Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1032.26.11ON53953928770.0
TPHA0M002106.11ON54554019100.0
TDEL0G046006.11ON52853417130.0
TBLA0G009806.11ON55853416850.0
ZYRO0F00506g6.11ON55054816720.0
NCAS0F002006.11ON54954616520.0
SAKL0E00902g6.11ON54454016430.0
NDAI0K028906.11ON56154615570.0
Skud_5.316.11ON55755115470.0
Ecym_30146.11ON55154215460.0
Suva_5.106.11ON55354815420.0
Smik_5.296.11ON55554715410.0
YEL058W (PCM1)6.11ON55754815330.0
KAFR0L003406.11ON54053815290.0
Kwal_56.223556.11ON54153715260.0
CAGL0B03597g6.11ON54055215170.0
KLTH0C11506g6.11ON54453915120.0
KLLA0D00858g6.11ON54154014970.0
ACR015W6.11ON55252814430.0
KNAG0E009406.11ON53854214160.0
ABL126W8.840ON62487990.002
TPHA0I002508.840ON62983980.003
Ecym_46118.840ON63031950.007
TDEL0B005708.840ON63030940.007
Kpol_1068.88.840ON63230940.008
KLLA0D01573g8.840ON60735940.009
KAFR0B039208.840ON62428910.017
CAGL0M02981g8.840ON61773900.022
Kwal_27.102588.840ON62030900.022
NDAI0K004108.840ON62676900.027
KLTH0C03872g8.840ON62161890.030
YMR278W (PGM3)8.840ON62228880.041
KNAG0J002708.840ON62577880.041
TBLA0B032508.840ON64328880.043
Suva_13.4668.840ON62228880.044
Skud_13.4508.840ON62228880.046
ZYRO0G14190g8.840ON61028870.049
Smik_13.4918.840ON62228870.063
SAKL0D01474g8.840ON62428840.13
NCAS0C004108.840ON62549840.14
Skud_11.444.280ON2051122790.56
KNAG0B027107.323ON476115770.74
Smik_11.484.280ON2051122771.1
SAKL0H06732g8.669ON49586751.4
Kpol_1036.728.328ON59284741.8
Kpol_292.33.318ON336141732.3
NDAI0G033008.64ON81398732.7
CAGL0L05302g2.646ON544118714.0
SAKL0G15400g5.103ON54429714.2
NDAI0E012008.669ON49046714.8
KLTH0F17160g5.648ON696112715.4
ZYRO0F07216g8.669ON48844706.1
TPHA0G016208.669ON49249689.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1032.2
         (539 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...  1112   0.0  
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...   740   0.0  
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...   664   0.0  
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...   653   0.0  
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...   648   0.0  
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...   640   0.0  
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...   637   0.0  
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....   604   0.0  
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)   600   0.0  
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...   600   0.0  
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)   598   0.0  
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)   598   0.0  
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...   595   0.0  
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...   593   0.0  
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...   592   0.0  
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...   588   0.0  
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...   587   0.0  
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...   581   0.0  
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...   560   0.0  
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...   550   0.0  
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...    43   0.002
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...    42   0.003
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...    41   0.007
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...    41   0.007
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...    41   0.008
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...    41   0.009
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...    40   0.017
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...    39   0.022
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...    39   0.022
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...    39   0.027
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...    39   0.030
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...    39   0.041
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...    39   0.041
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...    39   0.043
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...    39   0.044
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...    39   0.046
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...    38   0.049
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...    38   0.063
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...    37   0.13 
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...    37   0.14 
Skud_11.44 Chr11 (87128..93283) [6156 bp, 2051 aa] {ON} YKL182W ...    35   0.56 
KNAG0B02710 Chr2 complement(522102..523532) [1431 bp, 476 aa] {O...    34   0.74 
Smik_11.48 Chr11 (86169..92324) [6156 bp, 2051 aa] {ON} YKL182W ...    34   1.1  
SAKL0H06732g Chr8 complement(592276..593763) [1488 bp, 495 aa] {...    33   1.4  
Kpol_1036.72 s1036 (196871..198649) [1779 bp, 592 aa] {ON} (1968...    33   1.8  
Kpol_292.3 s292 (6641..7651) [1011 bp, 336 aa] {ON} (6641..7651)...    33   2.3  
NDAI0G03300 Chr7 complement(773833..776274) [2442 bp, 813 aa] {O...    33   2.7  
CAGL0L05302g Chr12 complement(590178..591812) [1635 bp, 544 aa] ...    32   4.0  
SAKL0G15400g Chr7 (1325560..1327194) [1635 bp, 544 aa] {ON} simi...    32   4.2  
NDAI0E01200 Chr5 complement(238271..239743) [1473 bp, 490 aa] {O...    32   4.8  
KLTH0F17160g Chr6 (1391428..1393518) [2091 bp, 696 aa] {ON} simi...    32   5.4  
ZYRO0F07216g Chr6 (584726..586192) [1467 bp, 488 aa] {ON} simila...    32   6.1  
TPHA0G01620 Chr7 complement(334221..335699) [1479 bp, 492 aa] {O...    31   9.2  

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score = 1112 bits (2877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/539 (100%), Positives = 539/539 (100%)

Query: 1   MNSKLFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITA 60
           MNSKLFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITA
Sbjct: 1   MNSKLFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITA 60

Query: 61  SHNPPEDNGVKIVEPNGAMLDQSWEPMATELANIAANSTFDDLKAYVEEKVKKFSPESGS 120
           SHNPPEDNGVKIVEPNGAMLDQSWEPMATELANIAANSTFDDLKAYVEEKVKKFSPESGS
Sbjct: 61  SHNPPEDNGVKIVEPNGAMLDQSWEPMATELANIAANSTFDDLKAYVEEKVKKFSPESGS 120

Query: 121 KVQPVVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVKKSYA 180
           KVQPVVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVKKSYA
Sbjct: 121 KVQPVVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVKKSYA 180

Query: 181 VQESSYYNYFIESWNKITALHNITDLYCSSLTIDTANGIGGPKIQELLKSWPFASKVTLV 240
           VQESSYYNYFIESWNKITALHNITDLYCSSLTIDTANGIGGPKIQELLKSWPFASKVTLV
Sbjct: 181 VQESSYYNYFIESWNKITALHNITDLYCSSLTIDTANGIGGPKIQELLKSWPFASKVTLV 240

Query: 241 NNEWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRIVFYFQDQDKQF 300
           NNEWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRIVFYFQDQDKQF
Sbjct: 241 NNEWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRIVFYFQDQDKQF 300

Query: 301 HLLDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLNVPVSCAKT 360
           HLLDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLNVPVSCAKT
Sbjct: 301 HLLDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLNVPVSCAKT 360

Query: 361 GVKHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKELKANSESIAVNTLVALSHLI 420
           GVKHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKELKANSESIAVNTLVALSHLI
Sbjct: 361 GVKHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKELKANSESIAVNTLVALSHLI 420

Query: 421 NQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFITTDQERKLL 480
           NQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFITTDQERKLL
Sbjct: 421 NQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFITTDQERKLL 480

Query: 481 SPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALVTKLVKESV 539
           SPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALVTKLVKESV
Sbjct: 481 SPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALVTKLVKESV 539

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/540 (66%), Positives = 433/540 (80%), Gaps = 8/540 (1%)

Query: 5   LFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASHNP 64
           +FE  CTT++H+YVYGTAGFRD+A++L+TVM TTG++ACLRSI+L GKAVGVMITASHN 
Sbjct: 9   VFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMITASHNQ 68

Query: 65  PEDNGVKIVEPNGAMLDQSWEPMATELANIAA--NSTFDDLKAYVEEKVKKFSPESGSKV 122
           P DNGVKIVEP+G+MLDQSWEP ATELAN A+  +ST  + K Y++EK  ++  +SG  +
Sbjct: 69  PCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHST-QEFKLYLQEKFAQYKVDSG--I 125

Query: 123 QPVVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVKKSYA-V 181
            PV+VVGRDSR+SG  LL+CL + A   M  KII+YGLLTTPQLHFLTN IN  KS A V
Sbjct: 126 TPVLVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTTKSRAPV 185

Query: 182 QESSYYNYFIESWNKITALHNITDLYCSSLTIDTANGIGGPKIQELLKSWPFASKVTLVN 241
            E  YY++F+++W  ITALH I  L    L ID ANGIGGPK+ +L + WP A + TLVN
Sbjct: 186 TEDDYYSFFMDAWVSITALHGIKVLQSPRLYIDAANGIGGPKVSKLFEVWPQAGQFTLVN 245

Query: 242 NEWEKPDLLNKNCGADFVKTNQKLPNGV--SGNSTENDLYCSYDGDADRIVFYFQDQDKQ 299
           N W+ P LLN +CGAD+VKTNQ+LP  +  + +S    LYCS+DGDADRIVFY+QD    
Sbjct: 246 NHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGDADRIVFYYQDAQNS 305

Query: 300 FHLLDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLNVPVSCAK 359
           FHLLDGDKISTLFA  I+K L  A L  KIS+GVVQTAYANG+STNYL+  LN+PVSCAK
Sbjct: 306 FHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTNYLENVLNIPVSCAK 365

Query: 360 TGVKHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKELKANSESIAVNTLVALSHL 419
           TGVKHLHHEA+TNYD+G+YFEANGHGTI+FS+ F++ CE  LK N+ES+ V TL++ +HL
Sbjct: 366 TGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCESLLKENNESLEVKTLLSFAHL 425

Query: 420 INQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFITTDQERKL 479
           INQTVGDAISDMLGVL+VLSIMKL+   WD EYTDLPNLLTKV+VPDRS+F TTDQERKL
Sbjct: 426 INQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVPDRSLFTTTDQERKL 485

Query: 480 LSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALVTKLVKESV 539
           L+PEG Q+KID  ++++ NGRSFVRASGTEDAVRVYAEAS+ ++A  LN  V+K V  SV
Sbjct: 486 LTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAAALNEEVSKAVLASV 545

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score =  664 bits (1713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/534 (60%), Positives = 410/534 (76%), Gaps = 16/534 (2%)

Query: 5   LFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASHNP 64
           L E+YCTT+ ++YVYGTAGFRD++  L+TVMF TGIVACLRS  L GK VGVMITASHNP
Sbjct: 8   LIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMITASHNP 67

Query: 65  PEDNGVKIVEPNGAMLDQSWEPMATELANIAANSTFDDLKAYVEEKVKKFSPESG-SKVQ 123
             DNGVK+VEP+G+ML QSWE  ATELAN+ AN   +D+KA    KV + +  SG S V+
Sbjct: 68  SGDNGVKVVEPDGSMLIQSWESTATELANLLANRPLEDIKA----KVGQLT--SGESSVR 121

Query: 124 PVVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVKKSYAVQE 183
           P ++VGRDSR SG +LL CL+ASA +  +AKI +YGLLTTPQLHFLTNE  +  ++ V E
Sbjct: 122 PQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLTNETMITGAH-VDE 180

Query: 184 SSYYNYFIESWNKITALHNITDLYCSSLTIDTANGIGGPKIQELLKSWPFASKVTLVNNE 243
            +Y+ +F+ +W++I AL  +      ++ +D ANGIGGPK+  LL  W FA + +++N++
Sbjct: 181 QAYFAHFLGAWDQIAALQPVK---LPNVVVDCANGIGGPKMSALLTQWGFAKQCSVINDK 237

Query: 244 WEKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRIVFYFQDQDKQFHLL 303
            ++P+LLN  CGADFVKT+Q+LPNGV  N+  NDLYCS+DGDADR+VFY+ DQ+  FHLL
Sbjct: 238 CDEPELLNHGCGADFVKTSQRLPNGVKPNA--NDLYCSFDGDADRVVFYYLDQNLGFHLL 295

Query: 304 DGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLNVPVSCAKTGVK 363
           DGDKISTLFA  +AKLL    L+S +S+GVVQTAYANGSST YLQ  L VPVSC KTGVK
Sbjct: 296 DGDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDNLQVPVSCTKTGVK 355

Query: 364 HLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKELKANSESIAVNTLVALSHLINQT 423
           HLHHEAV NYDIG+YFEANGHGT++FS+ F++          E   +  L  L+ LINQT
Sbjct: 356 HLHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVTNHADQTPE---LKILKYLAKLINQT 412

Query: 424 VGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFITTDQERKLLSPE 483
           VGDAISDM+ VL+VLSI++ S  +WD E+TDLPN LTKV+V DRS F TTDQER+L+SP 
Sbjct: 413 VGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSAFTTTDQERRLVSPA 472

Query: 484 GLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALVTKLVKE 537
           GLQ KID+A++   +GRSFVRASGTEDAVRVYAEA++Q E  +L+++V  LV+E
Sbjct: 473 GLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSSIVGDLVRE 526

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/534 (60%), Positives = 408/534 (76%), Gaps = 22/534 (4%)

Query: 3   SKLFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASH 62
           + LF K C TK+H Y YGTAGFRD A+IL+TVMFTTG VACLRS+S  GKAVGVM+TASH
Sbjct: 11  TDLFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAVGVMVTASH 70

Query: 63  NPPEDNGVKIVEPNGAMLDQSWEPMATELANIAANSTFDDLKAYVEEKVKKFSPESGSKV 122
           NPP DNGVKIVEPNG+ML Q WEP+AT+LAN+A+    D+L  +V  K+     E  S  
Sbjct: 71  NPPVDNGVKIVEPNGSMLSQDWEPIATDLANLASQGKIDELVQFVNAKL----IELNSNK 126

Query: 123 QPVVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVKKSYAVQ 182
            P ++VGRDSRES + LLECL   +    +AKI++Y LLTTPQLHFLTN  N++K    +
Sbjct: 127 VPTLIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNAYNLEKDLP-K 185

Query: 183 ESSYYNYFIESWNKITALHN----ITDLYCSSLTIDTANGIGGPKIQELLKSWPFASKVT 238
           E+ YY++F  +W+++ +++N     T     SL ID+ANGIGGPK++ LLK W    KV 
Sbjct: 186 ETDYYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKMENLLKYWKTNYKVR 245

Query: 239 LVNNEWEKPDLLNKNCGADFVKTNQKLPNGVSGN----STENDLYCSYDGDADRIVFYFQ 294
           L+NN W++P+ LN NCGAD+VKTNQKLPNG++ +    S++N ++CS+DGDADR+VFY+Q
Sbjct: 246 LINNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNVIHCSFDGDADRVVFYYQ 305

Query: 295 D-QDKQFHLLDGDKISTLFAKLIAKLLNDANLN--SKISLGVVQTAYANGSSTNYLQGTL 351
           D Q   F+LLDGDKISTLFA  I+  L  A ++  ++I LGVVQTAYANGSSTNYLQ  L
Sbjct: 306 DPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQTAYANGSSTNYLQQNL 365

Query: 352 NVPVSCAKTGVKHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKELKANSES---- 407
            +PV+CAKTGVKHLHHEA T YDIGVYFEANGHGTIIFS++FY++  +++ A S+     
Sbjct: 366 KIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKIINQKINAESQIENTP 425

Query: 408 --IAVNTLVALSHLINQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVP 465
              A+ TL  LS LINQTVGDAISDM+GV++VL+I+  + Q W+ EYTDLPN L K++VP
Sbjct: 426 KLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKEYTDLPNKLAKLVVP 485

Query: 466 DRSVFITTDQERKLLSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEAS 519
           DRSVF TTDQERKL SP GLQSKI+K ++++ NGRSFVRASGTEDAVRVYAEAS
Sbjct: 486 DRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAVRVYAEAS 539

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/548 (58%), Positives = 403/548 (73%), Gaps = 18/548 (3%)

Query: 3   SKLFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASH 62
           +KL ++YC+  D  YVYGTAGFR  A+ L+TV+F TGI+ACLRS++L G  +GVM+TASH
Sbjct: 8   TKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIGVMVTASH 67

Query: 63  NPPEDNGVKIVEPNGAMLDQSWEPMATELANI---------AANSTFDDLKAYVEEKVKK 113
           NPP DNGVK+VEP+G+M+ +SWEP+ATELAN           A +T   L+  ++ +++ 
Sbjct: 68  NPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRELKGQLQS 127

Query: 114 FSPESGSKVQPVVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEI 173
            +      + P +VVGRDSRESG  LL CL+ASA+   +AKI + GLLTTPQLHFLT+E 
Sbjct: 128 ANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQLHFLTSE- 186

Query: 174 NVKKSYAVQESSYYNYFIESWNKITALHNITDLY--CSSLTIDTANGIGGPKIQELLKSW 231
             K    V ES YY +F+++W+ +  LH I +     SSLTID ANGIG PK+QELL  W
Sbjct: 187 TAKGVANVTESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPKVQELLSQW 246

Query: 232 PFASKVTLVNNEWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRIVF 291
               +V  +N++W  P+LLN  CGADFVK+NQ+ P G + ++    L CSYDGDADR+VF
Sbjct: 247 ACRGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGFNDST---GLGCSYDGDADRVVF 303

Query: 292 YFQDQDKQFHLLDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTL 351
           Y+ ++  +F LLDGD+IS LFA   A +L  A L S++SLGVVQTAYANG+ST YLQ TL
Sbjct: 304 YYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANGNSTEYLQKTL 363

Query: 352 NVPVSCAKTGVKHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKELKANSESIAVN 411
            VPVSCAKTGVKHLHHEAVT YDIG+YFEANGHGTIIFS  FY+V +++      S+AV 
Sbjct: 364 QVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVIKEQ---KERSVAVE 420

Query: 412 TLVALSHLINQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFI 471
           TL A S LINQTVGDAISDMLGVL+ LSI K + + W  E+TDLPN L KV+VPDRSVFI
Sbjct: 421 TLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNRLAKVVVPDRSVFI 480

Query: 472 TTDQERKLLSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALV 531
           TTDQER+L  PEGLQ KID+A+  F  GRSFVRASGTEDAVRVYAEA+S E+ ++L+  V
Sbjct: 481 TTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEAASLEDVEKLSNTV 540

Query: 532 TKLVKESV 539
            +LV +SV
Sbjct: 541 KELVVKSV 548

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/546 (58%), Positives = 401/546 (73%), Gaps = 18/546 (3%)

Query: 4   KLFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASHN 63
           +++   CTT+D+KY YGTAGFRD AS L+TVMF TGI+AC RS+ L G  VGVM+TASHN
Sbjct: 10  QVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPVGVMVTASHN 69

Query: 64  PPEDNGVKIVEPNGAMLDQSWEPMATELANIAANSTFDDLKAYVEE--KVKKFSPESGSK 121
           PP DNGVK+VEP GAML Q WEP+ T+LANIAAN +F+ +  ++ E  K  KF  +    
Sbjct: 70  PPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANESFEKVYDFILEVSKDPKFPFQEN-- 127

Query: 122 VQPVVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVKKSY-- 179
            +P +++G DSRES   L + L+ +A    NA I NYGL+TTPQLHF+T+  N K +   
Sbjct: 128 -KPSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSLWNAKYNKNT 186

Query: 180 --AVQESSYYNYFIESWNKITALHNITDLYC-SSLTIDTANGIGGPKIQELLKSWP--FA 234
              +   +YYNYF  SW+K   L++        +L ID+ANGIGGPK+ +L+ +WP    
Sbjct: 187 NDVISVDNYYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDLISTWPSTLR 246

Query: 235 SKVTLVNNEWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRIVFYF- 293
             V+++NN WE P+LLN +CGAD+VKTNQKLP G+   S  N L+CS+DGDADRIVFY+ 
Sbjct: 247 GNVSIINNSWENPNLLNNDCGADYVKTNQKLPKGIQNPSNLN-LHCSFDGDADRIVFYYI 305

Query: 294 QDQDKQFHLLDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLNV 353
            + D++FHLLDGDKI+TLFAK ++ LL + NL  K+ LGVVQTAYANGSSTNYL   L V
Sbjct: 306 SEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSSTNYLTNVLKV 365

Query: 354 PVSCAKTGVKHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKELKANSESIAVNTL 413
           PVSC KTGVKHLHHEA T YDIG+YFEANGHGT++FS+ F QV + E K    + A  TL
Sbjct: 366 PVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVLQNEPK----TTATQTL 421

Query: 414 VALSHLINQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFITT 473
           +    +INQTVGDA++DMLGV++VLS+ K++  QWD  Y DLPN L KVIVPDRSVFITT
Sbjct: 422 LLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKVIVPDRSVFITT 481

Query: 474 DQERKLLSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALVTK 533
           +QER+L SP GLQ KID A+S+ +NGRSFVRASGTEDAVRVYAEA++QEE ++L+  V K
Sbjct: 482 NQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQEETEKLSQEVCK 541

Query: 534 LVKESV 539
            V  SV
Sbjct: 542 FVLSSV 547

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/540 (58%), Positives = 403/540 (74%), Gaps = 9/540 (1%)

Query: 4   KLFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASHN 63
           +L++K+C T    Y YGTAGFR  A +L+TVMFTTGI+A +RSI L G+ VGVMITASHN
Sbjct: 9   ELYDKHCKT-GFTYTYGTAGFRYKADVLDTVMFTTGILAAIRSIYLKGQYVGVMITASHN 67

Query: 64  PPEDNGVKIVEPNGAMLDQSWEPMATELANIAANSTFDDLKAYVEEKVKKFSPESGSKVQ 123
           PP+DNGVKIV+P G MLDQ+WEP ATELAN A+    + +KA +++ + K   +     +
Sbjct: 68  PPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGKQELIKA-LDKLITKLGIDDTESAK 126

Query: 124 PVVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVKKSYAVQE 183
             + + RDSRESG  LL+ ++   +   N +++++ LLTTPQLHFLT + N   S  V+E
Sbjct: 127 --ITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYNQGSSSKVEE 184

Query: 184 SSYYNYFIESWNKITALHNITDLYCSSLTIDTANGIGGPKIQE-LLKSWPFASKVTLVNN 242
           S+YY+ F  +W KI  LH+I  L    + ID ANGIGGPK+ E LLK+  F+S V+++NN
Sbjct: 185 STYYSAFSSAWTKICGLHDINSL-PYRVIIDAANGIGGPKVSEMLLKNKFFSSTVSVINN 243

Query: 243 EWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRIVFYFQDQDKQFHL 302
           +W+ P+LLN++CGAD+VKTNQ  P GVSGNS    +YCS+DGDADRIVFY+ D+  +F+L
Sbjct: 244 QWQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFDGDADRIVFYYHDEKSKFNL 303

Query: 303 LDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLNVPVSCAKTGV 362
           LDGDKISTLFAK   +LL  A   +++ LGVVQTAYANGSST YL   L VPVSC  TGV
Sbjct: 304 LDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTEYLSSILEVPVSCTATGV 363

Query: 363 KHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKELKANSE---SIAVNTLVALSHL 419
           KHLHHEA+ NYDIG+YFEANGHGT+IFSD F++  +K+LK   +   + A+ TL   ++L
Sbjct: 364 KHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKEPQDEKTAKALKTLYLFTNL 423

Query: 420 INQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFITTDQERKL 479
           INQTVGDAISDML VL+VL I+K S Q+WD EYTDLPN L KVIVPDRSVF T++ ER+L
Sbjct: 424 INQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKVIVPDRSVFKTSNAERQL 483

Query: 480 LSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALVTKLVKESV 539
           +SP+GLQ KID  + EF +GRSFVRASGTEDAVRVYAEA+++E+A  L A V+ LV  SV
Sbjct: 484 VSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKEKADRLAASVSDLVSRSV 543

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/546 (57%), Positives = 393/546 (71%), Gaps = 15/546 (2%)

Query: 6   FEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISL----GGKAVGVMITAS 61
           F + C TK++ Y YGTAGFRDNA  L+TVMFTTGIVACLRS++L       A+GVM+TAS
Sbjct: 16  FNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNKHSAIGVMVTAS 75

Query: 62  HNPPEDNGVKIVEPNGAMLDQSWEPMATELANIAANSTFDDLKAYVEEKVKKFSPESGSK 121
           HNPPEDNGVKI+EPNG+ML Q WEP AT+ ANIAAN +FD+    + + +     +   K
Sbjct: 76  HNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANESFDEFYQLLIDSIVTLENDLNIK 135

Query: 122 VQPVVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVKKSYAV 181
             P +++G DSR+S   L+  ++ SA    NAKIINY  +TTPQLHFLTN      +   
Sbjct: 136 QPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHFLTNL--TNTTGTA 193

Query: 182 QESSYYNYFIESWNKITALHNITDLYCSSLTIDTANGIGGPKIQELL----KSWPFASK- 236
           +E +YY++F +  +++ +L+   +L   +L ID ANGIG P++++LL    K  P   K 
Sbjct: 194 EEINYYDHFNKYLSQLQSLYPPFNLPFDNLIIDAANGIGAPQVEKLLFTKNKFPPLNIKN 253

Query: 237 -VTLVNNEWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTEND-LYCSYDGDADRIVFYFQ 294
            + ++NN+ + P+LLN NCGAD+VKTNQKLP G+  +   N  L+CSYDGDADRIVFY+ 
Sbjct: 254 PIKIINNDSKNPNLLNMNCGADYVKTNQKLPQGIPKDIDANSTLFCSYDGDADRIVFYYI 313

Query: 295 D-QDKQFHLLDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLNV 353
           D     F+LLDGDKI+TLFAK  + LL  A LN  + LGVVQTAYANGSSTNY+   L V
Sbjct: 314 DPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQTAYANGSSTNYISSKLKV 373

Query: 354 PVSCAKTGVKHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKELKANSESIAVNTL 413
           PVSC KTGVKHLHHEA+T YDIG+YFEANGHGT+IFSD F+    K LK +  S  + TL
Sbjct: 374 PVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFHSELTK-LKESGSSREIKTL 432

Query: 414 VALSHLINQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFITT 473
           +  S LINQTVGDA+SDML V++VLSI++LS   WD EY DLPN L KVIVPDRS FITT
Sbjct: 433 LLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLPNKLAKVIVPDRSKFITT 492

Query: 474 DQERKLLSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALVTK 533
           DQERKL+ P+GLQ  +++A++  S GRSFVRASGTEDAVRVYAEA +QEE + L+  V +
Sbjct: 493 DQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYAEAKTQEETEWLSKKVCQ 552

Query: 534 LVKESV 539
           LV ESV
Sbjct: 553 LVIESV 558

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/551 (55%), Positives = 395/551 (71%), Gaps = 18/551 (3%)

Query: 4   KLFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASHN 63
           KL+++ C TK+ +Y YGTAGFR  A  L+TVMFTTGI+A LRS+ L G+ VGVMITASHN
Sbjct: 10  KLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMITASHN 69

Query: 64  PPEDNGVKIVEPNGAMLDQSWEPMATELANIAANSTFDDLKAYVEEKVKKFSPE----SG 119
           P +DNGVKIVEP+G+ML  SWEP A +LAN A+ +T    + +  E VK    E      
Sbjct: 70  PYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFAT--HFEEFYAELVKLIELEKIDLGA 127

Query: 120 SKVQPVVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVKKS- 178
           S V P +VVGRDSRES  YLL CL ++  +  +A++++ G +TTPQLH++T+  N ++  
Sbjct: 128 SNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDLSNRRERE 187

Query: 179 -----YAVQESSYYNYFIESWNKITALHNITD-LYCSSLTIDTANGIGGPKIQELL--KS 230
                 A  E  YY++FI ++N++   +++   L    L IDTANGIGGP++++LL  K 
Sbjct: 188 GDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVPKLFIDTANGIGGPQLKKLLASKD 247

Query: 231 WPFAS-KVTLVNNEWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRI 289
           W   S ++ ++N++ + P LLN  CGAD+VKTNQ+LP G+S +S E+ LYCS+DGDADR+
Sbjct: 248 WVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSSFES-LYCSFDGDADRV 306

Query: 290 VFYFQDQDKQFHLLDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQG 349
           VFY+ D + +FHLLDGDKISTLFAK ++K L  ANL   + +GVVQTAYANGSST Y++ 
Sbjct: 307 VFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGSSTAYIKD 366

Query: 350 TLNVPVSCAKTGVKHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKEL-KANSESI 408
           TL+ PVSC KTGVKHLHHEA T YDIG+YFEANGHGTIIFS+ F+Q  E EL K N  ++
Sbjct: 367 TLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESELSKPNGHTL 426

Query: 409 AVNTLVALSHLINQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRS 468
           A+ TL   + LINQTVGDA+SDML VL+ L+I+K++   WD EY DLPN L K IVPDRS
Sbjct: 427 ALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKLVKCIVPDRS 486

Query: 469 VFITTDQERKLLSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELN 528
           +F TTDQERKL +P GLQSKID  I+++  GRSFVRASGTEDAVRVYAE     +  +  
Sbjct: 487 IFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAECQDMSKLDQFC 546

Query: 529 ALVTKLVKESV 539
             +   VK SV
Sbjct: 547 NEIVGYVKASV 557

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/542 (54%), Positives = 393/542 (72%), Gaps = 14/542 (2%)

Query: 3   SKLFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASH 62
           SKL++K+C ++  KY+YGTAGFR  A IL+TV+FTTG++ACLRS+ L G+ VG MITASH
Sbjct: 8   SKLYDKHCCSR-FKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMITASH 66

Query: 63  NPPEDNGVKIVEPNGAMLDQSWEPMATELANIAANSTFDDLKAYVEEKVKKFSPESGSKV 122
           NPP+DNGVK+V+P G ML Q WE  ATELAN A++     L   ++E + +F  ++ S+ 
Sbjct: 67  NPPQDNGVKLVDPKGEMLKQEWEVYATELANCASDGKHQFLHR-LQELMNQFGIKADSEA 125

Query: 123 QPVVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVK----KS 178
           +  +VV RDSRESGS LL+ L+     + N  I++Y +LTTPQLHFLT  +N +    + 
Sbjct: 126 R--IVVARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNRQMESERV 183

Query: 179 YAVQESSYYNYFIESWNKITALHNITDLYCSSLTIDTANGIGGPKIQEL-LKSWPFASKV 237
             V E+ YY++F+ +  ++T L NI  L    L ID ANG+GG K +EL +K+  F    
Sbjct: 184 IEVNEAFYYSHFLSALKELTELFNIPGL-PYPLVIDAANGVGGAKAEELFMKNTFFKDST 242

Query: 238 TLVNNEWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRIVFYFQDQD 297
           T++N  W + DLLN  CGAD+VKTNQ LP G+S  +  N L+CS+DGDADR++FY++D D
Sbjct: 243 TIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDADRVIFYYRDVD 302

Query: 298 KQFHLLDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLNVPVSC 357
             FHLLDGDKISTLFAK    +L  A +   + LGVVQTAYANGSST YL   L VPVSC
Sbjct: 303 GMFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYLSEVLIVPVSC 362

Query: 358 AKTGVKHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKELKANSES----IAVNTL 413
             TGVK+LH +AV NYD+G+YFEANGHGT+IFS++F     K LK  S S    +A+ TL
Sbjct: 363 TPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSLSAESKMALKTL 422

Query: 414 VALSHLINQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFITT 473
            + S LINQTVGDA+SDM+ VL+VL I+K + QQWD EYTDLPN L KV+VPDRS+F TT
Sbjct: 423 QSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVVVPDRSLFKTT 482

Query: 474 DQERKLLSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALVTK 533
           + ER+L+SP+GLQ++IDK I  + N RSFVRASGTEDAVR+YAEA+++E+A +L+  +++
Sbjct: 483 NAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKEQADDLSIKISQ 542

Query: 534 LV 535
           LV
Sbjct: 543 LV 544

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/548 (56%), Positives = 394/548 (71%), Gaps = 16/548 (2%)

Query: 4   KLFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASHN 63
           KL+E+ C TK+ +Y YGTAGFR  A  L+TVMFTTGI+A LRS+ L G+ VGVMITASHN
Sbjct: 10  KLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMITASHN 69

Query: 64  PPEDNGVKIVEPNGAMLDQSWEPMATELANIAA-NSTFDDLKAYVEEKVKKFSPES-GSK 121
           P +DNGVKIVEP+G+ML  +WEP A +LAN A+  +TFD+  A   E VK    E     
Sbjct: 70  PYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYA---ELVKLIEHEKIDLD 126

Query: 122 VQPVVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVKK---- 177
             P VVVGRDSRES  +LL CL ++  +  +A +++ G +TTPQLH++TN  N ++    
Sbjct: 127 AAPHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNLSNKRQREGG 186

Query: 178 -SYAVQESSYYNYFIESWNKITALHNITD-LYCSSLTIDTANGIGGPKIQELL--KSWPF 233
            +    E  YY++FI ++N++     I   L    L +DTANGIGGP++++LL  K W  
Sbjct: 187 SAQVATEQDYYSFFINAFNELFTTCQIEKRLSVPKLFVDTANGIGGPQLKKLLASKDWAV 246

Query: 234 AS-KVTLVNNEWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRIVFY 292
            S ++ +VN++ + P LLN  CGAD+VKTNQ+LP G+S +S ++ LYCS+DGDADR+VFY
Sbjct: 247 PSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSPDS-LYCSFDGDADRVVFY 305

Query: 293 FQDQDKQFHLLDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLN 352
           + D + +FHLLDGDKISTLFAK ++K L  ANL   + +GVVQTAYANGSST+Y++ TL+
Sbjct: 306 YVDPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSSTSYIKDTLH 365

Query: 353 VPVSCAKTGVKHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKEL-KANSESIAVN 411
            PVSC KTGVKHLHHEA T YDIG+YFEANGHGTIIFS  F+Q  E EL +A    +A+N
Sbjct: 366 CPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELSRAQGSLLALN 425

Query: 412 TLVALSHLINQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFI 471
           TL   ++LINQTVGDAISDML VL+ LSI+ ++   WD EYTDLPN L K IVPDRS+F 
Sbjct: 426 TLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKCIVPDRSIFQ 485

Query: 472 TTDQERKLLSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALV 531
           TTDQERKL +P GLQ+KID  I +++ GRSFVRASGTEDAVRVYAE     +  +    V
Sbjct: 486 TTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPTKLDQFCNEV 545

Query: 532 TKLVKESV 539
            + VK SV
Sbjct: 546 VEYVKSSV 553

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/547 (54%), Positives = 398/547 (72%), Gaps = 12/547 (2%)

Query: 3   SKLFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASH 62
           S+L++K C TK+ +Y YGTAGFR  A  L+TVMFTTGI+A LRS+ L G+ VGVMITASH
Sbjct: 9   SELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMITASH 68

Query: 63  NPPEDNGVKIVEPNGAMLDQSWEPMATELANIAA-NSTFDDLKAYVEEKVKKFSPESGSK 121
           NP +DNGVKIVEP+G+ML  +WEP A +LAN A+  S F++ +A +   ++       + 
Sbjct: 69  NPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEKIGLDTS 128

Query: 122 VQPVVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVKK---- 177
           + P +VVGRDSRES  YLL CL ++  +  +A++++ G +TTPQLH++T+  N ++    
Sbjct: 129 IVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLSNKREREGG 188

Query: 178 -SYAVQESSYYNYFIESWNKITALHNITD-LYCSSLTIDTANGIGGPKIQELL--KSWPF 233
            +    E  YY++FI ++N++ + + I   L    L ID ANGIGGP++++LL  K W  
Sbjct: 189 SAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKLLTSKDWVV 248

Query: 234 A-SKVTLVNNEWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRIVFY 292
              ++ ++N++ + P+LLN  CGAD+VKTNQ+LP G+S  S+ + LYCS+DGDADR+VFY
Sbjct: 249 PPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSP-SSHDSLYCSFDGDADRVVFY 307

Query: 293 FQDQDKQFHLLDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLN 352
           + D + QFHLLDGDKISTLFAK ++K L  A+L + + +GVVQTAYANGSSTNY++ TL 
Sbjct: 308 YVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTNYIENTLR 367

Query: 353 VPVSCAKTGVKHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKEL-KANSESIAVN 411
            PVSC KTGVKHLHHEA T YDIG+YFEANGHGTIIFS+ F+QV + EL +A  + +A+ 
Sbjct: 368 CPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRARGDMLALK 427

Query: 412 TLVALSHLINQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFI 471
           TL   S LINQTVGDA+SDML VL+ L+IMK++   WD EYTDLPN L K IVPDRS+F 
Sbjct: 428 TLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCIVPDRSIFQ 487

Query: 472 TTDQERKLLSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALV 531
           T DQERKL +P GLQ+KID  I+++  GRSFVRASGTEDAVR+YAE     +  +    +
Sbjct: 488 TIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQLDQFCNEI 547

Query: 532 TKLVKES 538
            +LVK S
Sbjct: 548 VELVKAS 554

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/548 (54%), Positives = 398/548 (72%), Gaps = 14/548 (2%)

Query: 4   KLFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASHN 63
           KL++  C TK+ ++ YGTAGFR  A  L+TVMF+TGI+A LRS+ L G+ VGVMITASHN
Sbjct: 10  KLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGVMITASHN 69

Query: 64  PPEDNGVKIVEPNGAMLDQSWEPMATELANIAANST-FDDLKAYVEEKVKKFSPESGSKV 122
           P +DNGVKIVEP+G+ML  +WEP A +LAN A+ +T F++ +  + + ++    +  + V
Sbjct: 70  PYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEHEKIDLNTTV 129

Query: 123 QPVVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVKK----- 177
            P +VVGRDSRES  YLL CL +S  +  +A++++ G +TTPQLH++T+  N +K     
Sbjct: 130 VPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLSNRRKLEGDT 189

Query: 178 SYAVQESSYYNYFIESWNKITALHNITD-LYCSSLTIDTANGIGGPKIQELLKS--WPF- 233
           +    E  YY++FI ++N++ A + +   L    L IDTANGIGGP++++LL S  W   
Sbjct: 190 APVATEQDYYSFFIGAFNELFATYQLEKRLSVPKLFIDTANGIGGPQLKKLLASEDWDVP 249

Query: 234 ASKVTLVNNEWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRIVFYF 293
           A +V ++N+  + P+LLN  CGAD+VKTNQ+LP G+S +S ++ LYCS+DGDADR+VFY+
Sbjct: 250 AEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSFDS-LYCSFDGDADRVVFYY 308

Query: 294 QDQDKQFHLLDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLNV 353
            D   +FHLLDGDKISTLFAK ++K L  A+L   + +GVVQTAYANGSST Y++ TL+ 
Sbjct: 309 VDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSSTAYIKNTLHC 368

Query: 354 PVSCAKTGVKHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKEL---KANSESIAV 410
           PVSC KTGVKHLHHEA T YDIG+YFEANGHGTIIFS+ F++  + EL   K N +++A+
Sbjct: 369 PVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSKSKLNGDTLAL 428

Query: 411 NTLVALSHLINQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVF 470
            TL   S LINQTVGDAISDML VL+ L+I+K+S   WD EYTDLPN L K IVPDRS+F
Sbjct: 429 RTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLVKCIVPDRSIF 488

Query: 471 ITTDQERKLLSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNAL 530
            TTDQERKLL+P GLQ KID  ++++  GRSFVRASGTEDAVRVYAE     +  +    
Sbjct: 489 QTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAECKDSSKLGQFCDE 548

Query: 531 VTKLVKES 538
           V + VK S
Sbjct: 549 VVEHVKAS 556

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/538 (54%), Positives = 392/538 (72%), Gaps = 13/538 (2%)

Query: 6   FEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASHNPP 65
           F KYCTT++H Y YGTAGFR NAS L+TVMFTTGIVA LRS+ L GK +GVMITASHNPP
Sbjct: 11  FIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIGVMITASHNPP 70

Query: 66  EDNGVKIVEPNGAMLDQSWEPMATELANIAANSTFDDLKAYVEEKVKKFSPESGSKVQPV 125
           +DNGVKIVEP+GAML +SWE +AT+LANIA++  F     ++ + + K + +  +   P 
Sbjct: 71  QDNGVKIVEPSGAMLIESWEQIATDLANIASHGNFTAFVMHLSQVIAKLNIDETTT--PR 128

Query: 126 VVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVKKSYAVQESS 185
           ++VG DSRES  YL+ECL A+A  + +  +IN+ L+TTPQLH+LT    + ++  V E  
Sbjct: 129 LIVGHDSRESSPYLMECLQAAAPVF-DTIVINHTLITTPQLHYLT----MLQNDVVTEVD 183

Query: 186 YYNYFIESWNKITALHNITDLYCSSLTIDTANGIGGPKIQELLKSWP-FASKVTLVNNEW 244
           YY +F  SWN + +L+   +L  ++L +D ANG+G  +  + L   P  A+  T++N++ 
Sbjct: 184 YYKFFSTSWNNLFSLYPDLNLTFNNLIVDGANGVGSVQFSKFLPYLPQLATLTTIINDKH 243

Query: 245 EKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRIVFYFQDQDKQFHLLD 304
             P +LN +CGADFVKTNQKLPNG+  N   +DLY S+DGDADRIVFY+ D +K+FHLLD
Sbjct: 244 NVPQMLNVDCGADFVKTNQKLPNGIV-NPNPSDLYASFDGDADRIVFYYVDNNKKFHLLD 302

Query: 305 GDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLNVPVSCAKTGVKH 364
           GDKIST+  K +  +L ++ L + I+LGVVQTAYANGSST Y+  +L VPV C KTGVKH
Sbjct: 303 GDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKYITKSLKVPVECTKTGVKH 362

Query: 365 LHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKELKANSESIAVN----TLVALSHLI 420
           LHH A + +DIG+YFEANGHGT++FS+ FY+V +K +   S S  ++    +L   S LI
Sbjct: 363 LHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSSSEKIHKARLSLFYFSKLI 422

Query: 421 NQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFITTDQERKLL 480
           NQTVGD+++D+L V++ LSI++LS   WD EY DLPNLLTK  V +R VF TTD ERKL 
Sbjct: 423 NQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCTVLNRFVFKTTDMERKLT 482

Query: 481 SPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALVTKLVKES 538
           SP GLQ KID A+S++ +GRSFVRASGTEDAVR+YAEA ++ E + L+  VT+LV+ S
Sbjct: 483 SPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEVEALSKEVTQLVENS 540

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/537 (56%), Positives = 380/537 (70%), Gaps = 12/537 (2%)

Query: 5   LFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASHNP 64
           L+E +C+T  H Y YGTAGFR  A +L+TVMFTTG+VA LRSI L GK VGVMITASHNP
Sbjct: 10  LYEAHCSTGFH-YAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGVMITASHNP 68

Query: 65  PEDNGVKIVEPNGAMLDQSWEPMATELANIAANSTFDDLKAYVEEKVKKFSPESGSKVQP 124
           PEDNGVKIV+P G ML+QSWE  AT+LAN +A+  F +  A VE  + K   E GS    
Sbjct: 69  PEDNGVKIVDPKGEMLEQSWEVYATDLAN-SASQGFSEFVASVERLMTKL--EVGSNDHG 125

Query: 125 VVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEIN-VKKSYAVQE 183
            +VV RDSRESG  LL   L+  +   N K+ ++GLLTTPQLHFLT++ N + K   + +
Sbjct: 126 SIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSNELPKGTEIGK 185

Query: 184 SSYYNYFIESWNKITALHNITDLYCSSLTIDTANGIGGPKIQELLKSWPF-ASKVTLVNN 242
           S YY+ F+ +W +I  L  I  L    L ID ANGIG P + E+L    F      +VN+
Sbjct: 186 SLYYDNFLSAWVEIAELCKIDSL-PYKLEIDAANGIGAPVVTEMLSQHKFFKGAFAVVND 244

Query: 243 EWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRIVFYFQDQDKQFHL 302
           EWE PD LN  CGADFVKTNQKLP+G++     N + CS+DGDADRIVFY+  ++  FHL
Sbjct: 245 EWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCSFDGDADRIVFYYCGKNGDFHL 304

Query: 303 LDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLNVPVSCAKTGV 362
           LDGDK++TLFAK   +LL DA L  ++ LGVVQTAYANGSST Y++  L + V+C  TGV
Sbjct: 305 LDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTAYIEQVLGISVTCTPTGV 364

Query: 363 KHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKELKANSESIAVNTLVALSH---- 418
           KHLHHEAV  YDIGVYFEANGHGT++FS  F  V +++L    ES A    + + H    
Sbjct: 365 KHLHHEAV-KYDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKLESDAAQKSLKVLHLFAK 423

Query: 419 LINQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFITTDQERK 478
           LINQTVGDAISDML VL+VLSI+K S ++WD EYTDLPN L KV+VPDR+VF T + ER+
Sbjct: 424 LINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIKVLVPDRTVFKTKNAERQ 483

Query: 479 LLSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALVTKLV 535
           L+SP G+Q KID  ++ FS GRSFVRASGTEDAVRVYAEA++ +E + L+  V KL+
Sbjct: 484 LVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATPQETEALSQQVEKLL 540

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score =  588 bits (1517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/552 (56%), Positives = 382/552 (69%), Gaps = 27/552 (4%)

Query: 1   MNSKLFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITA 60
           M+ +L+ K C T+D  Y YGTAGFR +A IL++VMFTTG++A LRSIS     VGVMITA
Sbjct: 1   MSLQLYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITA 60

Query: 61  SHNPPEDNGVKIVEPNGAMLDQSWEPMATELAN-IAANSTFDD-LKAYVEEKVKKFSPES 118
           SHNPP DNGVKIVE +G+ML Q WEP+AT LAN +A   TF+  L A ++E     SP  
Sbjct: 61  SHNPPRDNGVKIVESDGSMLLQDWEPLATRLANSVADYHTFESTLNAIMQEL--NISPGH 118

Query: 119 GSKVQPVVVVGRDSRESGSYLLECLLASAENYM-NAKIINYGLLTTPQLHFLTNEINVKK 177
                P +VVG DSRES   LL  LL   +    +A+I N+GLLTTPQLHFLT       
Sbjct: 119 A----PQIVVGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLT------A 168

Query: 178 SYAVQESSYYNYFIESWNKITALHNITDLYC-SSLTIDTANGIGGPKIQELLK----SWP 232
           + A  E  YY YF+++WN++  L+ I        L IDTANGIGGP+  ++L       P
Sbjct: 169 NPAHFEDYYYRYFLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTDLP 228

Query: 233 FASKVTL-----VNNEWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDAD 287
              K+ L      NN W  P +LN  CGADFVKTNQ+LP G+  N+   +LYCS+DGDAD
Sbjct: 229 HLQKIRLHQIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGI--NADPRNLYCSFDGDAD 286

Query: 288 RIVFYFQDQDKQFHLLDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYL 347
           R+VFY+ D    FHLLDGDKISTL A  I  LL +A L  ++ LGVVQTAYANGSST Y+
Sbjct: 287 RVVFYYVDDSLTFHLLDGDKISTLLAYFINALLKEAGLAEELKLGVVQTAYANGSSTTYV 346

Query: 348 QGTLNVPVSCAKTGVKHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKELKANSES 407
              L VPVS AKTGVKHLHHEAVTNYDIGVYFEANGHGT+IFS HFY+V E  L  N+  
Sbjct: 347 TKKLQVPVSIAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAKNAHD 406

Query: 408 IAVNTLVALSHLINQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDR 467
            +  TL  LS LINQT+GDAISDML +++VL I+  S   WD+EYTDLPN LTKV+VPDR
Sbjct: 407 KSTLTLRLLSRLINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVPDR 466

Query: 468 SVFITTDQERKLLSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKEL 527
           S+FITTDQER+L+SP GLQ KID  +++   GRSF+RASGTEDAVRVYAEA + E  ++L
Sbjct: 467 SIFITTDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATEKL 526

Query: 528 NALVTKLVKESV 539
           +  VT  + E+V
Sbjct: 527 STEVTDALIETV 538

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/539 (55%), Positives = 387/539 (71%), Gaps = 12/539 (2%)

Query: 5   LFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASHNP 64
           L+E +C +    Y YGTAGFR  A +L+TVMFTTG++A LRSI L G+ VGVMITASHNP
Sbjct: 10  LYETHCKSG-FTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGVMITASHNP 68

Query: 65  PEDNGVKIVEPNGAMLDQSWEPMATELANIAANSTFDDLKAYVEEKVKKFSPESGSKVQP 124
           PEDNGVKIV+P G ML+QSWE  AT+LAN +A  +F    AY++  V +   ++ +    
Sbjct: 69  PEDNGVKIVDPKGEMLEQSWESYATDLAN-SATQSFTAFLAYLQNLVSELGLDTDALGS- 126

Query: 125 VVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEIN-VKKSYAVQE 183
            + V RDSRESG  LL  LL  +    N +I +YGLLTTPQLHFLT++ N +    A+  
Sbjct: 127 -LAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLTSKRNELPNDTAIDR 185

Query: 184 SSYYNYFIESWNKITALHNITDLYCSSLTIDTANGIGGPKIQELLKSWPFASKV-TLVNN 242
             YY  F+ +W+ ITAL  I  L    L ID ANGIG P+++E+L +  F   V  +VN+
Sbjct: 186 FFYYKEFLSAWDDITALCGIQSL-PYKLEIDAANGIGAPRVKEMLSTHKFFDGVFRVVND 244

Query: 243 EWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRIVFYFQDQDKQFHL 302
           +WE P  LN  CGAD+VKTNQ+LP G+  N+    + CS+DGDADRIVFYF D + QF L
Sbjct: 245 DWETPASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSFDGDADRIVFYFCDSEGQFRL 304

Query: 303 LDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLNVPVSCAKTGV 362
           LDGDK++TLFAK    +L+ ANL  ++SLGVVQTAYANGSST+Y++  L +PV+C  TGV
Sbjct: 305 LDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTHYIERVLGIPVTCTPTGV 364

Query: 363 KHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKEL----KANSESIAVNTLVALSH 418
           KHLHHEA+ NYDIGVYFEANGHGT++FS  F +V    L    +++S   ++  L   ++
Sbjct: 365 KHLHHEAI-NYDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKHQSDSSLQSLEVLSKFAN 423

Query: 419 LINQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFITTDQERK 478
           LINQTVGDAISDM+GVL+VLSI+K + Q+W+ EYTDLPN L KV+VPDR+VF TT+ ER+
Sbjct: 424 LINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVKVLVPDRTVFKTTNAERQ 483

Query: 479 LLSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALVTKLVKE 537
           LLSP GLQ KI+  ++E+   RSFVRASGTEDAVRVYAEAS++EEA  L + V+++V+ 
Sbjct: 484 LLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTREEADSLASRVSQVVEH 542

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/540 (56%), Positives = 388/540 (71%), Gaps = 15/540 (2%)

Query: 5   LFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASHNP 64
           L+E+YC  + H Y YGTAGFR + S+L+TVMFTTGIVA LRSI L  K VGVMITASHNP
Sbjct: 6   LYEQYCK-QGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASHNP 64

Query: 65  PEDNGVKIVEPNGAMLDQSWEPMATELANIAANSTFDDLKAYVEEKVKKFSPESGSKVQP 124
           PEDNGVK+VEP G ML Q+WEP+AT+LAN AA+S+F  L++ ++  + + + ++      
Sbjct: 65  PEDNGVKVVEPYGEMLVQNWEPIATKLAN-AASSSFTQLESTLQSIIAELNIDTTQLAN- 122

Query: 125 VVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVK-KSYAVQE 183
            + V RDSRESG  LL  L A    +   KII++ LLTTPQLHFL   +N   +   V++
Sbjct: 123 -ITVARDSRESGPRLLAALKAGISVFPAVKIIDFELLTTPQLHFLVYSLNTSSQPSQVRD 181

Query: 184 SSYYNYFIESWNKITALHNITDLYCSSLTIDTANGIGGPKIQELLKS--WPFASKVTLVN 241
           S+YY++F+  WN++T L+ +T+L    LTID ANGIG  K+++L+        + +T VN
Sbjct: 182 STYYDHFVSIWNQLTQLYEVTEL-PFHLTIDCANGIGADKVKQLISQAGHMLENSLTAVN 240

Query: 242 NEWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRIVFYFQD-QDKQF 300
            E +   LLN++CGADFVKTNQ  P   + N   + LYCS+DGDADR+VFY+ D ++ +F
Sbjct: 241 GETKTFQLLNESCGADFVKTNQTFP--ANCNPKPSQLYCSFDGDADRVVFYYVDGKENKF 298

Query: 301 HLLDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLNVPVSCAKT 360
           HLLDGDKI+TL AKLIA LL D  L+  + LGVVQTAYANGSST Y+   L +PVSC KT
Sbjct: 299 HLLDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDKLKIPVSCTKT 358

Query: 361 GVKHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKELKANS----ESIAVNTLVAL 416
           GVKHLHHEAV+ YDIG+YFEANGHGT+IFS  F +  +  L+  S    +  ++ +L  L
Sbjct: 359 GVKHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNEQQYKSLLSLKLL 418

Query: 417 SHLINQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFITTDQE 476
           S LINQTVGDAISDML V++ LSI  L  + WD  Y DLPN LTKVIVPDRSVF++T+ E
Sbjct: 419 SQLINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIVPDRSVFVSTNAE 478

Query: 477 RKLLSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALVTKLVK 536
           R+LLSPEGLQ+KID  +++F N RSFVRASGTEDAVRVYAEA + E A EL   V +LVK
Sbjct: 479 RQLLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESAIELATKVGELVK 538

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/528 (52%), Positives = 367/528 (69%), Gaps = 10/528 (1%)

Query: 17  YVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASHNPPEDNGVKIVEPN 76
           Y YGTAGFR  A +L  V+F TG++ACLRS+ LGG  VGVM+TASHNPPEDNGVK+V+P+
Sbjct: 21  YAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGVMLTASHNPPEDNGVKLVDPH 80

Query: 77  GAMLDQSWEPMATELANIAANSTFDDLKAYVEEKVKKFSPESGSKVQPVVVVGRDSRESG 136
           G ML   WE  AT LAN A+    + L A +   V +   +   + +  VVV RDSR SG
Sbjct: 81  GEMLAAEWEKHATALANCASQGQQELLDA-LHMLVDRLGLDLALRAR--VVVARDSRASG 137

Query: 137 SYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVKKSYA-VQESSYYNYFIESWN 195
             LL+ LL       + ++++ G+LTTPQLHFLT   N + S A V+E  YY +F+ +  
Sbjct: 138 PQLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNERGSAAGVREDLYYAHFVAALE 197

Query: 196 KITALHNITDLYCSSLTIDTANGIGGPKIQELLKSWP-FASKVTLVNNEWEKPDLLNKNC 254
           ++ ALH +  L    L +DTANG+G  K +EL +  P F ++V+++N+ W + +LLN  C
Sbjct: 198 ELAALHGLETLP-FPLVVDTANGVGALKARELFRRSPLFKNRVSIINDNWSQHELLNSGC 256

Query: 255 GADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRIVFYFQDQDKQFHLLDGDKISTLFAK 314
           GAD+VKT Q LP G+S +     L+CSYDGDADR++FY+ D  ++FHLLDGDKISTL AK
Sbjct: 257 GADYVKTKQCLPQGISADLLRESLFCSYDGDADRVIFYYIDGQERFHLLDGDKISTLIAK 316

Query: 315 LIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLNVPVSCAKTGVKHLHHEAVTNYD 374
            +   L  A +N  + LGVVQTAYANGSST YL   L VPVSC  TGVKHLH EAV  YD
Sbjct: 317 FLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSEVLEVPVSCTPTGVKHLHREAVQKYD 376

Query: 375 IGVYFEANGHGTIIFSDHFYQVCEKELKANSES----IAVNTLVALSHLINQTVGDAISD 430
           +G+YFEANGHGT+IFS+HF    E+ L+  + S    +++ TL   ++LINQT+GDAI+D
Sbjct: 377 VGIYFEANGHGTVIFSEHFTLTVERALENPALSAKARLSLQTLKTFANLINQTIGDAIAD 436

Query: 431 MLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFITTDQERKLLSPEGLQSKID 490
           ML V+++LSI+  S + WD +YTDLPN L KV+VPDRS+F TT+ E++L SP GLQ  ID
Sbjct: 437 MLAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVPDRSMFKTTNAEQQLTSPAGLQELID 496

Query: 491 KAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALVTKLVKES 538
             +  + +GRSFVRASGTEDAVR+YAEA+SQ++A EL   V+ LV ES
Sbjct: 497 DIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQADELATKVSTLVVES 544

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/542 (52%), Positives = 366/542 (67%), Gaps = 19/542 (3%)

Query: 5   LFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASHNP 64
           +F+  CTTK + Y YGTAGFRD A++L+TVMF TG VA LRS  L G  VGVM+TASHNP
Sbjct: 9   VFDAVCTTKGYTYTYGTAGFRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGVMVTASHNP 68

Query: 65  PEDNGVKIVEPNGAMLDQSWEPMATELANIAANSTFDDLKAYVEEKVKKFSPESGSKVQP 124
           PEDNGVK+V+P G ML + WEP+AT LAN+AAN TFD    Y    V++ +   G+++  
Sbjct: 69  PEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGTFDQWWEYWTSLVEEGNYTGGARL-- 126

Query: 125 VVVVGRDSRESGSYLLECLLASAENYMNAKI-INYGLLTT-PQLHFLTNEINVKKSYAVQ 182
              VG D+RES   LL+ L+ +A       I I+   +T  PQLH+LT+   +++     
Sbjct: 127 --CVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQLHYLTS---LQRDGVTD 181

Query: 183 ESSYYNYFIESWNKITALHNITDLYCSSLTIDTANGIGGPKIQELLKSWPF-ASKVTLVN 241
            ++Y ++F   W K+     +       L IDTANG+G  ++Q+  K W    +K  L+N
Sbjct: 182 AAAYNDHFQGCWQKLFP-DGVVAWPFDRLFIDTANGVGAVQLQQFFKGWAVDQNKFRLLN 240

Query: 242 NEWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTEN----DLYCSYDGDADRIVFYFQDQD 297
            ++  P+ LN  CGADFVKTN +LP+ V      +    DLYCS+DGDADRIVFYF  ++
Sbjct: 241 TDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTSGALPDLYCSFDGDADRIVFYFV-KN 299

Query: 298 KQFHLLDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLNVPVSC 357
           KQFHLLDGDKISTLFAK I +L   A  + K+++GVVQTAYANG+ST Y+   L +P +C
Sbjct: 300 KQFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYANGNSTRYIASELGIPSAC 359

Query: 358 AKTGVKHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKELKANSESIAVNTLVALS 417
            KTGVKHLHH A T YDIG+YFEANGHGT++FSD F +V       N    A +TL   S
Sbjct: 360 TKTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVVAGVASTND---AASTLYHFS 416

Query: 418 HLINQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFITTDQER 477
            LINQTVGDAI+DMLGVL+VL  ++ + + W  EYTDLPNLLTKV+VPDRS+F TTDQER
Sbjct: 417 KLINQTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLTKVVVPDRSIFETTDQER 476

Query: 478 KLLSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALVTKLVKE 537
           +L+SPEGLQ KID  +  F   RSFVRASGTE+AVR+Y EA   +E +EL+  VT+ V  
Sbjct: 477 RLVSPEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAEDPQEVQELSKQVTEAVLN 536

Query: 538 SV 539
           SV
Sbjct: 537 SV 538

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 42/87 (48%), Gaps = 10/87 (11%)

Query: 32  NTVMFTTGIVACLRSISLGGKAVGVMITASHNPPEDNGVKIVEPNGAMLDQSWEPMATEL 91
           +  + T  +   + ++  G  + GVMITASHNP  DNG K+   NG  +     P   EL
Sbjct: 137 DVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQII----PPHDEL 192

Query: 92  ------ANIAANSTFDDLKAYVEEKVK 112
                 AN+   +   D KA +EE +K
Sbjct: 193 IGRHIDANLEPWTRAWDSKALIEEAIK 219

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 39/83 (46%), Gaps = 23/83 (27%)

Query: 14  DHKY-----------VYGTAGFR-----DNASILNTVMFTTGIVACLRSISLGGKAVGVM 57
           DH+Y           V+  AGF+      N   ++T M   GI       +L   ++GVM
Sbjct: 108 DHRYHSKEFAQITAAVFLNAGFKVYYLNPNDEFVHTPMVPFGI-------NLYSASIGVM 160

Query: 58  ITASHNPPEDNGVKIVEPNGAML 80
           ITASHNP  DNG K+   NG  +
Sbjct: 161 ITASHNPEMDNGYKVYYNNGCQI 183

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 21/31 (67%)

Query: 50  GGKAVGVMITASHNPPEDNGVKIVEPNGAML 80
           GG + G+MITASHNP  DNG K+   NG  +
Sbjct: 159 GGASCGIMITASHNPKMDNGYKVYYSNGCQI 189

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 21/30 (70%)

Query: 51  GKAVGVMITASHNPPEDNGVKIVEPNGAML 80
           G +VGVMITASHNP  DNG K+   NG  +
Sbjct: 156 GASVGVMITASHNPKMDNGYKVYYSNGCQI 185

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 2/40 (5%)

Query: 500 RSFVRASGTEDAVRVYAEA--SSQEEAKELNALVTKLVKE 537
           R  +R SGTE  ++VY EA   S+E A EL  L  +++K 
Sbjct: 577 RFTIRGSGTEPKLKVYIEACSKSEERASELAQLTWRVLKR 616

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 21/30 (70%)

Query: 51  GKAVGVMITASHNPPEDNGVKIVEPNGAML 80
           G +VGVMITASHNP  DNG K+   NG  +
Sbjct: 154 GASVGVMITASHNPKMDNGYKVYYSNGCQI 183

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 24/35 (68%)

Query: 46  SISLGGKAVGVMITASHNPPEDNGVKIVEPNGAML 80
           +++  G +VG+MITASHNP  DNG K+   NG  +
Sbjct: 146 TVNATGASVGIMITASHNPKMDNGYKVYYTNGCQI 180

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 20/28 (71%)

Query: 53  AVGVMITASHNPPEDNGVKIVEPNGAML 80
           A GVMITASHNP +DNG K+   NG  +
Sbjct: 156 ACGVMITASHNPKDDNGYKVYYSNGCQI 183

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 37/73 (50%), Gaps = 14/73 (19%)

Query: 53  AVGVMITASHNPPEDNGVKIVEPNGAM------------LDQSWEPMATE--LANIAANS 98
           +VGVMITASHNP  DNG K+   NG              ++ + EP +T+     I +N+
Sbjct: 147 SVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAETINNNLEPWSTDWNFTKILSNA 206

Query: 99  TFDDLKAYVEEKV 111
             D    YV +++
Sbjct: 207 ETDGKIEYVRKRM 219

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 20/30 (66%)

Query: 51  GKAVGVMITASHNPPEDNGVKIVEPNGAML 80
           G + GVMITASHNP  DNG K+   NG  +
Sbjct: 152 GASAGVMITASHNPKMDNGYKVYYSNGCQI 181

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 42/76 (55%), Gaps = 20/76 (26%)

Query: 53  AVGVMITASHNPPEDNGVKIVEPNG------------AMLDQSWEPMATELANIAANSTF 100
           ++GVMITASHNP  DNG K+   NG            A +D++ EP +++      +STF
Sbjct: 153 SIGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKNIAATIDENLEPWSSDW---NWDSTF 209

Query: 101 D-DLK----AYVEEKV 111
           + +LK     YV E++
Sbjct: 210 EKNLKEKKLVYVREEM 225

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 35/61 (57%), Gaps = 10/61 (16%)

Query: 23  GFRDNAS---ILNTVMFTTGIVACLRSISLGGKAVGVMITASHNPPEDNGVKIVEPNGAM 79
           GF ++AS   +++T M   GI   LR+      + G+MITASHNP  DNG K+   NG  
Sbjct: 129 GFTEDASQDVVVHTPMVPFGI-DHLRA------SGGIMITASHNPKMDNGYKVYYSNGCQ 181

Query: 80  L 80
           +
Sbjct: 182 I 182

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 20/28 (71%)

Query: 53  AVGVMITASHNPPEDNGVKIVEPNGAML 80
           +VGVMITASHNP  DNG K+   NG  +
Sbjct: 150 SVGVMITASHNPKMDNGYKVYYSNGCQI 177

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 16/77 (20%)

Query: 53  AVGVMITASHNPPEDNGVKIVEPNGAM------------LDQS---WEPMATELANIAAN 97
           +VGVMITASHNP  DNG K+   NG              +DQ+   WEP + +   +   
Sbjct: 153 SVGVMITASHNPKMDNGYKVYFANGCQIIPPHDLNIARSIDQNLEPWEP-SWDWPTVIQA 211

Query: 98  STFDDLKAYVEEKVKKF 114
           +  +D   YV++++ + 
Sbjct: 212 AEKEDRIVYVKDQMTQL 228

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 53  AVGVMITASHNPPEDNGVKIVEPNGAML 80
           +VGVM+TASHNP  DNG K+   NG  +
Sbjct: 165 SVGVMVTASHNPKMDNGYKVYYSNGCQI 192

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 38.5 bits (88), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 20/28 (71%)

Query: 53  AVGVMITASHNPPEDNGVKIVEPNGAML 80
           +VGVMITASHNP  DNG K+   NG  +
Sbjct: 150 SVGVMITASHNPKMDNGYKVYYSNGCQI 177

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 38.5 bits (88), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 20/28 (71%)

Query: 53  AVGVMITASHNPPEDNGVKIVEPNGAML 80
           +VGVMITASHNP  DNG K+   NG  +
Sbjct: 150 SVGVMITASHNPKMDNGYKVYYSNGCQI 177

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score = 38.1 bits (87), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 20/28 (71%)

Query: 53  AVGVMITASHNPPEDNGVKIVEPNGAML 80
           +VGVMITASHNP  DNG K+   NG  +
Sbjct: 146 SVGVMITASHNPKLDNGYKVYYANGCQI 173

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 38.1 bits (87), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 53  AVGVMITASHNPPEDNGVKIVEPNGAML 80
           +VGVM+TASHNP  DNG K+   NG  +
Sbjct: 150 SVGVMVTASHNPKMDNGYKVYYSNGCQI 177

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 19/28 (67%)

Query: 53  AVGVMITASHNPPEDNGVKIVEPNGAML 80
           + G+MITASHNP  DNG K+   NG  +
Sbjct: 154 SAGIMITASHNPKMDNGYKVYYSNGCQI 181

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 12/49 (24%)

Query: 53  AVGVMITASHNPPEDNGVK--------IVEPN----GAMLDQSWEPMAT 89
           +VGVMITASHNP  DNG K        I+ P+      M+ ++ EP +T
Sbjct: 152 SVGVMITASHNPKMDNGYKVYYDNACQIIPPHDKNIAEMIQKNLEPWST 200

>Skud_11.44 Chr11 (87128..93283) [6156 bp, 2051 aa] {ON} YKL182W
           (REAL)
          Length = 2051

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 57/122 (46%), Gaps = 9/122 (7%)

Query: 260 KTNQKLPNGVSGNSTENDLYCSYDGDADRIVFYFQDQDKQFHLLDGDKISTLFAKLIAKL 319
           K+N  L N VS  + +        G+ D      +DQ + +H+L GD I    A+ +++L
Sbjct: 140 KSNSALFNAVSEGNAQLVAIFGGQGNTDDYFEELRDQYQTYHVLVGDLIK-FSAETLSEL 198

Query: 320 LNDANLNSKI---SLGVVQ--TAYANGSSTNYLQGTLNVPVSCAKTGVKHLHHEAVTNYD 374
           + +     K+    L +++     +N    +YL   L++P+SC   GV  L H  +T   
Sbjct: 199 IRNTLDAEKVFTQGLNILEWLETPSNTPDKDYL---LSIPISCPLIGVIQLAHYVITAKL 255

Query: 375 IG 376
           +G
Sbjct: 256 LG 257

>KNAG0B02710 Chr2 complement(522102..523532) [1431 bp, 476 aa] {ON}
           Anc_7.323 YLR212C
          Length = 476

 Score = 34.3 bits (77), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 48/115 (41%), Gaps = 15/115 (13%)

Query: 160 LLTTPQLHFLTNEINVKKS-YAVQESSYYNY--------FIESWNKITALHNITDLYCSS 210
           L+ +P LHFLT       S Y   E  Y            I+  N + +  N   +Y ++
Sbjct: 260 LVPSPDLHFLTPSFTPFTSDYVAHEKEYRQNTAYDVLLDLIDGNNSLVSNKNNKPVYFNT 319

Query: 211 L-----TIDTANGIGG-PKIQELLKSWPFASKVTLVNNEWEKPDLLNKNCGADFV 259
                 T+D ++      K+Q  L   P++S V  VN     P L NKN G D+V
Sbjct: 320 FSTLIGTLDRSDITRAISKLQTRLHFAPWSSSVIHVNCGRRSPYLTNKNIGGDYV 374

>Smik_11.48 Chr11 (86169..92324) [6156 bp, 2051 aa] {ON} YKL182W
           (REAL)
          Length = 2051

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 56/122 (45%), Gaps = 9/122 (7%)

Query: 260 KTNQKLPNGVSGNSTENDLYCSYDGDADRIVFYFQDQDKQFHLLDGDKI---STLFAKLI 316
           K+N  L   VS NS +        G+ D      +D  + +H+L GD I   +   ++LI
Sbjct: 140 KSNSSLFKAVSENSAQLVAIFGGQGNTDDYFEELRDLYQTYHVLVGDLIKFSAETLSELI 199

Query: 317 AKLLNDANLNSKISLGVVQ--TAYANGSSTNYLQGTLNVPVSCAKTGVKHLHHEAVTNYD 374
              L+   + ++  L +++     +N    +YL   L++P+SC   GV  L H  VT   
Sbjct: 200 RTTLDAEKVFTQ-GLNILEWLETPSNTPDKDYL---LSIPISCPLIGVIQLAHYVVTAKL 255

Query: 375 IG 376
           +G
Sbjct: 256 LG 257

>SAKL0H06732g Chr8 complement(592276..593763) [1488 bp, 495 aa] {ON}
           highly similar to gnl|GLV|KLLA0F11297g Kluyveromyces
           lactis KLLA0F11297g and similar to YOR241W
           uniprot|Q08645 Saccharomyces cerevisiae YOR241W MET7
           Folylpolyglutamate synthetase catalyzes extension of the
           glutamate chains of the folate coenzymes required for
           methionine synthesis and for maintenance of
           mitochondrial DNA present in both the cytoplasm and
           mitochondria
          Length = 495

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 41/86 (47%), Gaps = 5/86 (5%)

Query: 114 FSPESGSKVQPVVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEI 173
           +S +  +K+  + + G   + S +   + +L+      N ++ N GL T+P L  +   I
Sbjct: 63  YSTKDYNKLNIIHITGTKGKGSTAAFTQSILSQ----YNDRLSNIGLYTSPHLKSVRERI 118

Query: 174 NVKKSYAVQESSYYNYFIESWNKITA 199
            +  +  + E  +  YF E W+K+ A
Sbjct: 119 RINGN-PITEEKFSQYFFEVWDKLEA 143

>Kpol_1036.72 s1036 (196871..198649) [1779 bp, 592 aa] {ON}
           (196871..198649) [1779 nt, 593 aa]
          Length = 592

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 42/84 (50%), Gaps = 6/84 (7%)

Query: 451 EYTDLPNLLTKVIVPDRSVFITTDQERKLLSPEGLQSKIDKAISEFSNGR--SFVRASG- 507
           EY  LP+LL +V  P+    I  D E ++L+   LQ+        F+NGR   F+  S  
Sbjct: 171 EYPHLPSLLLRVYGPNIDSIIDRDYELQILARLSLQNIGPSLFGCFTNGRFEQFLENSQT 230

Query: 508 -TEDAVRVYAEASSQEEAKELNAL 530
            T+D +R +   +SQ  A+ +  L
Sbjct: 231 LTKDDIRDW--KTSQRIARRMKEL 252

>Kpol_292.3 s292 (6641..7651) [1011 bp, 336 aa] {ON} (6641..7651)
           [1011 nt, 337 aa]
          Length = 336

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 30/141 (21%), Positives = 58/141 (41%), Gaps = 24/141 (17%)

Query: 2   NSKLFEKYCTTKDHKYVYGTAGFR---------DNASILNTVMFTTGIVA---CLRSISL 49
           N K  ++Y + +D K+VY    FR         ++A  L  ++    +V    C   I  
Sbjct: 98  NEKENDEYNSIEDEKFVYPFLNFRLAKPTLDEVNDAETLKKIINIRVLVTRAQCSAIIGT 157

Query: 50  GGKAVGVMITASHNPPEDNGVKIVEPNGAMLDQSWEPMATELANIAANSTFDDLKAYVEE 109
            G  +  +I       E+ GV+++  N  + D     +  +  ++A     +D+ A +  
Sbjct: 158 KGDRIKSLI-------ENRGVRMIASNQTLPDSDERLLEIQGTSMAITKVLEDINAVISN 210

Query: 110 KV-----KKFSPESGSKVQPV 125
           +V     K++ P    + QPV
Sbjct: 211 EVRATREKRYVPHVRRRNQPV 231

>NDAI0G03300 Chr7 complement(773833..776274) [2442 bp, 813 aa] {ON}
           Anc_8.64 YFL013C
          Length = 813

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 49/98 (50%), Gaps = 11/98 (11%)

Query: 143 LLASAENYMNAKIINYGLLTTPQLHF----LTNEINVKKSYAVQESSYYNYFIESWNKIT 198
           LL  A +   +KI+   LL  PQ+ F    L+  +N+ K      ++  N+++E  +++ 
Sbjct: 216 LLTIATSSKCSKILRDKLLIDPQIAFSTCILSLLVNIGKL-----NTTINFYVEMTSQLR 270

Query: 199 ALHNITDLYCSSLTIDTANGIGGPKIQELLKSWPFASK 236
             H++  L C S   D  +    P+++ +LK+ P  ++
Sbjct: 271 TFHSVPSLQCHS--TDPKSLQDTPRLKSILKNLPLGNQ 306

>CAGL0L05302g Chr12 complement(590178..591812) [1635 bp, 544 aa]
           {ON} similar to uniprot|P36076 Saccharomyces cerevisiae
           YKL088w
          Length = 544

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 51/118 (43%), Gaps = 10/118 (8%)

Query: 268 GVSGNSTENDLYCSYDGDADRIVFYFQDQD-KQFHLLDG--DKISTLFAKLIAKLLNDAN 324
           G+SG S   ++  S  G       YF  QD K+FH+L G    ++T+   LI   L    
Sbjct: 236 GISGASGSKEVIGSTSGPQIPFSEYFLRQDDKKFHILIGATGSVATIKVPLIIDKLLKLY 295

Query: 325 LNSKISLGVVQTAYA----NG---SSTNYLQGTLNVPVSCAKTGVKHLHHEAVTNYDI 375
              KIS+ ++ T  A    NG   S+   +    +V   C K G   LHHE     DI
Sbjct: 296 TPDKISIQLIVTKPAEHFLNGLKISTHVKIWREEDVWSDCKKMGDMILHHELRKWADI 353

>SAKL0G15400g Chr7 (1325560..1327194) [1635 bp, 544 aa] {ON} similar
           to gnl|GLV|KLLA0E15928g Kluyveromyces lactis
           KLLA0E15928g and weakly similar to YHR150W
           uniprot|P38848 Saccharomyces cerevisiae YHR150W PEX28
           Peroxisomal integral membrane protein involved in
           regulation of peroxisome size and number genetic
           interactions suggest that Pex28p and Pex29p act at steps
           upstream of those mediated by Pex30p Pex31p and Pex32p
          Length = 544

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 20/29 (68%), Gaps = 2/29 (6%)

Query: 13  KDHKYVYGTAGFRDNASILNTVMFTTGIV 41
           K  K+VYGTAGF+D     +T +F TG+V
Sbjct: 334 KLEKFVYGTAGFKDEHH--STALFLTGLV 360

>NDAI0E01200 Chr5 complement(238271..239743) [1473 bp, 490 aa] {ON}
           Anc_8.669 YOR241W
          Length = 490

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 1/46 (2%)

Query: 152 NAKIINYGLLTTPQLHFLTNEINVKKSYAVQESSYYNYFIESWNKI 197
           N K+   GL T+P L  +   I +     + E  +  YF E WNK+
Sbjct: 92  NDKLPKIGLYTSPHLKTVRERIRINGE-PISEDKFTKYFFEVWNKL 136

>KLTH0F17160g Chr6 (1391428..1393518) [2091 bp, 696 aa] {ON} similar
           to uniprot|P36148 Saccharomyces cerevisiae YKR067W GPT2
           Glycerol-3-phosphate acyltransferase located in both
           lipid particles and the ER involved in the stepwise
           acylation of glycerol-3-phosphate and dihydroxyacetone
           which are intermediate steps in lipid biosynthesis
          Length = 696

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 50/112 (44%), Gaps = 12/112 (10%)

Query: 438 LSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFITTD------QERKLLSPEGLQSKIDK 491
           L  +K + +Q   E T + N L   + PD   FITT       +E K   P    S +  
Sbjct: 577 LEDLKETRKQLSLEVTQVCNDLGPTVFPDFGRFITTQKAAERGEEDKDYVPRSRSSSVHS 636

Query: 492 AISEFSNGRSFVRASGTEDAVRVYAEASSQE------EAKELNALVTKLVKE 537
             S+ SN  S V ++ +   + + AE S+++      E  E  +L+  LV++
Sbjct: 637 MESQMSNALSKVNSNVSLSDIPILAEGSNEQQDTIEVEKTEKPSLIGNLVRQ 688

>ZYRO0F07216g Chr6 (584726..586192) [1467 bp, 488 aa] {ON} similar
           to uniprot|Q08645 Saccharomyces cerevisiae YOR241W MET7
           Folylpolyglutamate synthetase catalyzes extension of the
           glutamate chains of the folate coenzymes required for
           methionine synthesis and for maintenance of
           mitochondrial DNA present in both the cytoplasm and
           mitochondria
          Length = 488

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 154 KIINYGLLTTPQLHFLTNEINVKKSYAVQESSYYNYFIESWNKI 197
           K+   GL T+P L  +T  I +  +  + E  +  YF E W+K+
Sbjct: 92  KVPKVGLYTSPHLKSVTERIRINGN-PISEDKFAKYFFEVWDKL 134

>TPHA0G01620 Chr7 complement(334221..335699) [1479 bp, 492 aa] {ON}
           Anc_8.669 YOR241W
          Length = 492

 Score = 30.8 bits (68), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 159 GLLTTPQLHFLTNEINVKKSYAVQESSYYNYFIESWNKITALHNITDLY 207
           GL T+P L  +   I +  S  + E  +  YF E W+K+ +  + T+ +
Sbjct: 99  GLFTSPHLKSVRERIRIN-SEPIDEMKFTKYFFEVWDKLESTQSSTEKF 146

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,666,802
Number of extensions: 2677098
Number of successful extensions: 6754
Number of sequences better than 10.0: 76
Number of HSP's gapped: 6883
Number of HSP's successfully gapped: 77
Length of query: 539
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 425
Effective length of database: 40,409,475
Effective search space: 17174026875
Effective search space used: 17174026875
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)