Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1032.36.12ON78784091e-53
ZYRO0F00528g6.12ON77761756e-18
TDEL0G045906.12ON74821531e-14
Skud_5.306.12ON74811503e-14
Ecym_30156.12ON70791461e-13
TPHA0M002206.12ON78791435e-13
Smik_5.286.12ON74811435e-13
SAKL0E00924g6.12ON97881445e-13
YEL059C-A (SOM1)6.12ON74811426e-13
ACR014C6.12ON70791418e-13
Kwal_56.223596.12ON91821411e-12
Suva_5.96.12ON73801364e-12
NCAS0F002106.12ON79831341e-11
KLTH0C11484g6.12ON89801307e-11
TBLA0G009906.12ON78791166e-09
KLLA0D00880g6.12ON71801027e-07
KNAG0E009306.12ON10933740.018
KAFR0L003506.12ON7133690.050
Kwal_27.11781singletonOFF7958630.50
NDAI0C039105.281ON20852650.58
Kwal_56.226643.96ON21257640.82
ADL177C3.32ON90541621.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1032.3
         (78 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)...   162   1e-53
ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to...    72   6e-18
TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}...    64   1e-14
Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON} YEL...    62   3e-14
Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to As...    61   1e-13
TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12 Y...    60   5e-13
Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON} YEL...    60   5e-13
SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to...    60   5e-13
YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}  SO...    59   6e-13
ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON} Syn...    59   8e-13
Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A ...    59   1e-12
Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON} YEL0...    57   4e-12
NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12 YE...    56   1e-11
KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON...    55   7e-11
TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12 ...    49   6e-09
KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON} uniprot|P7...    44   7e-07
KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON...    33   0.018
KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12 Y...    31   0.050
Kwal_27.11781 s27 complement(943512..943751) [240 bp, 79 aa] {OF...    29   0.50 
NDAI0C03910 Chr3 complement(888565..889191) [627 bp, 208 aa] {ON...    30   0.58 
Kwal_56.22664 s56 complement(224313..224951) [639 bp, 212 aa] {O...    29   0.82 
ADL177C Chr4 complement(383367..386084) [2718 bp, 905 aa] {ON} S...    28   1.5  

>Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)
          [237 nt, 79 aa]
          Length = 78

 Score =  162 bits (409), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%)

Query: 1  MAPPTPIQSREEVLRGKKCLTMVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKRLFE 60
          MAPPTPIQSREEVLRGKKCLTMVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKRLFE
Sbjct: 1  MAPPTPIQSREEVLRGKKCLTMVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKRLFE 60

Query: 61 ECSGIRIEVTDRFTNNDK 78
          ECSGIRIEVTDRFTNNDK
Sbjct: 61 ECSGIRIEVTDRFTNNDK 78

>ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A
          Length = 77

 Score = 72.0 bits (175), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 52/76 (68%), Gaps = 3/76 (3%)

Query: 1  MAPPTPIQSREEVLRGKKCLTMVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKRLFE 60
          MAPPTPI + E+V R ++ + ++  +K KC L S+TQ  C  E    GEYIC+PFKR+FE
Sbjct: 1  MAPPTPILTSEQVSRERERVQIL-KEKNKCELKSLTQHLCHAEAP--GEYICVPFKRVFE 57

Query: 61 ECSGIRIEVTDRFTNN 76
          +C G  +EVTD  TN+
Sbjct: 58 KCLGHALEVTDADTND 73

>TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 74

 Score = 63.5 bits (153), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 39/82 (47%), Positives = 48/82 (58%), Gaps = 14/82 (17%)

Query: 1  MAPPTPIQSREEVLRGKKCLTMVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKRLFE 60
          MAPPTP+ +REE       L  +   K  C L S+TQFQC+   +  G Y C+PFKRLF+
Sbjct: 1  MAPPTPVLAREE-------LPEIPQSKN-CVLKSLTQFQCQLRPAGSGLYECVPFKRLFQ 52

Query: 61 EC---SG---IRIEVTDRFTNN 76
          EC   SG    RIEVT   TN+
Sbjct: 53 ECRDPSGRFKSRIEVTSPLTNH 74

>Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score = 62.4 bits (150), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 46/81 (56%), Gaps = 12/81 (14%)

Query: 1  MAPPTPIQSREEVLRGKKCLTMVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKRLFE 60
          MAPPT I+SR++ L     L    +   +C L  + Q++C+F    E +Y+C PFKRLFE
Sbjct: 1  MAPPTTIRSRDQALAPLAAL----DSHTRCQLKELVQWECQFR---EADYVCFPFKRLFE 53

Query: 61 EC-----SGIRIEVTDRFTNN 76
           C     S    EVTD +TN+
Sbjct: 54 RCIAPDKSATDYEVTDTYTNS 74

>Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to
          Ashbya gossypii ACR014C
          Length = 70

 Score = 60.8 bits (146), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 47/79 (59%), Gaps = 14/79 (17%)

Query: 1  MAPPTPIQSREEVLRGKKCLTMVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKRLFE 60
          MAPPTPI +R+EV         + ++   C L S+ Q +C F+      Y+C+PFKRLFE
Sbjct: 1  MAPPTPIITRDEV-------EPILSRTKDCILASLIQNECHFDGH---NYVCIPFKRLFE 50

Query: 61 ECS----GIRIEVTDRFTN 75
          EC+     +RIEVTD  TN
Sbjct: 51 ECTLNKRRVRIEVTDISTN 69

>TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 59.7 bits (143), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 45/79 (56%), Gaps = 8/79 (10%)

Query: 1  MAPPTPIQSREEV---LRGKKCLTMVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKR 57
          MAP TP+  RE V   L+  K        + +C L ++TQ++C+F +     YIC PFKR
Sbjct: 1  MAPATPVVDREAVAATLQASK-----QRNRQECELKALTQYECQFVDLESNRYICRPFKR 55

Query: 58 LFEECSGIRIEVTDRFTNN 76
          LFE C+G   E T + TN+
Sbjct: 56 LFEVCAGTSYETTAQPTNS 74

>Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score = 59.7 bits (143), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 46/81 (56%), Gaps = 12/81 (14%)

Query: 1  MAPPTPIQSREEVLRGKKCLTMVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKRLFE 60
          MAPPT I+SR++ L       M  + +  C L  + Q++C+F+ +   +Y+C PFKRLFE
Sbjct: 1  MAPPTTIRSRDQALAP----LMALDSQASCQLKELVQWECQFKGA---DYVCSPFKRLFE 53

Query: 61 EC-----SGIRIEVTDRFTNN 76
           C          EVTD +TN+
Sbjct: 54 HCVEHGKPATNYEVTDTYTNS 74

>SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A SOM1
          Protein whose overexpression suppresses the imp1
          mutation may be required for the function of the Imp1p
          mitochondrial inner membrane peptidase and/or the
          protein sorting machinery
          Length = 97

 Score = 60.1 bits (144), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 35/88 (39%), Positives = 49/88 (55%), Gaps = 21/88 (23%)

Query: 1  MAPPTPIQSREEVLRGKKCLTMVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKRLFE 60
          MAPPTP+  ++E+       +++   K  CTL S+ Q +C F      EYIC+PFKRLF+
Sbjct: 1  MAPPTPVFGKDELE------SLLKKVKPPCTLKSLIQNECTFNGE---EYICVPFKRLFK 51

Query: 61 EC------------SGIRIEVTDRFTNN 76
          EC              +RIE+TDR TN+
Sbjct: 52 ECLLDSKTKDGRTSRTVRIEITDRHTND 79

>YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}
          SOM1Subunit of the mitochondrial inner membrane
          peptidase, which is required for maturation of
          mitochondrial proteins of the intermembrane space;
          Som1p facilitates cleavage of a subset of substrates;
          contains twin cysteine-x9-cysteine motifs
          Length = 74

 Score = 59.3 bits (142), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 46/81 (56%), Gaps = 12/81 (14%)

Query: 1  MAPPTPIQSREEVLRGKKCLTMVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKRLFE 60
          MAPPT I++R++ L     L    + +  C L  + Q++C+F+     EY+C PFKRLFE
Sbjct: 1  MAPPTTIRTRDQALAPLATL----DSQTNCRLKELVQWECQFKG---AEYVCSPFKRLFE 53

Query: 61 EC-----SGIRIEVTDRFTNN 76
           C     S    EVTD +TN+
Sbjct: 54 HCIAPDKSATNYEVTDTYTNS 74

>ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YEL059C-A
          (SOM1)
          Length = 70

 Score = 58.9 bits (141), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 47/79 (59%), Gaps = 14/79 (17%)

Query: 1  MAPPTPIQSREEVLRGKKCLTMVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKRLFE 60
          MAPPTP+ +REEV       T  D     C L S+TQ +C F+      Y+C+PF+RLF 
Sbjct: 1  MAPPTPVLTREEV--APALATSRD-----CVLASLTQNECHFDGR---GYVCVPFQRLFR 50

Query: 61 ECS----GIRIEVTDRFTN 75
          EC+     +RIE+T+R TN
Sbjct: 51 ECTLNKRRVRIEITERNTN 69

>Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A
          (SOM1) - involved in mitochondrial inner peptidase
          function [contig 186] FULL
          Length = 91

 Score = 58.9 bits (141), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 13/82 (15%)

Query: 1  MAPPTPIQSREEVLRGKKCLTMVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKRLFE 60
          MAPPT +  +EE+        ++ N    C   S+TQ +C F+     +Y+C+PFKR+F+
Sbjct: 1  MAPPTVVFGKEELE------PLLRNVMATCIFKSLTQSECNFDGH---QYVCVPFKRVFK 51

Query: 61 EC----SGIRIEVTDRFTNNDK 78
          EC      IRIEVTDR TN  K
Sbjct: 52 ECKVDGKSIRIEVTDRNTNKAK 73

>Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON}
          YEL059C-A (REAL)
          Length = 73

 Score = 57.0 bits (136), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 46/80 (57%), Gaps = 12/80 (15%)

Query: 1  MAPPTPIQSREEVLRGKKCLTMVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKRLFE 60
          MAPPT I++R++ L     L    + +  C L  + Q++C+F+ +   +Y+C PF+RLFE
Sbjct: 1  MAPPTTIRARDQALAPLATL----DSRTHCHLKELVQWECQFKGA---DYVCSPFRRLFE 53

Query: 61 EC-----SGIRIEVTDRFTN 75
           C     +    EVTD +TN
Sbjct: 54 HCTAPGEAATNYEVTDTYTN 73

>NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 79

 Score = 56.2 bits (134), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 50/83 (60%), Gaps = 13/83 (15%)

Query: 1  MAPPTPIQSREEVLRGKKCLTMVDNKKGK--------CTLTSITQFQCRFENSYEGEYIC 52
          MAPP  +  ++++ R K  L+  +N+ G+        C    +TQFQC+     +G+YIC
Sbjct: 1  MAPPVVVFGKDDI-RVKTALS--NNRTGETDAETGDGCRQFQLTQFQCQLLE--DGQYIC 55

Query: 53 LPFKRLFEECSGIRIEVTDRFTN 75
           PFKR+F+EC G+R EVT+  +N
Sbjct: 56 FPFKRVFQECQGVRTEVTNVDSN 78

>KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON}
          similar to uniprot|Q05676 Saccharomyces cerevisiae
          YEL059C-A SOM1 Protein whose overexpression suppresses
          the imp1 mutation may be required for the function of
          the Imp1p mitochondrial inner membrane peptidase and/or
          the protein sorting machinery
          Length = 89

 Score = 54.7 bits (130), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 46/80 (57%), Gaps = 13/80 (16%)

Query: 1  MAPPTPIQSREEVLRGKKCLTMVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKRLFE 60
          MAPPT +  +EE L+G     + +     C L ++ Q +C F      EY+C PFKRLF+
Sbjct: 1  MAPPTLVFGKEE-LKG-----IWEKAAEPCFLKALVQNECEFNGH---EYVCTPFKRLFK 51

Query: 61 ECSG----IRIEVTDRFTNN 76
          EC      +RIEVTD+ TN+
Sbjct: 52 ECGAGKRIVRIEVTDQDTNH 71

>TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 49.3 bits (116), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 45/79 (56%), Gaps = 6/79 (7%)

Query: 1  MAPPTPIQSREE--VLRGKKCLTMVDN--KKGKCTLTSITQFQCRFENSYEGEYICLPFK 56
          MAPP  IQ++EE  +L         D+  K  K    SITQ++C F+N  +G+  C PFK
Sbjct: 1  MAPPVTIQTKEELDILEKVNRKNRKDDTKKSAKPKKYSITQYEC-FDND-KGQIECFPFK 58

Query: 57 RLFEECSGIRIEVTDRFTN 75
          R+F++    R E+TD  TN
Sbjct: 59 RIFQQVGEYRREITDETTN 77

>KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON}
          uniprot|P78699 Kluyveromyces lactis KLLA0D00880g SOM1
          Protein SOM1 mitochondrial precursor
          Length = 71

 Score = 43.9 bits (102), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 41/80 (51%), Gaps = 15/80 (18%)

Query: 1  MAPPTPIQSREEVLRGKKCLTMVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKRLFE 60
          MAPPT I   +   R       +  +   C+L S+ Q +C F  +   +Y+C PFKRLFE
Sbjct: 1  MAPPTKILGLDTQQR-------MLQRGENCSLKSLVQNECAFNGN---DYVCTPFKRLFE 50

Query: 61 EC-----SGIRIEVTDRFTN 75
          +C       + IEVT+  TN
Sbjct: 51 QCMVKDGRVLNIEVTNLNTN 70

>KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 109

 Score = 33.1 bits (74), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 3/33 (9%)

Query: 30 CTLTSITQFQCRFENSYEGEYICLPFKRLFEEC 62
          C L  + QF+C  + +   ++ C PF+RLFE+C
Sbjct: 22 CVLKELVQFRCENDGT---QWQCAPFRRLFEQC 51

>KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 71

 Score = 31.2 bits (69), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 2/33 (6%)

Query: 30 CTLTSITQFQCRFENSYEGEYICLPFKRLFEEC 62
          C L S+ Q+ C +     G   C PFKR+F EC
Sbjct: 23 CQLYSLVQYNCEYRVG--GTLECFPFKRMFLEC 53

>Kwal_27.11781 s27 complement(943512..943751) [240 bp, 79 aa]
          {OFF} [contig 27] FULL
          Length = 79

 Score = 28.9 bits (63), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 28/58 (48%)

Query: 21 TMVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKRLFEECSGIRIEVTDRFTNNDK 78
          + + NKK    + S  ++  +     EG  +C P   L + CS +R+E+ +   N +K
Sbjct: 20 SFLGNKKPLPLVLSKRRYARKGTGGGEGSTVCYPVHYLGQWCSFVRVELQNVAENGEK 77

>NDAI0C03910 Chr3 complement(888565..889191) [627 bp, 208 aa] {ON}
           Anc_5.281 YKL159C
          Length = 208

 Score = 29.6 bits (65), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 25/52 (48%)

Query: 10  REEVLRGKKCLTMVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKRLFEE 61
           REE L+     T++D+K G+ T+ +  Q       + E      P K +F++
Sbjct: 155 REETLKEPGTYTLIDSKSGRITVDTCAQADRPVHMTLEQVRTAFPPKSMFDD 206

>Kwal_56.22664 s56 complement(224313..224951) [639 bp, 212 aa]
          {ON} YDR487C (RIB3) - 3,4-dihydroxy-2-butanone
          4-phosphate synthase [contig 184] FULL
          Length = 212

 Score = 29.3 bits (64), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 25/57 (43%), Gaps = 6/57 (10%)

Query: 5  TPIQSREEVLRGKKCLTMVDNKKGK------CTLTSITQFQCRFENSYEGEYICLPF 55
          TPI    E+ +  K L ++D++  +      C    ITQ Q  F   Y   Y+C P 
Sbjct: 6  TPIDEAIELFKQNKFLMVMDDEGRENEADLICAAEGITQEQMAFLVRYSSGYVCAPL 62

>ADL177C Chr4 complement(383367..386084) [2718 bp, 905 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL313C
          Length = 905

 Score = 28.5 bits (62), Expect = 1.5,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 20/41 (48%)

Query: 22  MVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKRLFEEC 62
           MV   +GK  L ++   Q   +N+Y G  + L F+R    C
Sbjct: 78  MVAENRGKSLLVAVALLQTFIQNNYTGPVVPLDFERDVLRC 118

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,817,532
Number of extensions: 296889
Number of successful extensions: 558
Number of sequences better than 10.0: 22
Number of HSP's gapped: 539
Number of HSP's successfully gapped: 22
Length of query: 78
Length of database: 53,481,399
Length adjustment: 50
Effective length of query: 28
Effective length of database: 47,748,099
Effective search space: 1336946772
Effective search space used: 1336946772
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)