFK-TAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPEN 318
           + F     N   A++  D +VE           + + ++D+  + S    G+ +LS    
Sbjct: 223 LGFNGVIGNSLVAVSDRDFVVELMFWATLFMNHVSRFSEDL-IIYSTAEFGFIKLS-DAY 280

Query: 319 EPGSSIMPGKVNPTQNEAMTQVCVQVMG 346
             GSS+MP K N    E +     +V G
Sbjct: 281 STGSSLMPQKKNADSLELLRGKSGRVFG 308

>NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON}
           Anc_1.354 YHR018C
          Length = 462

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 82/212 (38%), Gaps = 11/212 (5%)

Query: 141 AQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLT 200
            +S ND   T + I     +   L P MT L + L  +++E   I+  G THLQ A P+ 
Sbjct: 111 GRSRNDQCVTDLRIYCRDVLNEKLFPGMTSLIEVLIKRAEEEIDILMPGYTHLQRAQPIR 170

Query: 201 LGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGFAERIAEQVSKETGI 260
                S Y       + R++  L        G  A+        G    I  +   E G+
Sbjct: 171 WSHWLSSYATYFTEDLKRLKQILERFNKSPLGAGALA-------GHPYGIDREFLAE-GL 222

Query: 261 EFK-TAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENE 319
            F     N   A++  D +VE           + + A+D+  + S    G+ +LS     
Sbjct: 223 GFDGVIGNSLVAVSDRDFVVELMFWGTLFMNHISRFAEDL-VIYSTAEFGFIKLS-DAYS 280

Query: 320 PGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAI 351
            GSS+MP K N    E +     +V G+ A  
Sbjct: 281 TGSSLMPQKKNADSLELLRGKSGRVFGDLAGF 312

>Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON}
           (40749..42197) [1449 nt, 483 aa]
          Length = 482

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 86/189 (45%), Gaps = 25/189 (13%)

Query: 164 LIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSL 223
           +IPK+  + D LA  + E++ +  +G TH Q A   T+G+  + ++Q+L+  +     + 
Sbjct: 128 IIPKLVNVIDRLAKFASEYKDLPVLGWTHFQPAQLTTMGKRATLWIQELLWDLRNFVRAR 187

Query: 224 INLKFLAQGGT--------AVGTGLNTKI-GFAERIAEQVSKET--GIEFKTAPNKFEAL 272
            ++      GT        A+  G + K+    +R+ E +  +T   +  +T   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDDDKVEALDKRVVELLGFDTVYPVTGQTYSRKID-- 245

Query: 273 AAHDAIVESSGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPT 332
                 ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPM 296

Query: 333 QNEAMTQVC 341
           + E   +VC
Sbjct: 297 RCE---RVC 302

>TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.354
           YHR018C
          Length = 463

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 93/226 (41%), Gaps = 16/226 (7%)

Query: 124 GGIMGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFE 183
           G I+G+K    +   +  +S ND   T + I     ++  L+  +  L + L N+++E  
Sbjct: 97  GEIIGTK---ISGKVHTGRSRNDQCVTDLRIYCREYLSDKLLKNLETLINVLINRAEEEI 153

Query: 184 HIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLK-FLAQGGTAVGTGLNT 242
             +  G THLQ A P+      S Y    +    R    L+ LK  L +     G     
Sbjct: 154 EFIMPGYTHLQRAQPIRWSHWLSSYATYFLEDYKR----LVQLKERLNKSPLGAGALAGH 209

Query: 243 KIGF-AERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRY 301
             G   E +AE++  ++ I      N   A++  D +VE           + + A+D+  
Sbjct: 210 PYGIDREYLAEKLGFDSVI-----GNSLVAVSDRDFVVEILFWSTLFMNHISRFAEDL-I 263

Query: 302 LGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 347
           + S    G+ +LS      GSS+MP K N    E +     +V GN
Sbjct: 264 IYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGN 308

>TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 82/184 (44%), Gaps = 15/184 (8%)

Query: 164 LIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSL 223
           +IPK+  + D L+  + E++ +  +G TH Q A   TLG+  + ++Q+L+  +     + 
Sbjct: 128 IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRSTLWIQELLWDLRNFVRAR 187

Query: 224 INLKFLAQGGTAVGTGLNTKIGF------AERIAEQVSKETGIEFKTAPNKFEALAAHDA 277
            +L      GT  GT  +    F       E + E+V++  G  F T         +   
Sbjct: 188 NDLGLRGVKGTT-GTQASFLALFHGNHDKVEELDERVTELLG--FDTVYPVTGQTYSRKI 244

Query: 278 IVESSGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAM 337
            ++    L + A +  K+A DIR L +       E    +++ GSS M  K NP + E  
Sbjct: 245 DIDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE-- 299

Query: 338 TQVC 341
            +VC
Sbjct: 300 -RVC 302

>Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar to
           Ashbya gossypii ABL006C
          Length = 482

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 91/194 (46%), Gaps = 35/194 (18%)

Query: 164 LIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSL 223
           LIPK+  + + L+  + +++ +  +G TH Q A   TLG+  + ++Q+L+  +     + 
Sbjct: 128 LIPKLVNVINRLSTFAIKYKDLPVLGWTHYQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 224 INLKFLAQGGT--------AVGTGLNTKIGFAERIAEQVSKETGIEF------KTAPNKF 269
            ++ F    GT        A+  G + K+   E + ++V++ +G +       +T   K 
Sbjct: 188 NDIGFRGVKGTTGTQASFLALFHGDHDKV---EALDKRVAELSGFDIIYPVTGQTYSRKV 244

Query: 270 EALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLP--ENEPGSSIMPG 327
           +        ++  G L++ A +  K+A DIR L +       EL  P   ++ GSS M  
Sbjct: 245 D--------IDVLGPLSSFAATSHKLATDIRLLAN-----LKELEEPFEASQIGSSAMAY 291

Query: 328 KVNPTQNEAMTQVC 341
           K NP + E   +VC
Sbjct: 292 KRNPMRCE---RVC 302

>KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.354
           YHR018C
          Length = 462

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 57/230 (24%), Positives = 89/230 (38%), Gaps = 20/230 (8%)

Query: 124 GGIMGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFE 183
           G I+G    H     +  +S ND   T M I     +   L+P M +L   L  +++   
Sbjct: 97  GEIIGR---HIAGKVHTGRSRNDQVVTDMRIYCRDILNEKLLPFMADLIKVLVKRAENEI 153

Query: 184 HIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVG---TGL 240
             +  G THLQ A P+      S Y         R++  L  L     G  A+     G+
Sbjct: 154 DTLMPGYTHLQRAQPIRWAHWLSSYATYFTEDYKRLKQILERLNVSPLGAGALAGHPYGI 213

Query: 241 NTKIGFAERIAEQVSKETGIEF-KTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDI 299
           +      E +AE      G+ F     N   A++  D +VE           + + A+D+
Sbjct: 214 DR-----EFLAE------GLNFGGVIGNSLVAVSDRDFVVELMFWGTLFMNHISRFAEDL 262

Query: 300 RYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA 349
             + S    G+ +LS      GSS+MP K N    E +     +V G+ A
Sbjct: 263 -IIYSTAEFGFVKLS-DSYSTGSSLMPQKKNADSLELLRGKSGRVFGDLA 310

>Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {ON}
           similar to Ashbya gossypii AEL019W
          Length = 470

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 85/209 (40%), Gaps = 17/209 (8%)

Query: 142 QSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTL 201
           +S ND   T M I     +   ++P ++     L N+++E   ++  G THLQ A P+  
Sbjct: 112 RSRNDQVATDMRIYCREILNEKILPAVSSFIRVLINRAREEVDVLMPGYTHLQRAQPIRW 171

Query: 202 GQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVG---TGLNTKIGFAERIAEQVSKET 258
               S Y         R+   +  L     G  A+     G++ K      +AEQ+    
Sbjct: 172 SHWLSCYATYFTEDYNRLRQVVERLNQSPLGAGALAGHPYGIDRKY-----LAEQLGF-N 225

Query: 259 GIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPE- 317
           GI      N   A++  D ++E     +     + + A+D+    +     +G ++L + 
Sbjct: 226 GI----IGNSLVAVSDRDFVIEIMFWGSLFMNHISRFAEDLIIYSTAE---FGFINLADA 278

Query: 318 NEPGSSIMPGKVNPTQNEAMTQVCVQVMG 346
              GSS+MP K NP   E +     +V G
Sbjct: 279 YSTGSSLMPQKKNPDSLELLRGKSGRVFG 307

>KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 461

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 84/212 (39%), Gaps = 17/212 (8%)

Query: 142 QSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTL 201
           +S ND   T M I     +   ++P ++ L   +  +++E   ++  G THLQ A P+  
Sbjct: 111 RSRNDQVATDMRIYCRDILNGTVLPALSSLIKVILQRAEEEIDVLMPGYTHLQRAQPIRW 170

Query: 202 GQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVG---TGLNTKIGFAERIAEQVSKET 258
               S Y         R++  +  L     G  A+     G++ +   A           
Sbjct: 171 AHWLSCYATYFTEDYKRLQQIVERLNVSPLGAGALAGHPYGIDREFLAA----------- 219

Query: 259 GIEFK-TAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPE 317
           G+ F     N   A+A  D +VE     +     + + A+D+  + S    G+ +LS   
Sbjct: 220 GLNFNGVIGNSLTAVADRDFVVEIMFWGSLFMNHISRFAEDL-IIYSTAEFGFIQLS-DA 277

Query: 318 NEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA 349
              GSS+MP K NP   E +     +V G  A
Sbjct: 278 YSTGSSLMPQKKNPDSLELLRGKSGRVFGQLA 309

>Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 87/186 (46%), Gaps = 19/186 (10%)

Query: 164 LIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSL 223
           +IPK+  + + LA  + E++ +  +G TH Q A   TLG+  + ++Q+L+  +   E + 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 224 INLKFLAQGGT--------AVGTGLNTKIGFAERIAEQVSKETGIEFKTAPNKFEALAAH 275
            ++      GT        A+  G + K+   E +  +V++  G + K  P   +   + 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDARVTELLGFD-KVYPVTGQTY-SR 242

Query: 276 DAIVESSGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 335
              ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 336 AMTQVC 341
              +VC
Sbjct: 300 ---RVC 302

>SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 464

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 86/225 (38%), Gaps = 16/225 (7%)

Query: 124 GGIMGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFE 183
           G I+G +EI    H    +S ND   T M I     +   L+P +      L  ++KE  
Sbjct: 98  GEIIG-REISGKVHT--GRSRNDQVATDMRIYCRDILNEVLLPALQAFIKVLTTRAKEEI 154

Query: 184 HIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQG-GTAVGTGLNT 242
            ++  G THLQ A P+      S Y         R++  +  L     G G   G     
Sbjct: 155 DVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYNRLKQIVERLNKSPLGAGALAGHPYGI 214

Query: 243 KIGFAERIAEQVSKETGIEFK-TAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRY 301
              F  R         G+ F+    N   A++  D +VE           + + ++D+  
Sbjct: 215 DREFLAR---------GLGFQGVIGNSLTAVSDRDFVVEIMFWGTLFMNHISRFSEDL-I 264

Query: 302 LGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 346
           + S    G+ +LS      GSS+MP K NP   E +     +V G
Sbjct: 265 IYSTAEFGFIKLS-DAYSTGSSLMPQKKNPDSLELLRGKAGRVFG 308

>Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359W
           (ADE13) - Adenylosuccinate Lyase [contig 198] FULL
          Length = 482

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 82/183 (44%), Gaps = 13/183 (7%)

Query: 164 LIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSL 223
           LIPK+  + D L+  + E++ +  +G TH Q A   TLG+  + ++Q+L+  +     + 
Sbjct: 128 LIPKLVNVIDRLSKFAMEWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 224 INLKFLAQGGTAVGTG-----LNTKIGFAERIAEQVSKETGIEFKTAPNKFEALAAHDAI 278
            ++      GT    G      ++     E + ++V++  G  F T         +    
Sbjct: 188 NDIGLRGVKGTTGTQGSFLALFHSDHDKVEALDKRVTELLG--FDTVYPVTGQTYSRKID 245

Query: 279 VESSGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMT 338
           ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E   
Sbjct: 246 IDVLAPLSSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMRCE--- 299

Query: 339 QVC 341
           +VC
Sbjct: 300 RVC 302

>NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 88/191 (46%), Gaps = 29/191 (15%)

Query: 164 LIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSL 223
           +IPK+  + D L+  + E++ +  +G TH Q A   TLG+  + ++Q+L+  +     + 
Sbjct: 128 VIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 224 INLKFLAQGGT--------AVGTGLNTKI-GFAERIAEQVSKET--GIEFKTAPNKFEAL 272
            ++      GT        A+  G + K+    +R+ E +  +T   +  +T   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 273 AAHDAIVESSGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKVN 330
                 ++    L++ A +  K+A DIR L +       EL  P  +++ GSS M  K N
Sbjct: 246 ------IDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKRN 294

Query: 331 PTQNEAMTQVC 341
           P + E   +VC
Sbjct: 295 PMRCE---RVC 302

>Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 81/207 (39%), Gaps = 11/207 (5%)

Query: 142 QSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTL 201
           +S ND   T + I     +  +L P +  L D L  ++K   +I+  G THLQ A P+  
Sbjct: 112 RSRNDQVVTDLRIYCRDVVNDNLFPALKGLVDVLIKRAKGEINILMPGYTHLQRAQPIRW 171

Query: 202 GQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGFAERIAEQVSKETGIE 261
               S Y         R++  L  L     G  A+        G    I  +   E G+ 
Sbjct: 172 SHWLSSYATYFTEDYKRLDQILHRLNQSPLGAGALA-------GHPYGIDREFLAE-GLG 223

Query: 262 FKTA-PNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEP 320
           F +   N   A++  D IVE           + + A+D+  +      G+ +LS      
Sbjct: 224 FNSVIGNSMVAVSDRDFIVELMFWGTLFMNHISRFAEDL-IIYCTAEFGFIQLS-DAYST 281

Query: 321 GSSIMPGKVNPTQNEAMTQVCVQVMGN 347
           GSS+MP K N    E +     +V G+
Sbjct: 282 GSSLMPQKKNADSLELLRGKSGRVFGD 308

>TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.354
           YHR018C
          Length = 466

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 86/224 (38%), Gaps = 14/224 (6%)

Query: 124 GGIMGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFE 183
           G I+G+   H     +  +S ND   T + I     +   L+P M +L   +  +++   
Sbjct: 97  GEIIGT---HIAGKVHTGRSRNDQCVTDLRIYCRDILVEKLLPFMIDLVQVITKRAENEI 153

Query: 184 HIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTK 243
            I+  G THLQ A P+      S Y         R++  L  L     G  A+       
Sbjct: 154 DILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQVLERLNKCPLGAGAIA------ 207

Query: 244 IGFAERIAEQ-VSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYL 302
            G    I  Q +S E G       N   A++  D IV+           + + ++D+  +
Sbjct: 208 -GHPYGIDRQYLSDELGFN-SIIGNSLVAVSDRDFIVDIMFWSTLFMNHISRFSEDL-II 264

Query: 303 GSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 346
            S    G+ +LS      GSS+MP K N    E +     +V G
Sbjct: 265 YSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 307

>NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 85/189 (44%), Gaps = 25/189 (13%)

Query: 164 LIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSL 223
           +IPK+  + D L+  + E++ +  +G TH Q A   TLG+  + ++Q+L+  +     + 
Sbjct: 128 IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 224 INLKFLAQGGT--------AVGTGLNTKI-GFAERIAEQVSKET--GIEFKTAPNKFEAL 272
            ++      GT        A+  G + K+    +R+ E +  +T   +  +T   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 273 AAHDAIVESSGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPT 332
                 ++    L + A +  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVLAPLASFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPM 296

Query: 333 QNEAMTQVC 341
           + E   +VC
Sbjct: 297 RCE---RVC 302

>KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]
           {ON} highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 88/192 (45%), Gaps = 31/192 (16%)

Query: 164 LIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSL 223
           LIPK+  + + L+  + E++ +  +G TH Q A   TLG+  + ++Q+L+  +     + 
Sbjct: 128 LIPKLVNVINRLSKFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 224 INLKFLAQGGTAVGT---------GLNTKI-GFAERIAEQVSKET--GIEFKTAPNKFEA 271
            ++      GT  GT         G + K+    +R+AE +   T   +  +T   K + 
Sbjct: 188 NDIGLRGVKGTT-GTQASFLTLFHGDHDKVEALDKRVAELLGFSTVYPVTGQTYSRKID- 245

Query: 272 LAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKV 329
                  ++    L++ A +  K+A DIR L +       EL  P  +++ GSS M  K 
Sbjct: 246 -------IDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKR 293

Query: 330 NPTQNEAMTQVC 341
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 62/257 (24%), Positives = 94/257 (36%), Gaps = 49/257 (19%)

Query: 110 NANEVISNRAIELKGGIMGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMT 169
           +AN+   + A E + G +  ++I    H    +S ND   T + I     +   L P M 
Sbjct: 82  HANDEDIHTANERRLGELIGRDIAGKVHT--GRSRNDQVVTDLRIYCRDVVNDSLFPAMK 139

Query: 170 ELKDALANKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIAR---IEHSL--- 223
            L D L  +++    I+  G THLQ A P+      S Y         R   I H L   
Sbjct: 140 GLVDVLVKRAEGEMDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLVQILHRLNQS 199

Query: 224 -------------INLKFLAQGGTAVGTGLNTKIGFAERIAEQVSKETGIEFKTAPNKFE 270
                        I+ +FLA+     G G N+ IG                     N   
Sbjct: 200 PLGAGALAGHPYGIDREFLAE-----GLGFNSVIG---------------------NSLV 233

Query: 271 ALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVN 330
           A++  D IVE           + + A+D+  +      G+ +LS      GSS+MP K N
Sbjct: 234 AVSDRDFIVELMFWGTLFMNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKN 291

Query: 331 PTQNEAMTQVCVQVMGN 347
               E +     +V G+
Sbjct: 292 ADSLELLRGKSGRVFGD 308

>KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 86/189 (45%), Gaps = 25/189 (13%)

Query: 164 LIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSL 223
           +IPK+  + D L+  + +++ +  +G TH Q A   TLG+  + ++Q+L+  +     + 
Sbjct: 128 VIPKLVNVIDRLSKFALQYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFVRAR 187

Query: 224 INLKFLAQGGT--------AVGTGLNTKI-GFAERIAEQVSKET--GIEFKTAPNKFEAL 272
            ++      GT        A+  G + K+    +R+ E +  +T   +  +T   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 273 AAHDAIVESSGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPT 332
                 ++    L++ A S  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPM 296

Query: 333 QNEAMTQVC 341
           + E   +VC
Sbjct: 297 RCE---RVC 302

>ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 83/189 (43%), Gaps = 25/189 (13%)

Query: 164 LIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSL 223
           +IPK+  + D L+  +  ++ +  +G TH Q A   TLG+  + ++Q L+  +   + + 
Sbjct: 128 IIPKLINVIDRLSKFALNYKDVPVLGWTHFQPAQLTTLGKRVTLWIQDLLWDLRNFDRAR 187

Query: 224 INLKFLAQGGT--------AVGTGLNTKI-GFAERIAEQVSKET--GIEFKTAPNKFEAL 272
            ++      GT        A+  G + K+    +R+ E +  ET   +  +T   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEELDQRVTELLGFETVYPVTGQTYSRKID-- 245

Query: 273 AAHDAIVESSGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPT 332
                 ++    L + A +  K+A DIR L +       E    + + GSS M  K NP 
Sbjct: 246 ------IDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPM 296

Query: 333 QNEAMTQVC 341
           + E   +VC
Sbjct: 297 RCE---RVC 302

>SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 88/191 (46%), Gaps = 29/191 (15%)

Query: 164 LIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSL 223
           LIPK+  + + L+  + E++ +  +G TH Q A   TLG+  + ++Q+L+  +     + 
Sbjct: 128 LIPKLVNVINRLSQFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 224 INLKFLAQGGT--------AVGTGLNTKI-GFAERIAEQVSKET--GIEFKTAPNKFEAL 272
            ++      GT        A+  G + K+    +R+ E +  +T   +  +T   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 273 AAHDAIVESSGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKVN 330
                 ++    L++ A +  K+A DIR L +       E+  P  +++ GSS M  K N
Sbjct: 246 ------IDVLAPLSSFAATAHKMATDIRLLAN-----LKEMEEPFEKSQIGSSAMAYKRN 294

Query: 331 PTQNEAMTQVC 341
           P + E   +VC
Sbjct: 295 PMRCE---RVC 302

>KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 84/186 (45%), Gaps = 19/186 (10%)

Query: 164 LIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSL 223
           LIPK+  + + L   +   + +  +G TH Q A   TLG+  + ++Q+L+  +   E + 
Sbjct: 128 LIPKLVNVINRLCKFAMANKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 224 INLKFLAQGGT--------AVGTGLNTKIGFAERIAEQVSKETGIEFKTAPNKFEALAAH 275
            ++      GT        A+  G + K+   E++ E+V +  G  F T         + 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHNKV---EKLDERVVELLG--FDTVYPVTGQTYSR 242

Query: 276 DAIVESSGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 335
              +++   L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243 KIDIDAFAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 336 AMTQVC 341
              +VC
Sbjct: 300 ---RVC 302

>KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]
           {ON} highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 465

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 67/288 (23%), Positives = 115/288 (39%), Gaps = 36/288 (12%)

Query: 68  GILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGIM 127
           G+L AG+  L Q+  DE+  G       ++  +  S +    + +E I        G I+
Sbjct: 50  GLLKAGL--LTQEELDEIHRG-----LEIIRGEWASNSFVEKDGDEDIHTANERRLGEII 102

Query: 128 GSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIVK 187
           G    H     +  +S ND   T M I    E   ++   + +L  A+  ++++    + 
Sbjct: 103 GR---HIAGKVHTGRSRNDQVATDMRIYC-REALDNMAKILKDLVGAILQRAEQEIDALM 158

Query: 188 IGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVG---TGLNTKI 244
            G THLQ A P+      + Y         R++     L     G  A+     G++   
Sbjct: 159 PGYTHLQRAQPIRWSHWLNLYATYFTEDFKRLKQIRERLNVSPLGCGALAGHPYGIDR-- 216

Query: 245 GFAERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLF-----KIAQDI 299
              E IAE++  +  I      N  +A++  D +VE         CSLF     + ++D+
Sbjct: 217 ---EHIAERLGFDGVI-----GNSLQAVSDRDFVVEI-----LFWCSLFMNHISRFSEDL 263

Query: 300 RYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 347
             + S     + +LS      GSS+MP K NP   E +     +V G+
Sbjct: 264 -IIYSTAEFNFVKLS-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGS 309

>ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly
           similar to uniprot|P04076 Saccharomyces cerevisiae
           YHR018C ARG4 Argininosuccinate lyase catalyzes the final
           step in the arginine biosynthesis pathway
          Length = 462

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 85/217 (39%), Gaps = 15/217 (6%)

Query: 138 CNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIVKIGRTHLQDAT 197
            +  +S ND   T M I     +   L+P + EL   +  ++++    +  G THLQ A 
Sbjct: 108 VHTGRSRNDQVVTDMRIFCRDTVNEKLLPGLKELVSVMVKRAEKEIGYLMPGYTHLQRAQ 167

Query: 198 PLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVG---TGLNTKIGFAERIAEQV 254
           P+      S Y       + R+   L        G  A+     G++      E +AE++
Sbjct: 168 PIRWSHWLSSYATYFTEDLKRLRQLLERFNQSPLGAGALAGHPYGIDR-----EFLAEEL 222

Query: 255 SKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGPRCGYGELS 314
             +  I      N   A++  D +VE           + + A+D+  + S    G+ +L+
Sbjct: 223 GFQGVI-----GNSLVAVSDRDFVVELMFWGTLFMNHISRFAEDL-IIYSTAEFGFIKLN 276

Query: 315 LPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAI 351
                 GSS+MP K N    E +     +V G+ A  
Sbjct: 277 -DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLAGF 312

>TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.354
           YHR018C
          Length = 465

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 78/224 (34%), Gaps = 37/224 (16%)

Query: 142 QSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTL 201
           +S ND   T + I     +   L P +  L D +  + KE   ++  G THLQ A P+  
Sbjct: 112 RSRNDQCVTDLRIYCRDLLNDKLFPDLQALVDVMIKRGKEEIDVLMPGYTHLQRAQPIRW 171

Query: 202 GQEFSGYVQQLINGIARIEHSL--INLKFLAQGG------------TAVGTGLNTKIGFA 247
               S Y         R+   +  IN   L  G              A G G +  IG  
Sbjct: 172 SHWLSSYATYFTEDFKRLRQIMDRINQSPLGAGALAGHPYGIDREFLAAGLGFDGVIG-- 229

Query: 248 ERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGPR 307
                              N   A++  D IVE           + + A+D+  + S   
Sbjct: 230 -------------------NSLVAVSDRDFIVELMFWGTLFMNHISRFAEDL-IIYSTAE 269

Query: 308 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAI 351
            G+ +L+      GSS+MP K N    E +     +V G+ A  
Sbjct: 270 FGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLAGF 312

>TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 89/191 (46%), Gaps = 29/191 (15%)

Query: 164 LIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSL 223
           +IPK+  + + L++ + +++ +  +G TH Q A   TLG+  + ++Q+L+  +     + 
Sbjct: 128 IIPKLVNVINRLSDFALKYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 224 INLKFLAQGGT--------AVGTGLNTKI-GFAERIAEQVSKET--GIEFKTAPNKFEAL 272
            ++      GT        A+  G + K+    +R+ E +  +T   +  +T   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 273 AAHDAIVESSGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKVN 330
                 ++    L++ A +  K+A DIR L +       E+  P  +++ GSS M  K N
Sbjct: 246 ------IDVLSPLSSFAATAHKMATDIRLLAN-----LKEMEEPFEKSQIGSSAMAYKRN 294

Query: 331 PTQNEAMTQVC 341
           P + E   +VC
Sbjct: 295 PMRCE---RVC 302

>KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 85/189 (44%), Gaps = 25/189 (13%)

Query: 164 LIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSL 223
           LIPK+  + + L+  + +++ +  +G TH Q A   TLG+  + ++Q+L+  +     + 
Sbjct: 128 LIPKLVNVINRLSQFALQWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 224 INLKFLAQGGT--------AVGTGLNTKI-GFAERIAEQVSKET--GIEFKTAPNKFEAL 272
            ++      GT        A+  G + K+    +R+ E +  +T   +  +T   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 273 AAHDAIVESSGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPT 332
                 ++    L + A +  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVLAPLCSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPM 296

Query: 333 QNEAMTQVC 341
           + E   +VC
Sbjct: 297 RCE---RVC 302

>Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]
           {ON} YHR018C (ARG4) - argininosuccinate lyase [contig
           260] FULL
          Length = 465

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 58/244 (23%), Positives = 95/244 (38%), Gaps = 39/244 (15%)

Query: 124 GGIMGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFE 183
           G I+G    H     +  +S ND   T M I    E   +L   + +L  A+  +S++  
Sbjct: 99  GEIIGR---HIAGKVHTGRSRNDQVATDMRIYC-REALDNLAKILEDLIGAILQRSEQEI 154

Query: 184 HIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEH--SLINLKFLAQGGTA---VGT 238
             +  G THLQ A P+      + Y         R++     +N+  L  G  A    G 
Sbjct: 155 DALMPGYTHLQRAQPIRWSHWLNLYATYFTEDFKRLKQIRERLNVSPLGCGALAGHPYGI 214

Query: 239 G---LNTKIGFAERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLF-- 293
               L  ++GF++ I                N  +A++  D +VE         CSLF  
Sbjct: 215 DREFLAERLGFSDVIG---------------NSLQAVSDRDFVVEI-----MFWCSLFMN 254

Query: 294 ---KIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA 350
              + ++D+  + S     + +LS      GSS+MP K NP   E +     +V G+ A 
Sbjct: 255 HISRFSEDL-IIYSTAEFNFVKLS-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGSLAG 312

Query: 351 ITFA 354
              +
Sbjct: 313 FMMS 316

>Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 51/207 (24%), Positives = 78/207 (37%), Gaps = 11/207 (5%)

Query: 142 QSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTL 201
           +S ND   T + I     +   L P +  L D L  +++    I+  G THLQ A P+  
Sbjct: 112 RSRNDQVVTDLRIYCRDVVNGTLFPALKGLVDVLIKRAEGEIDILMPGYTHLQRAQPIRW 171

Query: 202 GQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGFAERIAEQVSKETGIE 261
               S Y         R+   L  L     G  A+        G    I  +   E G+ 
Sbjct: 172 SHWLSSYATYFTEDYKRLGQILHRLNQSPLGAGALA-------GHPYGIDREFLAE-GLG 223

Query: 262 FKTA-PNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEP 320
           F +   N   A++  D IVE           + + A+D+  +      G+ +LS      
Sbjct: 224 FNSVIGNSLVAVSDRDFIVELMFWGTLFMNHISRFAEDL-IIYCTAEFGFIQLS-DAYST 281

Query: 321 GSSIMPGKVNPTQNEAMTQVCVQVMGN 347
           GSS+MP K N    E +     +V G+
Sbjct: 282 GSSLMPQKKNADSLELLRGKSGRVFGD 308

>Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]
           {ON} complement(330965..332347) [1383 nt, 461 aa]
          Length = 460

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 52/228 (22%), Positives = 78/228 (34%), Gaps = 37/228 (16%)

Query: 141 AQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLT 200
            +S ND   T + I     I   L+P +  L   L  + +    I+  G THLQ A P+ 
Sbjct: 109 GRSRNDQCVTDLRIYCRDIIQDKLLPSLKSLIQVLVKRGEGEIGILMPGYTHLQRAQPIR 168

Query: 201 LGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAV--------------GTGLNTKIGF 246
                S Y         R++  L  L     G  A+              G G N  IG 
Sbjct: 169 WSHWLSSYATYFTEDYKRLKQLLDRLNVSPLGAGALAGHPYGIDREFLANGLGFNGVIG- 227

Query: 247 AERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGP 306
                               N   A++  D +VE           + + A+D+  + S  
Sbjct: 228 --------------------NSLVAVSDRDFVVELLFWGTLFMNHISRFAEDL-IIYSTA 266

Query: 307 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFA 354
             G+  LS      GSS+MP K N    E +     +V GN + +  +
Sbjct: 267 EFGFITLS-DAYSTGSSLMPQKKNSDSLELLRGKSGRVFGNLSGLLMS 313

>ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR359W
           (ADE13)
          Length = 482

 Score = 37.0 bits (84), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 84/190 (44%), Gaps = 27/190 (14%)

Query: 164 LIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSL 223
           +IPK+  + + L+  + E++ +  +G TH Q A   TLG+  + ++Q+L+  +     + 
Sbjct: 128 IIPKLVNVINRLSKFACEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 224 INLKFLAQGGTAVGTGLNTKIGF------AERIAEQVSKETGIEF------KTAPNKFEA 271
            ++      GT  GT  +    F       E + ++V++  G +       +T   K + 
Sbjct: 188 NDIGLRGVKGT-TGTQASFLALFHGDHDRVEALDKRVTELLGFDIVYPVTGQTYSRKID- 245

Query: 272 LAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNP 331
                  ++  G+ ++   +  K+A DIR L +       E    + + GSS M  K NP
Sbjct: 246 -------IDILGSGSSFEATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNP 295

Query: 332 TQNEAMTQVC 341
            + E   +VC
Sbjct: 296 MRCE---RVC 302

>YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}
           ARG4Argininosuccinate lyase, catalyzes the final step in
           the arginine biosynthesis pathway
          Length = 463

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 52/225 (23%), Positives = 80/225 (35%), Gaps = 47/225 (20%)

Query: 142 QSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTL 201
           +S ND   T + I     +   L P +  L + L  +++    ++  G THLQ A P+  
Sbjct: 112 RSRNDQVVTDLRIYCRDIVNDTLFPALKGLVEVLIKRAEGEIDVLMPGYTHLQRAQPIRW 171

Query: 202 GQEFSGYVQQLINGIAR---IEHSL----------------INLKFLAQGGTAVGTGLNT 242
               S Y         R   I H L                I+ +FLA+     G G N+
Sbjct: 172 SHWLSSYATYFTEDYKRLGQILHRLNQSPLGAGALAGHPYGIDREFLAE-----GLGFNS 226

Query: 243 KIGFAERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYL 302
            IG                     N   A++  D IVE           + + A+D+  +
Sbjct: 227 VIG---------------------NSLVAVSDRDFIVELMFWGTLFMNHISRFAEDL-II 264

Query: 303 GSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 347
                 G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 265 YCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>KLLA0D15081g Chr4 (1271696..1274728) [3033 bp, 1010 aa] {ON} some
           similarities with Saccharomyces cerevisiae YPR115W
           Hypothetical ORF and to YGR097W uniprot|P48361
           Saccharomyces cerevisiae YGR097W ASK10 Component of the
           RNA polymerase II holoenzyme phosphorylated in response
           to oxidative stress has a role in destruction of Ssn8p
           which relieves repression of stress-response genes
          Length = 1010

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 153 HIAAVTEITHHLIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYV 209
            + +  EIT  +IPK+ +L+  L++K KE + +    +T++Q+   LT GQ    Y+
Sbjct: 269 QVKSSKEITLQIIPKLEDLRKDLSHKIKEIKELNADFKTNIQEHVALT-GQLLHKYI 324

>ACR072C Chr3 complement(489699..492671) [2973 bp, 990 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR027C
           (RPN1)
          Length = 990

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 72/179 (40%), Gaps = 13/179 (7%)

Query: 98  VFQTGSGTQSNMNANE---VISNRAIELKGGIMGSKEIHPNNHCNMAQSSNDTFPTVMHI 154
           V  T S T+ +  +NE     S +A E K  +  SKE    N       S D   +   +
Sbjct: 668 VMNTASTTEDSAISNEESTSTSKKADEDKMDVDNSKEEDAKNGDQGKHESKDDESSEKSM 727

Query: 155 AAVTEITHHLIP-KMTELKDALANKS--KEFEHIVKIGRTHLQDATPLTLGQ-EFSGYVQ 210
           A + E+T+ ++   M  + + +  +   + F H++  G  H++   PL +G    S    
Sbjct: 728 AHIDELTYSVLGIAMVAMGEDIGKEMSLRHFGHLMHYGNQHIRRVVPLAMGLVSVSDPQM 787

Query: 211 QLINGIARIEHS-----LINLKFLAQGGTAVGTGLNTKIGFAERIAEQVSKETGIEFKT 264
           ++ + ++R  H       IN  F A G    GT          ++A   SKE    F T
Sbjct: 788 KVFDTLSRFSHDPDLDVSINSIF-AMGLCGCGTNNARLAQLLRQLASYYSKEQNTLFVT 845

>KNAG0D03480 Chr4 complement(625236..628724) [3489 bp, 1162 aa]
          {ON} Anc_4.117 YGL006W
          Length = 1162

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 9  LETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVL 56
          L+TD    IKVP ++  G Q  RS + ++  G   R+PE + K+FG L
Sbjct: 52 LKTDLETGIKVPLNETEGTQNHRSTDRYRKYGD-NRIPERLPKSFGKL 98

>Ecym_4452 Chr4 complement(923429..927094) [3666 bp, 1221 aa] {ON}
           similar to Ashbya gossypii ADR029W
          Length = 1221

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 31/71 (43%), Gaps = 2/71 (2%)

Query: 95  PLVVFQTG--SGTQSNMNANEVISNRAIELKGGIMGSKEIHPNNHCNMAQSSNDTFPTVM 152
           P++    G  S ++ N        N  + +  G+  SK++ PN +C      N+T PT  
Sbjct: 272 PILTISCGEQSASEFNFYKTRFSINVVVGIPYGVFDSKKLLPNKNCIRVDKDNNTTPTPF 331

Query: 153 HIAAVTEITHH 163
           +  +V   + H
Sbjct: 332 YNFSVLSCSTH 342

>AAR086W Chr1 (496601..499024) [2424 bp, 807 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR097W (ASK10) and
           YPR115W
          Length = 807

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 153 HIAAVTEITHHLIPKMTELKDALANKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYV 209
            + A  E+ + +IPK+ EL+  L++K KE + +    +T++ +   LT GQ    Y+
Sbjct: 187 QLKASRELNNVVIPKLEELRRNLSSKIKEIKELSNDFKTNIHEQVALT-GQLLQKYI 242

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,386,501
Number of extensions: 1973773
Number of successful extensions: 5390
Number of sequences better than 10.0: 75
Number of HSP's gapped: 5512
Number of HSP's successfully gapped: 75
Length of query: 467
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 354
Effective length of database: 40,524,141
Effective search space: 14345545914
Effective search space used: 14345545914
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)