Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1028.825.525ON92592545070.0
SAKL0G04884g5.525ON93094119810.0
TPHA0L003505.525ON85992319540.0
KAFR0E033105.525ON93893919600.0
TDEL0A038905.525ON83191119150.0
YDR421W (ARO80)5.525ON95094919030.0
ZYRO0D12518g5.525ON88191518890.0
Suva_2.5985.525ON96594218920.0
Skud_4.6955.525ON95495518820.0
Smik_4.6965.525ON94994918420.0
NCAS0F010705.525ON90491818250.0
NDAI0H015805.525ON90993418120.0
KLLA0A01804g5.525ON94595517210.0
KLTH0G03718g5.525ON85790915720.0
TBLA0D016705.525ON101884215640.0
KNAG0C032505.525ON93696215370.0
CAGL0F03025g5.525ON92896914300.0
ADR199C5.525ON94498213331e-168
KNAG0E041004.344ON903601254e-06
TBLA0E047504.344ON1283521229e-06
KLTH0C07480g3.264ON775671202e-05
TPHA0B004104.344ON945491174e-05
Smik_9.392.231ON1012611131e-04
TBLA0F012003.109ON1086701131e-04
YIL130W (ASG1)2.231ON964611121e-04
Suva_9.592.231ON926611121e-04
Skud_9.372.231ON954611112e-04
TPHA0B015854.344ON812431093e-04
KLLA0F04609g2.231ON916531093e-04
Kwal_56.230583.264ON775621093e-04
SAKL0D00264g8.879ON848501083e-04
CAGL0G08844g2.231ON8471551084e-04
Ecym_53972.231ON826711084e-04
KLTH0E16500g8.879ON833501084e-04
Kwal_27.96888.879ON841521084e-04
Smik_15.3506.61ON784541075e-04
TBLA0C062306.60ON795481076e-04
SAKL0G17908g4.344ON809531076e-04
CAGL0H06875g8.879ON702451066e-04
KLLA0E02663gna 1ON1109691076e-04
TBLA0H006808.423ON880671076e-04
YML076C (WAR1)4.344ON944601066e-04
KNAG0A025508.423ON730551067e-04
KLLA0B04620g4.344ON919581067e-04
SAKL0H13024g8.423ON754481058e-04
Kpol_538.528.879ON907411050.001
Kpol_1001.34.344ON856491050.001
TPHA0A045403.109ON1178701050.001
SAKL0D03586g3.264ON801541040.001
KAFR0C03660singletonON847511040.001
KAFR0C013203.109ON10061241050.001
NCAS0C002208.879ON839391040.001
NCAS0I002707.17ON944561040.001
AFR171Wna 2ON6121071030.001
AER370W2.231ON801511040.001
TDEL0D00820na 3ON685531030.001
KAFR0I002804.344ON936621030.001
KNAG0A044808.423ON1013661030.001
KLTH0H16170gna 4ON619691030.002
KLTH0D16852g4.344ON811571030.002
NCAS0A061904.344ON894531030.002
Suva_10.3238.423ON813481030.002
Kwal_23.31228.423ON788491020.002
TBLA0G011308.879ON1132461020.002
TDEL0C044802.231ON852671020.002
Ecym_7440na 5ON898951020.002
NDAI0K001508.879ON953391020.002
KNAG0J002108.879ON861391020.002
KAFR0J017102.231ON848891020.002
Smik_4.4608.423ON918541020.002
NDAI0B038502.231ON930851020.002
NCAS0A016304.113ON1043571020.002
TBLA0G026102.231ON1000631020.002
Kwal_47.168624.344ON743551010.002
NCAS0B065502.231ON906591010.002
TBLA0I025408.423ON1259411010.003
Smik_13.644.344ON944601010.003
KLTH0E03256gsingletonON674501010.003
TDEL0B004808.879ON835521010.003
Skud_13.664.344ON939601010.003
TDEL0D036103.264ON724541010.003
ZYRO0B14718g4.344ON1035481010.003
TBLA0B062404.344ON1435551010.003
SAKL0H00682gna 6ON922621000.003
NDAI0A03410na 7ON980561000.003
CAGL0I07755g3.109ON1053681000.003
Kwal_26.7095na 8ON838601000.004
Ecym_11354.344ON822551000.004
CAGL0H04367g4.344ON945531000.004
NDAI0E034608.423ON949641000.004
Skud_4.4758.423ON913801000.004
Suva_2.3818.423ON918541000.004
TBLA0C019105.577ON1148461000.004
Skud_12.2968.423ON81448990.004
Smik_12.2898.423ON81248990.005
NDAI0A034204.113ON110846990.005
Smik_12.1578.283ON64457990.005
CAGL0C01199g8.423ON92259990.005
YLR228C (ECM22)8.423ON81448990.005
NDAI0F00110singletonON50839980.005
AAL175W8.879ON88350980.006
KLLA0F04213g3.264ON76853980.006
KAFR0A03060singletonON86044980.006
NCAS0A125802.547ON70465980.006
NDAI0D00900singletonON86561980.006
Kpol_455.108.879ON83057980.006
TBLA0E034803.109ON104659980.007
KLTH0B09262gsingletonON82070980.007
TBLA0C040504.113ON120750980.007
KAFR0E012503.264ON73670970.007
Suva_1.147.17ON104563980.007
TPHA0L010608.423ON97343980.007
KLTH0D07260g2.547ON97955980.007
ABL099W3.264ON80050970.007
Kpol_1061.113.264ON73362970.007
Suva_13.1862.565ON89454970.007
ZYRO0B03278g7.389ON123965970.008
AER153W4.344ON74859970.008
CAGL0K11902g3.264ON83173970.008
ZYRO0A03058g3.264ON73675970.009
YGL013C (PDR1)4.113ON106859970.009
NCAS0A067105.322ON76952970.009
TBLA0A04280singletonON89247970.009
NDAI0D031804.344ON98960970.009
Kwal_47.175064.113ON92454970.009
Suva_2.1873.264ON78471960.009
Skud_14.399na 9ON60769960.010
KAFR0L021308.879ON88239960.010
NDAI0I021906.61ON73573960.010
KNAG0D052407.512ON86992960.010
TPHA0F025506.61ON79965960.010
KLLA0C17050gna 10ON95563960.010
Kpol_1049.19na 11ON94345960.010
TDEL0D051503.109ON99663960.011
KLLA0F00572gna 12ON597144950.011
NCAS0B028608.423ON86955960.011
TPHA0C021808.423ON88666960.011
Suva_8.2256.61ON80154960.011
CAGL0F07909g3.109ON104942960.012
KLTH0E14454gna 5ON90260950.012
TDEL0F054708.423ON81053950.013
NCAS0A076107.17ON102260950.013
ZYRO0A00440g8.879ON85046950.013
Kpol_1039.112.231ON99253950.013
NCAS0H00780singletonON90946950.013
KNAG0A02300singletonON72959950.013
Suva_13.764.344ON94660950.014
TBLA0C033905.322ON110662950.014
NCAS0F027005.322ON83558950.014
YDR213W (UPC2)8.423ON91354950.014
Skud_15.3346.61ON79053950.015
CAGL0F07865g8.423ON84453950.015
Kwal_23.47542.231ON81250950.015
ZYRO0G10252g4.113ON103651950.015
Smik_18.8singletonON77597940.016
KLTH0G09108g2.231ON78250940.016
ADR403C7.17ON97067940.016
Kwal_56.226053.109ON86564940.016
YDR034C (LYS14)3.264ON79063940.017
NDAI0C041705.322ON82558940.017
KAFR0E013005.322ON82758940.017
TPHA0M010403.264ON77059940.017
NDAI0C002602.654ON104151940.017
YAL051W (OAF1)7.17ON104763940.018
SAKL0E08998g2.231ON82345940.019
KAFR0C049807.17ON95157940.019
KAFR0B063408.423ON86461930.021
Ecym_51313.264ON77058930.021
Smik_1.137.17ON104663930.021
KNAG0H012603.264ON74145930.022
Ecym_81598.879ON90839930.022
KNAG0E017602.231ON90245930.023
KAFR0A066904.113ON99742930.023
Ecym_41448.423ON84071930.023
YOR172W (YRM1)6.61ON78654930.024
Smik_4.2693.264ON77863930.024
AGL091W8.423ON86647930.025
KLTH0C10098g6.60ON77164930.025
TPHA0C049808.879ON85254930.026
Smik_13.1832.565ON91177930.026
Skud_4.2873.264ON78463920.027
TBLA0I018903.264ON82559920.028
Skud_1.107.17ON104063920.028
TDEL0E00300singletonON637128920.030
Smik_17.27singletonON68847920.031
NCAS0A035804.113ON111342920.031
NCAS0A047502.547ON114144920.033
CAGL0M12298g7.17ON99467920.033
Smik_7.2774.113ON106959920.035
KLLA0F18084gna 13ON86061910.035
ZYRO0E06270g2.565ON91287920.035
NCAS0A105503.264ON74147910.036
ZYRO0G17512gsingletonON52347910.037
TDEL0F023304.113ON108661910.037
Kpol_1023.415.322ON81539910.038
TDEL0D007304.344ON80651910.038
KNAG0A02290singletonON80070910.038
NCAS0C027308.423ON77547910.039
Skud_7.2744.113ON108059910.041
TBLA0A007302.654ON103747910.041
NDAI0K018002.547ON121044910.041
TDEL0G04890singletonON58453900.042
KNAG0A071002.547ON128647910.043
NCAS0A150207.512ON80949910.044
SAKL0G17622gna 3ON67649900.045
Kpol_495.213.109ON108542910.046
KLLA0C19228gsingletonON59144900.046
KLTH0D01804g7.56ON65282900.049
KLLA0C10923g5.235ON77566900.049
NDAI0A057503.264ON75952900.049
TPHA0E012905.322ON85249900.051
NDAI0D03540na 7ON110760900.052
ZYRO0C18282gna 14ON716127900.053
Kpol_1008.137.512ON90249900.054
KAFR0B014502.547ON108841900.055
ZYRO0G12584gna 15ON68643900.055
KLLA0C03201g1.128ON650114900.055
KLLA0A04169g8.423ON77548900.055
Smik_12.5497.512ON88660900.056
Kpol_1005.25.322ON83950900.059
KLTH0D00594gna 12ON63168890.059
Suva_15.773.109ON102968900.059
SAKL0G19470g2.654ON83152900.060
NCAS0A03070singletonON65647890.060
Kpol_1002.52.547ON95856900.061
Skud_13.438.879ON88052890.061
Kpol_529.158.423ON94849900.061
Suva_15.415na 11ON86749890.062
KAFR0B028208.283ON66457890.062
Ecym_6141na 14ON11457820.063
NDAI0C048408.423ON94848890.063
CAGL0E05434g7.56ON81656890.064
YMR019W (STB4)2.565ON94977890.064
Smik_11.2102.547ON116950890.065
KLLA0C16489gna 16ON72853890.065
KLTH0C06776g7.389ON105474890.065
NDAI0B015402.565ON80370890.067
SAKL0F15444g7.512ON96462890.067
YLR451W (LEU3)7.512ON88660890.068
SAKL0D14520g7.17ON98357890.069
Kpol_1031.478.423ON89442890.071
Skud_8.1135.322ON881112890.071
KLTH0F07854g8.423ON78845890.071
ZYRO0A09350g8.423ON79353890.071
NDAI0D035504.113ON111844890.071
TPHA0F013802.231ON89050890.075
Skud_12.3466.60ON69458890.075
KNAG0M00120singletonON88147890.076
YML099C (ARG81)8.879ON88052890.077
Kwal_55.218847.512ON88250890.079
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1028.82
         (925 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1028.82 s1028 complement(183595..186372) [2778 bp, 925 aa] ...  1740   0.0  
SAKL0G04884g Chr7 (400351..403143) [2793 bp, 930 aa] {ON} simila...   767   0.0  
TPHA0L00350 Chr12 complement(47367..49946) [2580 bp, 859 aa] {ON}     757   0.0  
KAFR0E03310 Chr5 complement(656129..658945) [2817 bp, 938 aa] {O...   759   0.0  
TDEL0A03890 Chr1 (695880..698375) [2496 bp, 831 aa] {ON} Anc_5.5...   742   0.0  
YDR421W Chr4 (1312040..1314892) [2853 bp, 950 aa] {ON}  ARO80Zin...   737   0.0  
ZYRO0D12518g Chr4 (1055521..1058166) [2646 bp, 881 aa] {ON} simi...   732   0.0  
Suva_2.598 Chr2 (1064757..1067654) [2898 bp, 965 aa] {ON} YDR421...   733   0.0  
Skud_4.695 Chr4 (1233000..1235864) [2865 bp, 954 aa] {ON} YDR421...   729   0.0  
Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421...   714   0.0  
NCAS0F01070 Chr6 (211085..213799) [2715 bp, 904 aa] {ON} Anc_5.5...   707   0.0  
NDAI0H01580 Chr8 (382179..384908) [2730 bp, 909 aa] {ON} Anc_5.5...   702   0.0  
KLLA0A01804g Chr1 complement(159689..162526) [2838 bp, 945 aa] {...   667   0.0  
KLTH0G03718g Chr7 (292858..295431) [2574 bp, 857 aa] {ON} simila...   610   0.0  
TBLA0D01670 Chr4 complement(413360..416416) [3057 bp, 1018 aa] {...   607   0.0  
KNAG0C03250 Chr3 complement(635995..638805) [2811 bp, 936 aa] {O...   596   0.0  
CAGL0F03025g Chr6 (295783..298569) [2787 bp, 928 aa] {ON} simila...   555   0.0  
ADR199C Chr4 complement(1048528..1051362) [2835 bp, 944 aa] {ON}...   518   e-168
KNAG0E04100 Chr5 (814663..817374) [2712 bp, 903 aa] {ON} Anc_4.3...    53   4e-06
TBLA0E04750 Chr5 (1222163..1226014) [3852 bp, 1283 aa] {ON} Anc_...    52   9e-06
KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} simila...    51   2e-05
TPHA0B00410 Chr2 complement(84722..87559) [2838 bp, 945 aa] {ON}...    50   4e-05
Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W (R...    48   1e-04
TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3....    48   1e-04
YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc c...    48   1e-04
Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W (R...    48   1e-04
Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)    47   2e-04
TPHA0B01585 Chr2 complement(352396..354834) [2439 bp, 812 aa] {ON}     47   3e-04
KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {...    47   3e-04
Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {...    47   3e-04
SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON...    46   3e-04
CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {...    46   4e-04
Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar t...    46   4e-04
KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON} simi...    46   4e-04
Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}...    46   4e-04
Smik_15.350 Chr15 (610312..612666) [2355 bp, 784 aa] {ON} YOR172...    46   5e-04
TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6...    46   6e-04
SAKL0G17908g Chr7 (1552344..1554773) [2430 bp, 809 aa] {ON} simi...    46   6e-04
CAGL0H06875g Chr8 complement(682518..684626) [2109 bp, 702 aa] {...    45   6e-04
KLLA0E02663g Chr5 (244696..248025) [3330 bp, 1109 aa] {ON} conse...    46   6e-04
TBLA0H00680 Chr8 complement(144914..147556) [2643 bp, 880 aa] {O...    46   6e-04
YML076C Chr13 complement(112513..115347) [2835 bp, 944 aa] {ON} ...    45   6e-04
KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa] {O...    45   7e-04
KLLA0B04620g Chr2 complement(413129..415888) [2760 bp, 919 aa] {...    45   7e-04
SAKL0H13024g Chr8 complement(1119585..1121849) [2265 bp, 754 aa]...    45   8e-04
Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON} (126243...    45   0.001
Kpol_1001.3 s1001 complement(9551..12121) [2571 bp, 856 aa] {ON}...    45   0.001
TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON} Anc_...    45   0.001
SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} simila...    45   0.001
KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa] {O...    45   0.001
KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3....    45   0.001
NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879       45   0.001
NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}...    45   0.001
AFR171W Chr6 (752589..754427) [1839 bp, 612 aa] {ON} NOHBY629; N...    44   0.001
AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic ...    45   0.001
TDEL0D00820 Chr4 (151394..153451) [2058 bp, 685 aa] {ON}               44   0.001
KAFR0I00280 Chr9 complement(57061..59871) [2811 bp, 936 aa] {ON}...    44   0.001
KNAG0A04480 Chr1 complement(626229..629270) [3042 bp, 1013 aa] {...    44   0.001
KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]...    44   0.002
KLTH0D16852g Chr4 (1392572..1395007) [2436 bp, 811 aa] {ON} simi...    44   0.002
NCAS0A06190 Chr1 (1226184..1228868) [2685 bp, 894 aa] {ON} Anc_4...    44   0.002
Suva_10.323 Chr10 complement(566314..568755) [2442 bp, 813 aa] {...    44   0.002
Kwal_23.3122 s23 complement(166388..168754) [2367 bp, 788 aa] {O...    44   0.002
TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8....    44   0.002
TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.2...    44   0.002
Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}...    44   0.002
NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON...    44   0.002
KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.87...    44   0.002
KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {...    44   0.002
Smik_4.460 Chr4 (833609..836365) [2757 bp, 918 aa] {ON} YDR213W ...    44   0.002
NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {O...    44   0.002
NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {...    44   0.002
TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {...    44   0.002
Kwal_47.16862 s47 complement(147009..149240) [2232 bp, 743 aa] {...    44   0.002
NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa] ...    44   0.002
TBLA0I02540 Chr9 (590352..594131) [3780 bp, 1259 aa] {ON} Anc_8....    44   0.003
Smik_13.64 Chr13 complement(110338..113172) [2835 bp, 944 aa] {O...    44   0.003
KLTH0E03256g Chr5 complement(294997..297021) [2025 bp, 674 aa] {...    44   0.003
TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879...    44   0.003
Skud_13.66 Chr13 complement(111847..114666) [2820 bp, 939 aa] {O...    44   0.003
TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.2...    44   0.003
ZYRO0B14718g Chr2 (1196539..1199646) [3108 bp, 1035 aa] {ON} sim...    44   0.003
TBLA0B06240 Chr2 complement(1469510..1473817) [4308 bp, 1435 aa]...    44   0.003
SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON...    43   0.003
NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa] {O...    43   0.003
CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa] ...    43   0.003
Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C...    43   0.004
Ecym_1135 Chr1 complement(276229..278697) [2469 bp, 822 aa] {ON}...    43   0.004
CAGL0H04367g Chr8 complement(410256..413093) [2838 bp, 945 aa] {...    43   0.004
NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON} Anc_8.423     43   0.004
Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W ...    43   0.004
Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W ...    43   0.004
TBLA0C01910 Chr3 complement(448085..448684,448765..451611) [3447...    43   0.004
Skud_12.296 Chr12 complement(540407..542851) [2445 bp, 814 aa] {...    43   0.004
Smik_12.289 Chr12 complement(540824..543262) [2439 bp, 812 aa] {...    43   0.005
NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa] {...    43   0.005
Smik_12.157 Chr12 complement(317470..319404) [1935 bp, 644 aa] {...    43   0.005
CAGL0C01199g Chr3 complement(121944..124712) [2769 bp, 922 aa] {...    43   0.005
YLR228C Chr12 complement(600019..602463) [2445 bp, 814 aa] {ON} ...    43   0.005
NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON}                 42   0.005
AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic ...    42   0.006
KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} simila...    42   0.006
KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa] {O...    42   0.006
NCAS0A12580 Chr1 complement(2481447..2483561) [2115 bp, 704 aa] ...    42   0.006
NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON}               42   0.006
Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON} (12074..1...    42   0.006
TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3....    42   0.007
KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly...    42   0.007
TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {...    42   0.007
KAFR0E01250 Chr5 complement(249538..251748) [2211 bp, 736 aa] {O...    42   0.007
Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W (R...    42   0.007
TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON} Anc_8....    42   0.007
KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {...    42   0.007
ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic ho...    42   0.007
Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {O...    42   0.007
Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019...    42   0.007
ZYRO0B03278g Chr2 (269277..272996) [3720 bp, 1239 aa] {ON} simil...    42   0.008
AER153W Chr5 (925950..928196) [2247 bp, 748 aa] {ON} Syntenic ho...    42   0.008
CAGL0K11902g Chr11 complement(1149210..1151705) [2496 bp, 831 aa...    42   0.008
ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} simila...    42   0.009
YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON} ...    42   0.009
NCAS0A06710 Chr1 (1324253..1326562) [2310 bp, 769 aa] {ON} Anc_5...    42   0.009
TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa] ...    42   0.009
NDAI0D03180 Chr4 (759984..762953) [2970 bp, 989 aa] {ON} Anc_4.3...    42   0.009
Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013...    42   0.009
Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON...    42   0.009
Skud_14.399 Chr14 (715444..717267) [1824 bp, 607 aa] {ON} YNR063...    42   0.010
KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON} Anc_8....    42   0.010
NDAI0I02190 Chr9 (501867..504074) [2208 bp, 735 aa] {ON} Anc_6.6...    42   0.010
KNAG0D05240 Chr4 (953893..956502) [2610 bp, 869 aa] {ON} Anc_7.5...    42   0.010
TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.6...    42   0.010
KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON} cons...    42   0.010
Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON} (38439....    42   0.010
TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.1...    42   0.011
KLLA0F00572g Chr6 complement(42710..44503) [1794 bp, 597 aa] {ON...    41   0.011
NCAS0B02860 Chr2 complement(488982..491591) [2610 bp, 869 aa] {O...    42   0.011
TPHA0C02180 Chr3 complement(493972..496632) [2661 bp, 886 aa] {O...    42   0.011
Suva_8.225 Chr8 (404288..406693) [2406 bp, 801 aa] {ON} YOR172W ...    42   0.011
CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some ...    42   0.012
KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]...    41   0.012
TDEL0F05470 Chr6 (1017743..1020175) [2433 bp, 810 aa] {ON} Anc_8...    41   0.013
NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]...    41   0.013
ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON...    41   0.013
Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON} (29727....    41   0.013
NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa] {O...    41   0.013
KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene e...    41   0.013
Suva_13.76 Chr13 complement(113974..116811) [2838 bp, 946 aa] {O...    41   0.014
TBLA0C03390 Chr3 complement(814708..818028) [3321 bp, 1106 aa] {...    41   0.014
NCAS0F02700 Chr6 complement(547682..550189) [2508 bp, 835 aa] {O...    41   0.014
YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol...    41   0.014
Skud_15.334 Chr15 (602966..605338) [2373 bp, 790 aa] {ON} YOR172...    41   0.015
CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa] {...    41   0.015
Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W...    41   0.015
ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON} simil...    41   0.015
Smik_18.8 Chr18 (12069..14396) [2328 bp, 775 aa] {ON} YOR172W (R...    41   0.016
KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly...    41   0.016
ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}...    41   0.016
Kwal_56.22605 s56 (200072..202669) [2598 bp, 865 aa] {ON} YOL089...    41   0.016
YDR034C Chr4 complement(509737..512109) [2373 bp, 790 aa] {ON}  ...    41   0.017
NDAI0C04170 Chr3 complement(953071..955548) [2478 bp, 825 aa] {O...    41   0.017
KAFR0E01300 Chr5 (259207..261690) [2484 bp, 827 aa] {ON} Anc_5.3...    41   0.017
TPHA0M01040 Chr13 complement(202491..204803) [2313 bp, 770 aa] {...    41   0.017
NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.65...    41   0.017
YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}  OAF1Oleate-...    41   0.018
SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {...    41   0.019
KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.1...    41   0.019
KAFR0B06340 Chr2 (1311310..1313904) [2595 bp, 864 aa] {ON} Anc_8...    40   0.021
Ecym_5131 Chr5 (278980..281292) [2313 bp, 770 aa] {ON} similar t...    40   0.021
Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W (R...    40   0.021
KNAG0H01260 Chr8 (220201..222426) [2226 bp, 741 aa] {ON} Anc_3.2...    40   0.022
Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar t...    40   0.022
KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.2...    40   0.023
KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa] ...    40   0.023
Ecym_4144 Chr4 complement(306206..308728) [2523 bp, 840 aa] {ON}...    40   0.023
YOR172W Chr15 (654210..656570) [2361 bp, 786 aa] {ON}  YRM1Zn2-C...    40   0.024
Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON...    40   0.024
AGL091W Chr7 (535317..537917) [2601 bp, 866 aa] {ON} Syntenic ho...    40   0.025
KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa] {...    40   0.025
TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON} Anc_8...    40   0.026
Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 ...    40   0.026
Skud_4.287 Chr4 complement(501344..503698) [2355 bp, 784 aa] {ON...    40   0.027
TBLA0I01890 Chr9 complement(423851..426328) [2478 bp, 825 aa] {O...    40   0.028
Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W (R...    40   0.028
TDEL0E00300 Chr5 (64461..66374) [1914 bp, 637 aa] {ON}                 40   0.030
Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}...    40   0.031
NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {...    40   0.031
NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2....    40   0.033
CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa...    40   0.033
Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {O...    40   0.035
KLLA0F18084g Chr6 complement(1652031..1654613) [2583 bp, 860 aa]...    40   0.035
ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly...    40   0.035
NCAS0A10550 Chr1 (2100725..2102950) [2226 bp, 741 aa] {ON} Anc_3...    40   0.036
ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]...    40   0.037
TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa] {...    40   0.037
Kpol_1023.41 s1023 (88566..91013) [2448 bp, 815 aa] {ON} (88566....    40   0.038
TDEL0D00730 Chr4 complement(129036..131456) [2421 bp, 806 aa] {O...    40   0.038
KNAG0A02290 Chr1 (211626..214028) [2403 bp, 800 aa] {ON}               40   0.038
NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423     40   0.039
Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {O...    40   0.041
TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2....    40   0.041
NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON} Anc_2...    40   0.041
TDEL0G04890 Chr7 (903504..903581,903640..905316) [1755 bp, 584 a...    39   0.042
KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]...    40   0.043
NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON} Anc_7...    40   0.044
SAKL0G17622g Chr7 complement(1525163..1527193) [2031 bp, 676 aa]...    39   0.045
Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON} (71447.....    40   0.046
KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON} simi...    39   0.046
KLTH0D01804g Chr4 complement(173650..175608) [1959 bp, 652 aa] {...    39   0.049
KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa] {...    39   0.049
NDAI0A05750 Chr1 complement(1302180..1304459) [2280 bp, 759 aa] ...    39   0.049
TPHA0E01290 Chr5 (258004..260562) [2559 bp, 852 aa] {ON} Anc_5.3...    39   0.051
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    39   0.052
ZYRO0C18282g Chr3 (1431515..1433665) [2151 bp, 716 aa] {ON} cons...    39   0.053
Kpol_1008.13 s1008 (21147..23855) [2709 bp, 902 aa] {ON} (21147....    39   0.054
KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2....    39   0.055
ZYRO0G12584g Chr7 complement(996642..998702) [2061 bp, 686 aa] {...    39   0.055
KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {...    39   0.055
KLLA0A04169g Chr1 complement(376273..378600) [2328 bp, 775 aa] {...    39   0.055
Smik_12.549 Chr12 (964956..967616) [2661 bp, 886 aa] {ON} YLR451...    39   0.056
Kpol_1005.2 s1005 complement(1473..3992) [2520 bp, 839 aa] {ON} ...    39   0.059
KLTH0D00594g Chr4 (57414..59309) [1896 bp, 631 aa] {ON} conserve...    39   0.059
Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {...    39   0.059
SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]...    39   0.060
NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON}               39   0.060
Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON} (11943.....    39   0.061
Skud_13.43 Chr13 complement(73880..76522) [2643 bp, 880 aa] {ON}...    39   0.061
Kpol_529.15 s529 complement(38664..41510) [2847 bp, 948 aa] {ON}...    39   0.061
Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106...    39   0.062
KAFR0B02820 Chr2 complement(576317..578311) [1995 bp, 664 aa] {O...    39   0.062
Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON} ...    36   0.063
NDAI0C04840 Chr3 (1117201..1120047) [2847 bp, 948 aa] {ON} Anc_8...    39   0.063
CAGL0E05434g Chr5 (532814..535264) [2451 bp, 816 aa] {ON} simila...    39   0.064
YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putat...    39   0.064
Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL03...    39   0.065
KLLA0C16489g Chr3 (1444456..1446642) [2187 bp, 728 aa] {ON} cons...    39   0.065
KLTH0C06776g Chr3 complement(586976..590140) [3165 bp, 1054 aa] ...    39   0.065
NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa] {O...    39   0.067
SAKL0F15444g Chr6 (1243590..1246484) [2895 bp, 964 aa] {ON} simi...    39   0.067
YLR451W Chr12 (1036093..1038753) [2661 bp, 886 aa] {ON}  LEU3Zin...    39   0.068
SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]...    39   0.069
Kpol_1031.47 s1031 (125242..127926) [2685 bp, 894 aa] {ON} (1252...    39   0.071
Skud_8.113 Chr8 complement(188347..190992) [2646 bp, 881 aa] {ON...    39   0.071
KLTH0F07854g Chr6 complement(677647..680013) [2367 bp, 788 aa] {...    39   0.071
ZYRO0A09350g Chr1 (749695..752076) [2382 bp, 793 aa] {ON} simila...    39   0.071
NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {...    39   0.071
TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {O...    39   0.075
Skud_12.346 Chr12 complement(616734..618818) [2085 bp, 694 aa] {...    39   0.075
KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}      39   0.076
YML099C Chr13 complement(74398..77040) [2643 bp, 880 aa] {ON}  A...    39   0.077
Kwal_55.21884 s55 (1020057..1022705) [2649 bp, 882 aa] {ON} YLR4...    39   0.079
TDEL0B06360 Chr2 complement(1127150..1130095) [2946 bp, 981 aa] ...    39   0.081
KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON} Anc_2.6...    39   0.081
ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa] ...    39   0.083
NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]...    39   0.087
ZYRO0D01650g Chr4 complement(131688..134270) [2583 bp, 860 aa] {...    39   0.089
Suva_13.49 Chr13 complement(75704..78352) [2649 bp, 882 aa] {ON}...    39   0.089
Skud_12.544 Chr12 (969942..972608) [2667 bp, 888 aa] {ON} YLR451...    39   0.089
ZYRO0B14476g Chr2 complement(1175759..1177882) [2124 bp, 707 aa]...    39   0.090
Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343 ...    39   0.090
KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa] {...    39   0.090
Kpol_1061.37 s1061 complement(102667..104616) [1950 bp, 649 aa] ...    39   0.092
Smik_13.36 Chr13 complement(71547..74189) [2643 bp, 880 aa] {ON}...    39   0.097
Suva_8.421 Chr8 complement(757924..760932) [3009 bp, 1002 aa] {O...    39   0.098
SAKL0D02596g Chr4 (204347..206599) [2253 bp, 750 aa] {ON} conser...    39   0.099
TDEL0H00590 Chr8 complement(101024..103477) [2454 bp, 817 aa] {O...    38   0.10 
KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly...    38   0.11 
ZYRO0D08316g Chr4 (719929..721971) [2043 bp, 680 aa] {ON} conser...    38   0.11 
Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar...    38   0.11 
Ecym_4635 Chr4 complement(1238691..1241261) [2571 bp, 856 aa] {O...    38   0.12 
Skud_2.39 Chr2 complement(80293..83772) [3480 bp, 1159 aa] {ON} ...    38   0.12 
Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig ...    38   0.12 
KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa] ...    38   0.12 
SAKL0A01386g Chr1 (132287..134599) [2313 bp, 770 aa] {ON} conser...    38   0.12 
CAGL0D03850g Chr4 (384689..387193) [2505 bp, 834 aa] {ON} weakly...    38   0.13 
Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON} YDR03...    38   0.13 
CAGL0H00396g Chr8 complement(37005..39827) [2823 bp, 940 aa] {ON...    38   0.13 
NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {...    38   0.13 
YBL066C Chr2 complement(96669..100115) [3447 bp, 1148 aa] {ON}  ...    38   0.13 
Kwal_YGOB_gneas1 s33 complement(285483..287042) [1560 bp, 519 aa...    38   0.13 
KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly...    38   0.14 
Smik_2.50 Chr2 complement(90559..94011) [3453 bp, 1150 aa] {ON} ...    38   0.14 
KNAG0F03720 Chr6 (695079..697379) [2301 bp, 766 aa] {ON} Anc_7.5...    38   0.14 
TDEL0H03950 Chr8 (674423..676411) [1989 bp, 662 aa] {ON} Anc_7.5...    38   0.14 
Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {...    38   0.14 
Suva_2.51 Chr2 complement(93709..97176) [3468 bp, 1155 aa] {ON} ...    38   0.14 
KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON} Anc_2....    38   0.15 
ZYRO0B00242g Chr2 (12202..14118) [1917 bp, 638 aa] {ON} conserve...    38   0.15 
SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON} weak...    38   0.15 
KLTH0F18392g Chr6 (1484590..1487211) [2622 bp, 873 aa] {ON} simi...    38   0.15 
Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {O...    38   0.15 
KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]...    38   0.15 
TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON}       38   0.17 
ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some...    37   0.17 
AGR061C Chr7 complement(831052..832890) [1839 bp, 612 aa] {ON} S...    37   0.17 
ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} simila...    38   0.17 
YOR337W Chr15 (954344..956623) [2280 bp, 759 aa] {ON}  TEA1Ty1 e...    38   0.17 
KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa] {O...    37   0.17 
SAKL0B10538g Chr2 (910662..912767) [2106 bp, 701 aa] {ON} simila...    37   0.17 
KNAG0B02380 Chr2 complement(466392..469595) [3204 bp, 1067 aa] {...    38   0.18 
Smik_18.3 Chr18 complement(3105..5219) [2115 bp, 704 aa] {ON} YK...    37   0.18 
Ecym_7203 Chr7 (415869..418523) [2655 bp, 884 aa] {ON} similar t...    38   0.18 
Kwal_26.6805 s26 (71596..74430) [2835 bp, 944 aa] {ON} YAL051W (...    38   0.18 
KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {...    37   0.18 
Ecym_1146 Chr1 (302989..304986) [1998 bp, 665 aa] {ON} similar t...    37   0.18 
KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {...    38   0.18 
Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}...    37   0.19 
TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.2...    37   0.19 
CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON} simi...    37   0.19 
YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}  PDR3Transc...    37   0.19 
KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON} unip...    37   0.19 
Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W ...    37   0.19 
Skud_15.502 Chr15 (894741..897020) [2280 bp, 759 aa] {ON} YOR337...    37   0.19 
TPHA0I00860 Chr9 complement(188725..190215) [1491 bp, 496 aa] {O...    37   0.19 
SAKL0F12342g Chr6 (964262..967393) [3132 bp, 1043 aa] {ON} simil...    37   0.20 
Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 ...    37   0.20 
SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa] ...    37   0.20 
KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} simila...    37   0.20 
YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}  RGT1Gluc...    37   0.20 
AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic ho...    37   0.20 
NCAS0A03570 Chr1 complement(708718..711654) [2937 bp, 978 aa] {O...    37   0.21 
TBLA0B04800 Chr2 complement(1127000..1129333) [2334 bp, 777 aa] ...    37   0.21 
Smik_15.515 Chr15 (903950..906229) [2280 bp, 759 aa] {ON} YOR337...    37   0.21 
KAFR0H01800 Chr8 complement(333664..336048) [2385 bp, 794 aa] {O...    37   0.21 
CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]...    37   0.21 
TPHA0C04280 Chr3 complement(922743..926132) [3390 bp, 1129 aa] {...    37   0.21 
Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON} YKL22...    37   0.21 
YOL089C Chr15 complement(150398..153490) [3093 bp, 1030 aa] {ON}...    37   0.22 
Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}...    37   0.22 
Skud_2.106 Chr2 (200722..203754) [3033 bp, 1010 aa] {ON} YBL005W...    37   0.23 
ZYRO0D14432g Chr4 complement(1222977..1226489) [3513 bp, 1170 aa...    37   0.24 
Smik_2.115 Chr2 (210321..213236) [2916 bp, 971 aa] {ON} YBL005W ...    37   0.24 
YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON...    37   0.24 
KAFR0I00230 Chr9 (48095..51232) [3138 bp, 1045 aa] {ON} Anc_7.17...    37   0.25 
Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {O...    37   0.25 
Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}...    37   0.25 
Sklu_YGOB_gneas1 Chr3 complement(352893..354335) [1443 bp, 480 a...    37   0.26 
KLLA0E19603g Chr5 complement(1739869..1741914) [2046 bp, 681 aa]...    37   0.26 
Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W ...    37   0.26 
TBLA0F02920 Chr6 (700340..703111) [2772 bp, 923 aa] {ON} Anc_7.5...    37   0.26 
KLLA0D10593g Chr4 complement(900326..903103) [2778 bp, 925 aa] {...    37   0.26 
NCAS0D02720 Chr4 complement(520916..523189) [2274 bp, 757 aa] {O...    37   0.27 
KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {O...    37   0.27 
Suva_2.469 Chr2 complement(833514..836180) [2667 bp, 888 aa] {ON...    37   0.27 
SAKL0G09768g Chr7 (828604..830937) [2334 bp, 777 aa] {ON} simila...    37   0.27 
TBLA0H03910 Chr8 complement(943931..946234) [2304 bp, 767 aa] {O...    37   0.28 
Smik_4.552 Chr4 complement(1000275..1002938) [2664 bp, 887 aa] {...    37   0.29 
KAFR0B07080 Chr2 complement(1480370..1482397) [2028 bp, 675 aa] ...    37   0.29 
Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {O...    37   0.29 
TPHA0E03830 Chr5 complement(805860..808328) [2469 bp, 822 aa] {O...    37   0.30 
NDAI0J00440 Chr10 complement(78052..80523) [2472 bp, 823 aa] {ON...    37   0.30 
Ecym_5015 Chr5 (29616..32099) [2484 bp, 827 aa] {ON} similar to ...    37   0.30 
KAFR0B00100 Chr2 (2110..4137) [2028 bp, 675 aa] {ON}                   37   0.30 
NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56      37   0.30 
SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]...    37   0.31 
KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly...    37   0.31 
TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {O...    37   0.31 
KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some s...    37   0.32 
KLTH0D16456g Chr4 complement(1360294..1362279) [1986 bp, 661 aa]...    37   0.32 
KNAG0E00450 Chr5 complement(74721..76853) [2133 bp, 710 aa] {ON}...    37   0.32 
CAGL0A04455g Chr1 (437546..440842) [3297 bp, 1098 aa] {ON} simil...    37   0.32 
YDR303C Chr4 complement(1068729..1071386) [2658 bp, 885 aa] {ON}...    37   0.32 
TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON}                37   0.33 
Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106...    37   0.33 
Skud_4.565 Chr4 complement(1011134..1013803) [2670 bp, 889 aa] {...    37   0.33 
ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar ...    37   0.34 
TDEL0G04090 Chr7 complement(744499..746730) [2232 bp, 743 aa] {O...    37   0.35 
NCAS0H00270 Chr8 complement(45600..48320) [2721 bp, 906 aa] {ON}...    37   0.36 
TDEL0E03050 Chr5 (575425..577893) [2469 bp, 822 aa] {ON} Anc_5.3...    37   0.36 
YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}  G...    37   0.36 
YHR056C Chr8 complement(215183..217834) [2652 bp, 883 aa] {ON}  ...    37   0.36 
AAL057C Chr1 complement(246899..249328) [2430 bp, 809 aa] {ON} S...    37   0.36 
NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3....    37   0.37 
KLTH0F03300g Chr6 complement(283918..285474) [1557 bp, 518 aa] {...    36   0.37 
Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C ...    37   0.37 
NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {...    37   0.37 
KNAG0F02830 Chr6 (536483..538723) [2241 bp, 746 aa] {ON}               37   0.38 
TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa] {...    37   0.38 
NDAI0D01770 Chr4 (411567..413924) [2358 bp, 785 aa] {ON} Anc_5.322     37   0.38 
SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa] ...    37   0.40 
KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {...    36   0.41 
ACL195C Chr3 complement(19204..19533) [330 bp, 109 aa] {ON} NOHB...    34   0.41 
Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL03...    37   0.41 
KAFR0A03180 Chr1 complement(655176..657716) [2541 bp, 846 aa] {O...    36   0.41 
KLTH0E07854g Chr5 (719642..722458) [2817 bp, 938 aa] {ON} weakly...    36   0.41 
Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C ...    36   0.44 
NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {O...    36   0.44 
Kwal_14.819 s14 complement(63184..64890) [1707 bp, 568 aa] {ON} ...    36   0.44 
SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON...    36   0.45 
NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON}               36   0.45 
Smik_8.127 Chr8 complement(190428..193079) [2652 bp, 883 aa] {ON...    36   0.45 
NDAI0B01680 Chr2 (398598..401372) [2775 bp, 924 aa] {ON} Anc_2.547     36   0.47 
Suva_10.569 Chr10 (990917..992962,992995..993603) [2655 bp, 884 ...    36   0.47 
ADR404C Chr4 complement(1432320..1434947) [2628 bp, 875 aa] {ON}...    36   0.48 
NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {O...    36   0.48 
ADR365W Chr4 (1355407..1357512) [2106 bp, 701 aa] {ON} Syntenic ...    36   0.48 
NDAI0A06990 Chr1 (1593540..1596476) [2937 bp, 978 aa] {ON} Anc_3...    36   0.48 
SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {...    36   0.48 
Kwal_56.24566 s56 (1057546..1059813) [2268 bp, 755 aa] {ON} [con...    36   0.49 
TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {...    36   0.49 
NCAS0B02930 Chr2 (504501..506606) [2106 bp, 701 aa] {ON} Anc_8.416     36   0.50 
Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL03...    36   0.51 
NDAI0D00220 Chr4 complement(43353..46187) [2835 bp, 944 aa] {ON}...    36   0.51 
NCAS0E02620 Chr5 complement(523279..526626) [3348 bp, 1115 aa] {...    36   0.52 
Ecym_5044 Chr5 complement(91778..94489) [2712 bp, 903 aa] {ON} s...    36   0.52 
Smik_2.151 Chr2 (282822..285581) [2760 bp, 919 aa] {ON} YBR033W ...    36   0.52 
Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W ...    36   0.53 
Kpol_1071.10 s1071 (22248..24344) [2097 bp, 698 aa] {ON} (22248....    36   0.53 
KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} som...    36   0.54 
TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {...    36   0.55 
KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.2...    36   0.56 
ZYRO0C13882g Chr3 complement(1093041..1095542) [2502 bp, 833 aa]...    36   0.56 
SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON...    36   0.56 
AGL233C Chr7 complement(260414..263032) [2619 bp, 872 aa] {ON} N...    36   0.58 
Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}...    36   0.58 
KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.8...    36   0.60 
Ecym_2672 Chr2 (1294580..1296799) [2220 bp, 739 aa] {ON} similar...    36   0.61 
Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON} ...    34   0.62 
CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {...    36   0.63 
TBLA0G01090 Chr7 complement(275031..277499) [2469 bp, 822 aa] {O...    36   0.65 
Kwal_14.915 s14 (110216..112684) [2469 bp, 822 aa] {ON} YKL015W ...    36   0.65 
Smik_15.67 Chr15 complement(113506..116598) [3093 bp, 1030 aa] {...    36   0.68 
KLLA0F22880g Chr6 (2123577..2127071) [3495 bp, 1164 aa] {ON} som...    36   0.68 
NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON}            36   0.68 
YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON} Pu...    35   0.68 
TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.2...    36   0.69 
NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56      35   0.70 
Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar t...    35   0.70 
KAFR0B04830 Chr2 (1003592..1005487) [1896 bp, 631 aa] {ON} Anc_2...    35   0.72 
KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa...    35   0.73 
SAKL0D14916g Chr4 complement(1233415..1235313) [1899 bp, 632 aa]...    35   0.73 
TPHA0F02540 Chr6 (556797..559178) [2382 bp, 793 aa] {ON} Anc_6.6...    35   0.73 
KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {O...    35   0.75 
KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17 ...    35   0.77 
TBLA0E01110 Chr5 (243534..246755) [3222 bp, 1073 aa] {ON} Anc_6....    35   0.77 
SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON} conse...    35   0.77 
SAKL0H25146g Chr8 complement(2185695..2187632) [1938 bp, 645 aa]...    35   0.79 
KAFR0A04940 Chr1 (975356..978913) [3558 bp, 1185 aa] {ON} Anc_6....    35   0.80 
SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly...    35   0.80 
KAFR0G02540 Chr7 complement(524919..527486) [2568 bp, 855 aa] {O...    35   0.80 
Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {O...    35   0.80 
TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa] ...    35   0.82 
KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} simila...    35   0.82 
Kpol_1061.42 s1061 complement(116430..119819) [3390 bp, 1129 aa]...    35   0.83 
CAGL0D02904g Chr4 complement(302952..305615) [2664 bp, 887 aa] {...    35   0.83 
TBLA0B07050 Chr2 (1669768..1671996) [2229 bp, 742 aa] {ON}             35   0.84 
Ecym_3200 Chr3 complement(384639..387116) [2478 bp, 825 aa] {ON}...    35   0.85 
YLR266C Chr12 complement(675619..677724) [2106 bp, 701 aa] {ON} ...    35   0.86 
Skud_6.15 Chr6 complement(24031..25701) [1671 bp, 556 aa] {ON} Y...    35   0.86 
KLLA0D12650g Chr4 complement(1073580..1075535) [1956 bp, 651 aa]...    35   0.86 
KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa] ...    35   0.90 
Smik_25.2 Chr25 (2105..4462) [2358 bp, 785 aa] {ON} YER184C (REAL)     35   0.91 
KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} simil...    35   0.92 
KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON} conser...    35   0.92 
TBLA0B04740 Chr2 complement(1110720..1112675) [1956 bp, 651 aa] ...    35   0.92 
AGL083W Chr7 (550291..552861) [2571 bp, 856 aa] {ON} Syntenic ho...    35   0.97 
Suva_15.425 Chr15 (750153..752087) [1935 bp, 644 aa] {ON} YLR098...    35   0.98 
NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279     35   0.98 
KNAG0M00970 Chr13 (169393..172926) [3534 bp, 1177 aa] {ON} Anc_6...    35   0.98 
KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5....    35   0.98 
Kpol_1018.92 s1018 (244116..247298) [3183 bp, 1060 aa] {ON} (244...    35   0.99 
NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa] {O...    35   1.0  
SAKL0D08008g Chr4 complement(665498..669184) [3687 bp, 1228 aa] ...    35   1.0  
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    35   1.0  
Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C (...    35   1.0  
KLLA0E20307g Chr5 (1806005..1809364) [3360 bp, 1119 aa] {ON} uni...    35   1.0  
Kwal_26.6732 s26 (43580..45610) [2031 bp, 676 aa] {ON} [contig 4...    35   1.1  
NDAI0D02730 Chr4 (629970..633647) [3678 bp, 1225 aa] {ON} Anc_6....    35   1.1  
KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly...    35   1.1  
ADR405C Chr4 complement(1435702..1438125) [2424 bp, 807 aa] {ON}...    35   1.1  
TDEL0C01580 Chr3 complement(272178..275687) [3510 bp, 1169 aa] {...    35   1.1  
SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {...    35   1.1  
NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa] {O...    35   1.1  
Skud_4.795 Chr4 complement(1401165..1403492) [2328 bp, 775 aa] {...    35   1.1  
Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}...    35   1.2  
AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON} S...    35   1.2  
YNR063W Chr14 (746943..748766) [1824 bp, 607 aa] {ON} Putative z...    35   1.2  
Ecym_5001 Chr5 (915..2738) [1824 bp, 607 aa] {ON} similar to Ash...    35   1.2  
Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa] ...    35   1.3  
Ecym_3112 Chr3 (203876..207310) [3435 bp, 1144 aa] {ON} similar ...    35   1.3  
KNAG0F03040 Chr6 complement(576753..580325) [3573 bp, 1190 aa] {...    35   1.3  
YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON} ...    35   1.3  
TDEL0D06620 Chr4 (1197405..1199084) [1680 bp, 559 aa] {ON}             35   1.3  
Kwal_26.6664 s26 complement(11094..12833) [1740 bp, 579 aa] {ON}...    35   1.3  
Smik_15.547 Chr15 complement(966368..969355) [2988 bp, 995 aa] {...    35   1.3  
TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa] ...    35   1.3  
Suva_10.18 Chr10 complement(36048..38576) [2529 bp, 842 aa] {ON}...    35   1.4  
KAFR0G02520 Chr7 complement(522206..524722) [2517 bp, 838 aa] {O...    35   1.4  
TDEL0A02690 Chr1 (485785..487953) [2169 bp, 722 aa] {ON}               35   1.4  
Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646 b...    35   1.4  
KAFR0L01720 Chr12 (313720..316545) [2826 bp, 941 aa] {ON} Anc_7....    35   1.4  
KLTH0H16236g Chr8 (1400457..1402148) [1692 bp, 563 aa] {ON} cons...    35   1.4  
TPHA0J00190 Chr10 (44450..45142) [693 bp, 230 aa] {ON}                 34   1.5  
Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to ...    35   1.5  
KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa] ...    35   1.5  
YFL052W Chr6 (28232..29629) [1398 bp, 465 aa] {ON} Putative zinc...    34   1.5  
TBLA0G00730 Chr7 complement(165589..167994) [2406 bp, 801 aa] {O...    35   1.6  
NCAS0B05110 Chr2 complement(951685..953485,953561..953643) [1884...    34   1.6  
NCAS0F00370 Chr6 complement(61819..65148) [3330 bp, 1109 aa] {ON...    35   1.6  
TBLA0C04000 Chr3 complement(961730..963748) [2019 bp, 672 aa] {O...    34   1.6  
Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052...    34   1.6  
CAGL0M02651g Chr13 complement(304583..305971) [1389 bp, 462 aa] ...    34   1.6  
Kpol_1061.19 s1061 (51386..54709) [3324 bp, 1107 aa] {ON} (51386...    35   1.6  
Kwal_47.16939 s47 (180147..182156) [2010 bp, 669 aa] {ON} [conti...    34   1.6  
SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {...    34   1.6  
Kwal_27.10852 s27 complement(526456..529596) [3141 bp, 1046 aa] ...    34   1.6  
ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]...    34   1.7  
YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}  MAL33MAL-a...    34   1.7  
KNAG0M01560 Chr13 (276011..278863) [2853 bp, 950 aa] {ON} Anc_5....    34   1.7  
SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]...    34   1.8  
ZYRO0D14080g Chr4 (1191418..1194183) [2766 bp, 921 aa] {ON} weak...    34   1.8  
Kwal_14.931 s14 complement(119423..122608) [3186 bp, 1061 aa] {O...    34   1.8  
SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {...    34   1.8  
ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar...    34   1.8  
Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar t...    34   1.8  
TBLA0E05030 Chr5 complement(1294821..1297529) [2709 bp, 902 aa] ...    34   1.8  
TDEL0C05790 Chr3 (1045249..1047057) [1809 bp, 602 aa] {ON}             34   1.9  
Kwal_56.24670 s56 complement(1099601..1101532) [1932 bp, 643 aa]...    34   1.9  
ZYRO0D14058g Chr4 (1188615..1190891) [2277 bp, 758 aa] {ON} simi...    34   1.9  
KLLA0D05038g Chr4 (433653..435674) [2022 bp, 673 aa] {ON} simila...    34   2.0  
NDAI0A01040 Chr1 complement(220931..223918) [2988 bp, 995 aa] {O...    34   2.0  
ACR028C Chr3 complement(408701..410506) [1806 bp, 601 aa] {ON} N...    34   2.0  
Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {O...    34   2.1  
Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W ...    34   2.1  
KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {O...    34   2.1  
YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}  MAL13MAL...    34   2.2  
AGL206C Chr7 complement(311846..314053) [2208 bp, 735 aa] {ON} N...    34   2.2  
KLTH0A07766g Chr1 (654163..655980) [1818 bp, 605 aa] {ON} conser...    34   2.2  
NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON} Anc_2...    34   2.2  
AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON} N...    34   2.3  
KLTH0C00880g Chr3 complement(85841..89098) [3258 bp, 1085 aa] {O...    34   2.3  
SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} simi...    34   2.4  
KNAG0B01840 Chr2 (345204..348422) [3219 bp, 1072 aa] {ON} Anc_1....    34   2.4  
Kwal_33.13934 s33 complement(456687..459080) [2394 bp, 797 aa] {...    34   2.5  
NDAI0J02230 Chr10 complement(542750..545359) [2610 bp, 869 aa] {...    34   2.5  
Ecym_2345 Chr2 (676841..678754) [1914 bp, 637 aa] {ON} similar t...    34   2.5  
KLTH0A06644g Chr1 complement(553084..555270) [2187 bp, 728 aa] {...    33   2.7  
AER291C Chr5 complement(1172383..1174374) [1992 bp, 663 aa] {ON}...    33   2.8  
TDEL0G04100 Chr7 complement(746975..749074) [2100 bp, 699 aa] {O...    33   2.8  
CAGL0M05907g Chr13 (622029..624704) [2676 bp, 891 aa] {ON} simil...    33   2.9  
ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa...    33   3.0  
AGR369W Chr7 (1412833..1415988) [3156 bp, 1051 aa] {ON} Syntenic...    33   3.0  
TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON}                 33   3.0  
TBLA0A07480 Chr1 (1852023..1854782) [2760 bp, 919 aa] {ON} Anc_1...    33   3.2  
YLR278C Chr12 complement(699999..704024) [4026 bp, 1341 aa] {ON}...    33   3.4  
ADR375W Chr4 (1378248..1380026) [1779 bp, 592 aa] {ON} NOHBY445;...    33   3.5  
SAKL0F00418g Chr6 (34751..36430) [1680 bp, 559 aa] {ON} conserve...    33   3.6  
Skud_12.361 Chr12 complement(641047..645075) [4029 bp, 1342 aa] ...    33   3.6  
KNAG0M00130 Chr13 complement(15079..17142) [2064 bp, 687 aa] {ON}      33   3.7  
SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {...    33   3.7  
KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON}               33   3.8  
TBLA0G00520 Chr7 (108060..110696) [2637 bp, 878 aa] {ON} Anc_6.6...    33   3.8  
SAKL0G07634g Chr7 (636596..639364) [2769 bp, 922 aa] {ON} some s...    33   4.0  
KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}...    33   4.1  
KLTH0H01672g Chr8 complement(148024..150129) [2106 bp, 701 aa] {...    33   4.1  
NDAI0C04790 Chr3 complement(1100952..1104053) [3102 bp, 1033 aa]...    33   4.2  
Smik_26.8 Chr26 (8892..9242) [351 bp, 117 aa] {ON} YER184C (REAL)      31   4.3  
Smik_6.23 Chr6 complement(37285..38955) [1671 bp, 556 aa] {ON} Y...    33   4.3  
Kwal_33.13118 s33 (80421..82760) [2340 bp, 779 aa] {ON} YDR520C ...    33   4.5  
Smik_23.3 Chr23 complement(4675..6111) [1437 bp, 478 aa] {ON} YB...    33   4.5  
YLR098C Chr12 complement(337527..339473) [1947 bp, 648 aa] {ON} ...    33   4.5  
TDEL0G04920 Chr7 complement(912754..914844) [2091 bp, 696 aa] {O...    33   4.9  
KLTH0A03498g Chr1 complement(301696..303915) [2220 bp, 739 aa] {...    33   5.0  
Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380...    33   5.5  
Ecym_4686 Chr4 complement(1336279..1339581) [3303 bp, 1100 aa] {...    33   5.8  
NCAS0F00310 Chr6 (49514..52084) [2571 bp, 856 aa] {ON}                 33   5.9  
KLLA0F02299g Chr6 (205549..208167) [2619 bp, 872 aa] {ON} conser...    33   5.9  
SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa...    33   6.0  
SAKL0B12518g Chr2 (1072142..1073932) [1791 bp, 596 aa] {ON} cons...    32   6.1  
Smik_15.342 Chr15 complement(595611..595820,595851..598070) [243...    32   6.3  
Suva_10.10 Chr10 complement(16722..18389) [1668 bp, 555 aa] {ON}...    32   6.4  
TPHA0E00880 Chr5 complement(177030..180164) [3135 bp, 1044 aa] {...    32   6.5  
Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}...    31   6.6  
Kwal_47.17233 s47 (309658..312504) [2847 bp, 948 aa] {ON} [conti...    32   6.8  
Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}...    32   7.0  
SAKL0F11198g Chr6 complement(873587..875866) [2280 bp, 759 aa] {...    32   7.7  
KLLA0D00396g Chr4 complement(36277..37362) [1086 bp, 361 aa] {ON...    32   8.0  
TBLA0C00940 Chr3 (187969..190338) [2370 bp, 789 aa] {ON} Anc_2.6...    32   8.3  

>Kpol_1028.82 s1028 complement(183595..186372) [2778 bp, 925 aa]
           {ON} complement(183595..186372) [2778 nt, 926 aa]
          Length = 925

 Score = 1740 bits (4507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 855/925 (92%), Positives = 855/925 (92%)

Query: 1   MSLSKRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECI 60
           MSLSKRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECI
Sbjct: 1   MSLSKRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECI 60

Query: 61  FPVTKRRDVTAKINNMKGSELERXXXXXXLPDVDKKSLNGGGSAGSDLKQNNIRKKPTDS 120
           FPVTKRRDVTAKINNMKGSELER      LPDVDKKSLNGGGSAGSDLKQNNIRKKPTDS
Sbjct: 61  FPVTKRRDVTAKINNMKGSELERSIISSILPDVDKKSLNGGGSAGSDLKQNNIRKKPTDS 120

Query: 121 NWQSDISTMQTALEFLANAVGVISKSDTRSLLNLNQNNTLIXXXXXXXXXXXXXXXXXXX 180
           NWQSDISTMQTALEFLANAVGVISKSDTRSLLNLNQNNTLI                   
Sbjct: 121 NWQSDISTMQTALEFLANAVGVISKSDTRSLLNLNQNNTLIENEDADDSNPNNDNSEDVS 180

Query: 181 RSDSNTPKSRNSIFSLIHDDTASKVISPLMGTIESIRPKPTRNLSDIEYIGPNKLLTEDE 240
           RSDSNTPKSRNSIFSLIHDDTASKVISPLMGTIESIRPKPTRNLSDIEYIGPNKLLTEDE
Sbjct: 181 RSDSNTPKSRNSIFSLIHDDTASKVISPLMGTIESIRPKPTRNLSDIEYIGPNKLLTEDE 240

Query: 241 ARTLINVFFLTMHPYFPYIPLQLHNPDELVRYPILLCAILTVSSRYNSFNEIFINNEYEK 300
           ARTLINVFFLTMHPYFPYIPLQLHNPDELVRYPILLCAILTVSSRYNSFNEIFINNEYEK
Sbjct: 241 ARTLINVFFLTMHPYFPYIPLQLHNPDELVRYPILLCAILTVSSRYNSFNEIFINNEYEK 300

Query: 301 DRNIVVHEKLWFYCQRLISNTIWAEASTRSIGTILAFLLFTEWNPRAIHWTWSDYGNNPE 360
           DRNIVVHEKLWFYCQRLISNTIWAEASTRSIGTILAFLLFTEWNPRAIHWTWSDYGNNPE
Sbjct: 301 DRNIVVHEKLWFYCQRLISNTIWAEASTRSIGTILAFLLFTEWNPRAIHWTWSDYGNNPE 360

Query: 361 LTCFTKNNENNMSEFKGEKTTGFEAMRHSDRMAWMFTGSAVRLAQDMHFIDNNYKIFMAT 420
           LTCFTKNNENNMSEFKGEKTTGFEAMRHSDRMAWMFTGSAVRLAQDMHFIDNNYKIFMAT
Sbjct: 361 LTCFTKNNENNMSEFKGEKTTGFEAMRHSDRMAWMFTGSAVRLAQDMHFIDNNYKIFMAT 420

Query: 421 HISETFNAMNVNQRXXXXXXXXXXXXXXXRSHGKNNDDEEGHIFAENFGNEQYYLEQILK 480
           HISETFNAMNVNQR               RSHGKNNDDEEGHIFAENFGNEQYYLEQILK
Sbjct: 421 HISETFNAMNVNQRSTLSDSLSNINLSITRSHGKNNDDEEGHIFAENFGNEQYYLEQILK 480

Query: 481 HDKSKEKWIKFLXXXXXXXXXXXXTVITDAEREYLNDEYILYYQNNNPETQPTWGNHSVT 540
           HDKSKEKWIKFL            TVITDAEREYLNDEYILYYQNNNPETQPTWGNHSVT
Sbjct: 481 HDKSKEKWIKFLKEINSNKSSENSTVITDAEREYLNDEYILYYQNNNPETQPTWGNHSVT 540

Query: 541 STSLPYPLKFASFHKAKIEILRIMSIAYETIYSAKNKRVLAFNNQRQNLAVLSIFSPLIE 600
           STSLPYPLKFASFHKAKIEILRIMSIAYETIYSAKNKRVLAFNNQRQNLAVLSIFSPLIE
Sbjct: 541 STSLPYPLKFASFHKAKIEILRIMSIAYETIYSAKNKRVLAFNNQRQNLAVLSIFSPLIE 600

Query: 601 SWYSNHHGLLKLFECAPCDMSKYKDKNTVQKLSQAIEKESLIGDYYYCQLYIYSLALKVD 660
           SWYSNHHGLLKLFECAPCDMSKYKDKNTVQKLSQAIEKESLIGDYYYCQLYIYSLALKVD
Sbjct: 601 SWYSNHHGLLKLFECAPCDMSKYKDKNTVQKLSQAIEKESLIGDYYYCQLYIYSLALKVD 660

Query: 661 IKDNNLNLSEITKSAKYVYMAYNAAKEILTSAVRVNKLKLLRYLPVRWVTRILRSVAFIV 720
           IKDNNLNLSEITKSAKYVYMAYNAAKEILTSAVRVNKLKLLRYLPVRWVTRILRSVAFIV
Sbjct: 661 IKDNNLNLSEITKSAKYVYMAYNAAKEILTSAVRVNKLKLLRYLPVRWVTRILRSVAFIV 720

Query: 721 KCFXXXXXXXXXXXXXXXXXXRLSGIPVDEALELIETTSVTLNDASPDELHLCKRYSSIL 780
           KCF                  RLSGIPVDEALELIETTSVTLNDASPDELHLCKRYSSIL
Sbjct: 721 KCFLLLTESETSENSEINAIIRLSGIPVDEALELIETTSVTLNDASPDELHLCKRYSSIL 780

Query: 781 LYMCKELRNKTQNLYMNEGVAAKQENADVKVGNKSLENLSSIENSQEPIEPFIMNEHPQT 840
           LYMCKELRNKTQNLYMNEGVAAKQENADVKVGNKSLENLSSIENSQEPIEPFIMNEHPQT
Sbjct: 781 LYMCKELRNKTQNLYMNEGVAAKQENADVKVGNKSLENLSSIENSQEPIEPFIMNEHPQT 840

Query: 841 ELPINTTEQIAIVGNEHHGIEQTPILNPNSMSFQGEVIDWFSSSADIGLEFVESWTEMIE 900
           ELPINTTEQIAIVGNEHHGIEQTPILNPNSMSFQGEVIDWFSSSADIGLEFVESWTEMIE
Sbjct: 841 ELPINTTEQIAIVGNEHHGIEQTPILNPNSMSFQGEVIDWFSSSADIGLEFVESWTEMIE 900

Query: 901 QMYLRSSDGDQNIHVNSLFGHMDRN 925
           QMYLRSSDGDQNIHVNSLFGHMDRN
Sbjct: 901 QMYLRSSDGDQNIHVNSLFGHMDRN 925

>SAKL0G04884g Chr7 (400351..403143) [2793 bp, 930 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 930

 Score =  767 bits (1981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/941 (44%), Positives = 562/941 (59%), Gaps = 75/941 (7%)

Query: 1   MSLSKRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECI 60
           M+  KR L E    Q  KWRR+Y+AC+NCR+RK+KCDLGP+DNPH PPCVRCKRE++ECI
Sbjct: 1   MNNKKRTLFETQQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECI 60

Query: 61  FPVTKRRDVTAKINNMKGSELERXXXXXXLPDVDKKSLNGGGSAGS---DLK-QNNIRKK 116
           F  + +R    ++ N+             +         G  S GS   D K +N+I   
Sbjct: 61  FTESNKRG-GLRVANVSAIAENTANATASMSKAITSVFQGNTSEGSQQPDFKRENSIDPL 119

Query: 117 PTDSNWQSDISTMQTALEFLANAVGVISKSDTRSLLNLNQNNTLIXXXXXXXXXX---XX 173
           P +S    +++TMQ ALEFLA A G ++K D+R L++ +     +               
Sbjct: 120 PINS----ELTTMQDALEFLAKAAGSVAKEDSRDLVDASTKYEELESQSNSRTDTPISSG 175

Query: 174 XXXXXXXRSDSNTPKSRNSIFSLIHDDTASKVISPLMGTIESIRPKPTRNLSDIEYIGPN 233
                   S+S        I  L+      +   PL+  + S+RPKP+R L+DIEYIG  
Sbjct: 176 SAQDSTRNSNSANIPDEACIAPLLRPHGLGRPTIPLIEKLSSVRPKPSRRLTDIEYIGTL 235

Query: 234 KLLTEDEARTLINVFFLTMHPYFPYIPLQLHNPDELVRYPILLCAILTVSSRYNSFNEIF 293
           K+L+E+EA  LI++FFLTMHP+FP++PLQL NPDEL +YPILLCAILT+SSRY+SF+E+ 
Sbjct: 236 KMLSEEEAVKLIDLFFLTMHPFFPHVPLQLQNPDELAQYPILLCAILTISSRYHSFDEVN 295

Query: 294 INNEYEKDRNIVVHEKLWFYCQRLISNTIWAEASTRSIGTILAFLLFTEWNPRAIHWTWS 353
           + N    +RN+ +HE+LW YCQRLIS T+WAEASTRSIGT+LAFLLFTEWNPRAIHW WS
Sbjct: 296 MYNGESNNRNVEIHERLWIYCQRLISQTVWAEASTRSIGTVLAFLLFTEWNPRAIHWRWS 355

Query: 354 DYGNNPELTCFTKNNENNM-----------SEFKGEKTTGFEAMRHSDRMAWMFTGSAVR 402
           DY NNP+L   +K + +N+           S+  G+  TG  AMR SDRMAWM TG+AVR
Sbjct: 356 DYANNPDLNDVSKRDLSNVACSSSSSTACNSQQHGDGLTGLSAMRRSDRMAWMLTGTAVR 415

Query: 403 LAQDMHFIDNNYKIFMATHISETFNAMNVNQRXXXXXXXXXXXXXXXRSHGKNNDDEEGH 462
           LAQDM F++ + KIF ATHISET  AMN+NQR                 +G  +D E   
Sbjct: 416 LAQDMGFMNTSSKIFTATHISETHTAMNMNQRSILSQSLAEINL-----NGYEDDVE--- 467

Query: 463 IFAENFGNEQYYLEQILKHDKSKEKWIKFLXXXXXXXXXXXXTVITDAEREYLNDEYILY 522
                  NE YYL QILK D SKE+W KFL              + D ERE++NDEY+LY
Sbjct: 468 -------NESYYLGQILKSDGSKERWSKFLKKLGSSSTRGR---MNDIEREFVNDEYVLY 517

Query: 523 YQNNNPE-------TQPTWGNHSVTSTSLPYPLKFASFHKAKIEILRIMSIAYETIYSAK 575
           Y + +         T     N        PY LKF+   +AKIE+LRIMSI YETIY  K
Sbjct: 518 YSDKDGAPAHADEYTMNDDKNRKKQIEEEPYNLKFSFGQRAKIELLRIMSIGYETIYRGK 577

Query: 576 NKRVLAFNNQRQNLAVLSIFSPLIESWYSNHHGLLKLFECAPCDMSKYKDKNTVQKLSQA 635
            K  L  N+Q  NLA+LSI SPLIESWY+ +  +LK    A C+ +   +K  + +L++ 
Sbjct: 578 LK--LYSNSQYHNLALLSILSPLIESWYNTYKTILKPCSGAACNTAMCSEKKYIFELTEK 635

Query: 636 IEKESLIGDYYYCQLYIYSLALKVDI---KDNNLNLSEITKSAKYVYMAYNAAKEILTSA 692
           +++ESLI DYYYCQLYIYSLAL+VD+   KD  L ++EITK A+YV +AYNAAKEIL SA
Sbjct: 636 VDRESLISDYYYCQLYIYSLALQVDVGTPKDKKLRMNEITKCARYVELAYNAAKEILNSA 695

Query: 693 VRVNKLKLLRYLPVRWVTRILRSVAFIVKCFXXXXXXXXXXXXXXXXXXRLSGIPVDEAL 752
           +RV+KLK+L+Y+PVRWVTRI+RSVAF+VKC+                   LS IP +E +
Sbjct: 696 IRVHKLKMLKYMPVRWVTRIVRSVAFVVKCYLTLTGSGIATNPEANTILTLSVIPTEEII 755

Query: 753 ELIETTSVTLNDASPDELHLCKRYSSILLYMCKELRNKTQ---NLYMNEGVAAKQENADV 809
           + I+  ++TL +ASPDELHLC RYS+IL+Y+C E++ +++      +   ++ + E   V
Sbjct: 756 QTIQRAAITLREASPDELHLCTRYSTILMYLCTEMKLRSRPNPQPPVPRSISEQPEQISV 815

Query: 810 KV-----GNKSLENLSSIENSQEPIEPFIMNEHPQ-TELPINTTEQIAIVGNEHHGIEQT 863
           +      G             + P+ P  MN  P+ T    N     +  G + H +   
Sbjct: 816 ETTFNFCGKNETHEKGQGSQQRGPLPPPRMNSLPETTNFAFNVDNFFSPQGAQTHHLPT- 874

Query: 864 PILNPNSMSFQGEVIDWFSSSADIGLEFVESWTEMIEQMYL 904
                       +V+DWFS+S +IGL+FVE WTEMIEQ ++
Sbjct: 875 ------------QVVDWFSTSDEIGLDFVEPWTEMIEQQFI 903

>TPHA0L00350 Chr12 complement(47367..49946) [2580 bp, 859 aa] {ON} 
          Length = 859

 Score =  757 bits (1954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/923 (46%), Positives = 550/923 (59%), Gaps = 81/923 (8%)

Query: 9   SEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF--PVTKR 66
           S+ +     KW+RS+RAC  CR RKIKC+LGPLDNPHKPPC RCKREQRECIF  P  K 
Sbjct: 3   SKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKS 62

Query: 67  RDVTAKINNMKGSELERXXXXXXLPDVDKKSLNGGGSAGSDLKQNNIRKKPTDSNWQSDI 126
           R ++ K  N      +           D K  N        L+         DS W+SD+
Sbjct: 63  RSLSPKDINYGDDGDDNKLKFIHYQQGDNKGANNKEIQNMALE---------DSAWESDV 113

Query: 127 STMQTALEFLANAVGVISKSDTRSLLNLNQNNTLIXXXXXXXXXXXXXXXXXXXRSDSNT 186
           S+MQ ALE+LA+A   +S+ +       N   T                      S S  
Sbjct: 114 SSMQNALEYLASAAKSVSQFE-------NHKPT--------------SKLSDMVNSYSKD 152

Query: 187 PKSRNSIFSLIHDDTASK-VISPLMGTIESIRPKPTRNLSDIEYIGPNKLLTEDEARTLI 245
             ++ +I   + + T  K   S L+  +  IR KP + LSDI YIG +KLLTE+EAR LI
Sbjct: 153 DMTQENIIKELFEKTELKNPASSLIAQLSRIRTKPHKKLSDIVYIGDDKLLTEEEARRLI 212

Query: 246 NVFFLTMHPYFPYIPLQLHNPDELVRYPILLCAILTVSSRYNSFNEIFINNEYEKDRNIV 305
            VFF  +HP+FPYIPLQLHNP++LVRYPILLCA++T+S+RYN+F ++ +      D NI 
Sbjct: 213 EVFFQKLHPFFPYIPLQLHNPEQLVRYPILLCAVITISARYNNFGDLDLKTRESPDYNIT 272

Query: 306 VHEKLWFYCQRLISNTIWAEASTRSIGTILAFLLFTEWNPRAIHWTWSDYGNNPELTCFT 365
           +HEKLW YCQRLIS TIWAEASTRSIGTILAFLLFTEWNPRAIHW WSDY N+ E   F 
Sbjct: 273 IHEKLWMYCQRLISRTIWAEASTRSIGTILAFLLFTEWNPRAIHWNWSDYANDSETINFN 332

Query: 366 KNNE-NNMSEFKGEKTTGFEAMRHSDRMAWMFTGSAVRLAQDMHFIDNNYKIFMATHISE 424
           + NE + ++ +KGE  TGFEAMRHSDRMAWM TGSAVRLAQDM FID + KIF+ATHI+E
Sbjct: 333 ELNEFDPINSYKGESITGFEAMRHSDRMAWMLTGSAVRLAQDMKFIDTSNKIFLATHIAE 392

Query: 425 TFNAMNVNQRXXXXXXXXXXXXXXXRSHGKNNDDE---EGHIFAENFGNEQYYLEQILKH 481
           T+NAMNVN R                 H K  D     +G      FGNE+YYLEQI K+
Sbjct: 393 TYNAMNVNLRSSLSESLSNVNI-----HSKKIDPVKIIDGKKSERYFGNEKYYLEQIFKN 447

Query: 482 DKSKEKWIKFLXXXXXXXXXXXXTVITDAEREYLNDEYILYYQNNNPETQPTWGNHSVTS 541
            K +E     L                D ER++LNDEYIL+Y N +  TQ         +
Sbjct: 448 AKDRESSYDLLENILRERRNAK--AFPDNERDFLNDEYILFYSNPDDATQ---------N 496

Query: 542 TSLPYPLKFASFHKAKIEILRIMSIAYETIYSAKNKRVLAFNNQRQNLAVLSIFSPLIES 601
             L  PL F    +AKIE+L+IMSI YETIY  K +R    NNQ+QNLA+L+IFS LI+S
Sbjct: 497 DELDTPLDFTVIQRAKIELLKIMSIGYETIYLEKGRRYTTANNQKQNLAMLNIFSALIDS 556

Query: 602 WYSNHHGLLKLFECAPCDMSKYKDKNTVQKLSQAIEKESLIGDYYYCQLYIYSLALKVDI 661
           WY N++ LL   E    D      K  +Q ++Q IE ESLI DYYYCQLYIYSL+L+V+ 
Sbjct: 557 WYVNYNELLSPEET--LDPVLNASKMGLQSMTQIIENESLICDYYYCQLYIYSLSLQVED 614

Query: 662 KDNNLNLSEITKSAKYVYMAYNAAKEILTSAVRVNKLKLLRYLPVRWVTRILRSVAFIVK 721
           +++ L L E+++SAKYV +AY++AKEIL SA R+ ++++L+++PVRWV RI+R+++FIVK
Sbjct: 615 EESKLKLKELSQSAKYVSIAYSSAKEILNSAKRLQEVRMLKFIPVRWVIRIVRAISFIVK 674

Query: 722 CFXXXXXXXXXXXXXXXXXXRLSGIPVDEALELIETTSVTLNDASPDELHLCKRYSSILL 781
           C+                   LSGIPVDE+LELI T +V L +++PDELHLC RYS ILL
Sbjct: 675 CYVTATDKDSMNYKELNSLLSLSGIPVDESLELIHTAAVLLKESTPDELHLCTRYSKILL 734

Query: 782 YMCKELRNKTQNLYMNEGVAAKQE--NADVKVGNKSLENLSSIENSQEPIEPFIMNEHPQ 839
            + +EL+  T +     G  +  E   AD  + N      ++  NS   +E   ++    
Sbjct: 735 CLYRELKMDTLSTQQAHGNDSMPERLTADTTLENAIRTEFTTTSNSGSQVELTPLSNKLA 794

Query: 840 TELPI--NTTEQIAIVGNEHHGIEQTPILNPNSMSFQGEVIDWFSSSADIGLEFVESWTE 897
           T LPI  NTT                    P   SF  EV+DWFS+SADIGLEFVE WTE
Sbjct: 795 T-LPIDRNTT--------------------PPYASFPTEVVDWFSTSADIGLEFVEPWTE 833

Query: 898 MIEQMYLRSSDGDQNIHVNSLFG 920
           MIEQ Y++S +  QN   + L  
Sbjct: 834 MIEQRYIKSGNT-QNKDFDDLLS 855

>KAFR0E03310 Chr5 complement(656129..658945) [2817 bp, 938 aa] {ON}
           Anc_5.525 YDR421W
          Length = 938

 Score =  759 bits (1960), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/939 (44%), Positives = 558/939 (59%), Gaps = 81/939 (8%)

Query: 17  TKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDVTAKINNM 76
           +KWRRSY+AC+NCR+RK+KCDLGP DNPH PPCVRCKREQREC+F  T RR     + + 
Sbjct: 14  SKWRRSYKACLNCRARKVKCDLGPYDNPHPPPCVRCKREQRECLF--TSRRKKKDDVISG 71

Query: 77  KGSELERXXXXXXLPDVDKKSLNGGGSAGSDLKQNNIRKKPT---DSNWQSDISTMQTAL 133
             S            D D+  LN G S G+    +N  K P     S W+  + +MQ  L
Sbjct: 72  TVSLTNVPSAITQEDDNDRIQLNSGSSKGALF--SNSPKNPNTQDQSKWKYGLGSMQNTL 129

Query: 134 EFLANAVGVISKSDTRSLLNLNQNNTLIXXXXXXXXXXXXXXXXXXXRSDSNTPKSRNSI 193
           EFLA A G +SK   R L     ++                      R D ++P S    
Sbjct: 130 EFLATAAGSVSKESNRRLTTARHSH------------QYAKETSEDFRVDDSSPSSERKD 177

Query: 194 FSLIHDDTASKVISPLM---GT----------IESIRPKPTRNLSDIEYIGPNKLLTEDE 240
              I D +   VI+PL+   GT          +  +RPKP + L+DI+YIGP+ LL+E E
Sbjct: 178 ---ITDTSEQSVIAPLLKECGTQRATVSLIEELSRVRPKPNKKLADIDYIGPSNLLSEQE 234

Query: 241 ARTLINVFFLTMHPYFPYIPLQLHNPDELVRYPILLCAILTVSSRYNSFNEIFINNEYEK 300
           AR LI+ +FLTMHP+FP IPLQL +PDELV YPILLCAILT+SSRY+ F+E    N    
Sbjct: 235 ARELIDAYFLTMHPFFPNIPLQLQDPDELVNYPILLCAILTMSSRYHPFSEFGFYNGENN 294

Query: 301 DRNIVVHEKLWFYCQRLISNTIWAEASTRSIGTILAFLLFTEWNPRAIHWTWSDYGNNPE 360
            RNI VHE LW YCQRLIS T+WAEASTRSIGT+LAF++FTEWNPR IHW  +DY N+ E
Sbjct: 295 KRNIEVHETLWDYCQRLISQTVWAEASTRSIGTVLAFIIFTEWNPRQIHWRRTDYANSAE 354

Query: 361 LTCFTKNNENNMSEFKGEKTTGFEAMRHSDRMAWMFTGSAVRLAQDMHFIDNNYKIFMAT 420
                K+ +   S+   +  TG  A+R SDRM+WM TGSAVRLAQDM FI+ + KIF+A+
Sbjct: 355 -----KDTDVPHSQKDDDGLTGIGAIRRSDRMSWMLTGSAVRLAQDMGFIETSTKIFVAS 409

Query: 421 HISETFNAMNVNQRXXXXXXXXXXXXXXXRSHGKNNDDEEGHIFAENFGNEQYYLEQILK 480
           HIS+TF +MN+NQR               R      D E+  +  +  GNE++YLEQ+L+
Sbjct: 410 HISDTFASMNMNQRCALSETFSVVGFGAGRERASAIDSEQTDV--DEVGNEKFYLEQMLQ 467

Query: 481 HDKSKEKWIKFLXXXXXXXXXXXXTVITDAEREYLNDEYILYYQNNNPETQPTWGNHSVT 540
           +++S+E+W + L              +TD ERE+LNDEY+LYY N N E           
Sbjct: 468 NEESRERWTRVLERLQHNNDKKNGP-LTDLEREFLNDEYVLYYANRNDEM-------VQQ 519

Query: 541 STSLPYPLKFASFHKAKIEILRIMSIAYETIYSAKNKRVLAFNNQRQNLAVLSIFSPLIE 600
              LP+PLKF+   +AKIE++RI+ IAY+TIY  K KR L  N+Q  NLAVL I SPLIE
Sbjct: 520 HLQLPFPLKFSFHQRAKIELIRIILIAYDTIYYDKGKRKLTSNDQVHNLAVLGILSPLIE 579

Query: 601 SWYSNHHGLLKLFECAPCDMSKYKDKNTVQKLSQAIEKESLIGDYYYCQLYIYSLALKVD 660
            WY+ +  LLK+    P  +   K+K  V +L + I +ES++ DYYYCQLYIYSLAL+VD
Sbjct: 580 GWYATYRNLLKISSGQPYSIEIRKNKRAVHELGEEINRESILSDYYYCQLYIYSLALQVD 639

Query: 661 IKDNNLNLSEITKSAKYVYMAYNAAKEILTSAVRVNKLKLLRYLPVRWVTRILRSVAFIV 720
           +K   L ++E TKSAKYV +AY AAKEIL S+ RV++LK+L+Y+PVRWV RI+R+V+F+V
Sbjct: 640 VKGPKLRINEATKSAKYVELAYVAAKEILISSTRVHRLKMLKYMPVRWVMRIVRAVSFLV 699

Query: 721 KCFXXXXXXXXXXXXXXXXXXRLSGIPVDEALELIETTSVTLNDASPDELHLCKRYSSIL 780
           KC+                  +L  I +DE +  I   ++ L +ASPDELHLC RYS+IL
Sbjct: 700 KCYLTLTGGGGVPNSEAQTILKLCCISLDETIHTIRLAALILKEASPDELHLCVRYSAIL 759

Query: 781 LYMCKELRNKT---QNLYMNEGVAAKQ--------------ENADVKVGNKSLENLSSIE 823
           LY+CKE+  K+   Q L ++ G+   +              +++D+ +G  S ++  +I+
Sbjct: 760 LYLCKEMNLKSKRNQKLLVSHGILINESRNRQMGSRRTKATQDSDIDLG--STDDSKNIQ 817

Query: 824 NSQEPI-----------EPFIMNEHPQTELPINTTEQIAIVGNEHHGIEQTPILNP-NSM 871
           ++ E +                 E  ++E P       A+  N  + ++     NP N  
Sbjct: 818 SNNELLPNNISTTNGLTTSLFNTEEMRSETPNQRIPTSAVADNTPNNLDNDGTNNPTNFP 877

Query: 872 SFQGEVIDWFSSSADIGLEFVESWTEMIEQMYLRSSDGD 910
           S   E IDWFS SADIGL+FVE WTE++EQ +L+S DG+
Sbjct: 878 SLPDEAIDWFSGSADIGLDFVEPWTELLEQRFLQSGDGN 916

>TDEL0A03890 Chr1 (695880..698375) [2496 bp, 831 aa] {ON} Anc_5.525
           YDR421W
          Length = 831

 Score =  742 bits (1915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/911 (44%), Positives = 551/911 (60%), Gaps = 96/911 (10%)

Query: 8   LSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRR 67
           +SE   N+ TKWRRSY+AC+NCR RKIKCD+GPLD PH+PPC RCKRE + C F  ++++
Sbjct: 4   ISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKK 63

Query: 68  DVTAKINNMKGSELERXXXXXXLPDVDKKSLNGGGSAGSDLKQNNIRKKPTDSNWQSDIS 127
            V  + +   G EL+          V    ++ GG   SD  + + R K  D  W+ +IS
Sbjct: 64  SVFKRQHRTNGLELQDEVEKHV---VITHEVDVGGP--SDRIERHSRNK-IDGKWRFEIS 117

Query: 128 TMQTALEFLANAVGVISKSDTRSLLNLNQNNTLIXXXXXXXXXXXXXXXXXXXRSDSNTP 187
           +MQ ALEFLA A G ++K D          N L                     + ++  
Sbjct: 118 SMQNALEFLAKAAGSVAKED----------NQLHEIKQIDPSQVSRDDSSWKDLTPTSFE 167

Query: 188 KSRNSIFS-LIHDDTASKVISPLMGTIESIRPKPTRNLSDIEYIGPNKLLTEDEARTLIN 246
            SR  I + L  D+ +S+   PL+  + S+RPKP   LS++E+IG +  LTE+E   L++
Sbjct: 168 ASRAGIMAPLEADEGSSRKAVPLIKKLSSVRPKPCIKLSNLEFIGGSDQLTEEEVIKLVD 227

Query: 247 VFFLTMHPYFPYIPLQLHNPDELVRYPILLCAILTVSSRYNSFNEIFINNEYEKDRNIVV 306
           VFFLTM+P+FP+IPLQL +P+EL RYP+LLC+I+TVS+RY+SF +I + +  + +RNI V
Sbjct: 228 VFFLTMYPFFPHIPLQLQDPEELARYPLLLCSIVTVSARYHSFCDIGLKDNMQNNRNIEV 287

Query: 307 HEKLWFYCQRLISNTIWAEASTRSIGTILAFLLFTEWNPRAIHWTWSDYGNNPELTCFTK 366
           HE+LW YCQ+LIS TIWAEASTRSIGT+LAFLLFTEWNPRAIHW WSDY N+ +    +K
Sbjct: 288 HEQLWIYCQKLISQTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANSGD----SK 343

Query: 367 NNENNMSEFK-GEKTTGFEAMRHSDRMAWMFTGSAVRLAQDMHFIDNNYKIFMATHISET 425
           +  N+ S  +  E+ TG  A+R SDRMAWM TG+AVRLAQDM F + + KIF ATHISET
Sbjct: 344 DRSNDFSISRDSERLTGMAAIRRSDRMAWMLTGNAVRLAQDMGFNETSSKIFTATHISET 403

Query: 426 FNAMNVNQRXXXXXXXXXXXXXXXRSHGKNNDDEEGHI-FAEN--FGNEQYYLEQILKHD 482
             AMNV QR                     N+   G I F  N   GNEQ+YLE+IL++D
Sbjct: 404 HTAMNVGQRSTLTESL--------------NEINLGSIKFPRNNSVGNEQFYLEKILEND 449

Query: 483 KSKEKWIKFLXXXXXXXXXXXXTVITDAEREYLNDEYILYYQNNNPETQPTWGNHSVTST 542
            SK++W +FL              +TD ERE+LNDEY+LYY  +          H  +S 
Sbjct: 450 DSKDRWTRFLHDIRDDYAHHDEGPLTDIEREFLNDEYVLYYTADGD------SKHRDSSN 503

Query: 543 SLPYPLKFASFHKAKIEILRIMSIAYETIYSAKNKRVLAFNNQRQNLAVLSIFSPLIESW 602
            LP+PL+F+   +AKIE+LRI+++ +E IY  K+K+   FN+  +NL++L + SPLIESW
Sbjct: 504 LLPFPLRFSKIQRAKIELLRIITVGFEAIYCTKDKQQSLFNDPTRNLSLLHLISPLIESW 563

Query: 603 YSNHHGLLKLFECAPCDMSKYKDKNTVQKLSQAIEKESLIGDYYYCQLYIYSLALKVDIK 662
           Y ++H LL+  E  PC +   ++K  V  + + I++ESLI +YYYCQLYIYS AL+VD+K
Sbjct: 564 YKSYHDLLEPAEGKPCTVDLCRNKREVHYVVRKIDRESLICEYYYCQLYIYSSALQVDVK 623

Query: 663 DNNLNLSEITKSAKYVYMAYNAAKEILTSAVRVNKLKLLRYLPVRWVTRILRSVAFIVKC 722
           +  L L EIT+SAKYV +AYNAAK +LTSA R+++L LL+ +PVRWVTRI++SVAFIVKC
Sbjct: 624 EGQLKLHEITRSAKYVELAYNAAKMLLTSATRLHRLNLLKCMPVRWVTRIVKSVAFIVKC 683

Query: 723 FXXXXXXXXXXXXXXXXXXRLSGIPVDEALELIETTSVTLNDASPDELHLCKRYSSILLY 782
           +                  +L+ IP ++ L+ I T ++ L +ASPDELHLC RYS+IL+ 
Sbjct: 684 YLTLMGNAVVNNPLANTILKLTVIPAEDILKTIHTAALILKEASPDELHLCMRYSTILMS 743

Query: 783 MCKELRNKTQNLYMNEGVAAKQENADVKVGNKSLENLSSIENSQEPIEPFIMNEHPQTEL 842
           +C E+R                E+ D    + +       +N   PI+P        T +
Sbjct: 744 LCSEMR----------------ESEDYTTDSPTPGTTFGQDNDPSPIQPL------DTAI 781

Query: 843 PINTTEQIAIVGNEHHGIEQTPILNPNSMSFQGEVIDWFSSSADIGLEFVESWTEMIEQM 902
           P+                       PN      +V+DWFS+S +IGLEFVESW EMIEQ 
Sbjct: 782 PL-----------------------PN------DVVDWFSTSDEIGLEFVESWAEMIEQR 812

Query: 903 YLRSSDGDQNI 913
           YL+ S   QN+
Sbjct: 813 YLQGSSYSQNL 823

>YDR421W Chr4 (1312040..1314892) [2853 bp, 950 aa] {ON}  ARO80Zinc
           finger transcriptional activator of the Zn2Cys6 family;
           activates transcription of aromatic amino acid catabolic
           genes in the presence of aromatic amino acids
          Length = 950

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/949 (43%), Positives = 554/949 (58%), Gaps = 64/949 (6%)

Query: 1   MSLSKRPLSEESGNQG---TKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQR 57
           MS  KRP    SGN      K RR+Y+AC++CRSRK+KCDLGP+DNPH PPC RCKRE +
Sbjct: 1   MSAKKRP----SGNAAFELPKRRRTYQACISCRSRKVKCDLGPVDNPHDPPCARCKRELK 56

Query: 58  ECIFPVTKRRDVTAKINNMKG----------SELERXXXXXXLPDVDKKSLNGGGSAGSD 107
           +CIF   K        N++             E++       L DV       G S+   
Sbjct: 57  KCIFSSNKGTSNDLPPNSINAISLPSLGKSKQEIQNDSTSPILSDVPLS--RKGISSEKS 114

Query: 108 LKQNNIRKKPTDSNWQSDISTMQTALEFLANAVGVISKSDTRSLLNLNQNNT--LIXXXX 165
            K   ++       W+ ++S+MQ ALEFLA A G ++K   + ++         L     
Sbjct: 115 FKSEGMK-------WKLELSSMQNALEFLAQAAGTVAKEGAKEIIKEKSTTPKPLKSSLD 167

Query: 166 XXXXXXXXXXXXXXXRSDSNTPKSRNSIFSLIHDDTASKVISPLMGTIESIRPKPTRNLS 225
                          +SDS      N+   L H    ++  S LM  I  +RP PTR + 
Sbjct: 168 ATNKSATDEGLKRLSKSDSTNTLYENTADMLNHTLNTNRKTSQLMEEIGKVRPPPTRKID 227

Query: 226 DIEYIGPNKLLTEDEARTLINVFFLTMHPYFPYIPLQLHNPDELVRYPILLCAILTVSSR 285
           D +YIGP+ LLT++EA  LI  FFLTMHP+FP IPLQLH+P EL  YPIL CAILTVS+R
Sbjct: 228 DFDYIGPDSLLTKEEAIELIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSAR 287

Query: 286 YNSFNEIFINNEYEKDRNIVVHEKLWFYCQRLISNTIWAEASTRSIGTILAFLLFTEWNP 345
           Y+ F+ + ++N  +  R+I VH+KLW YCQ+LIS TIWAEASTRSIGT+LAF++FTEWNP
Sbjct: 288 YHPFDTLGLDNGEDGMRHIEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNP 347

Query: 346 RAIHWTWSDYGNNPELTCFTKNNENNMSEFKGEKT-TGFEAMRHSDRMAWMFTGSAVRLA 404
           R+IH+ WSDY N+PEL         N+S  K E+  TG  A+R SDRM+WM TGSAVRLA
Sbjct: 348 RSIHYKWSDYANDPELNNVNARGSKNISTRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLA 407

Query: 405 QDMHFIDNNYKIFMATHISETFNAMNVNQRXXXXXXXXXXXXXXXRSHGKNNDDEEGHIF 464
           QDM FI+N+ K+F+ THISET +AMN+NQR               +     N+  E ++ 
Sbjct: 408 QDMGFIENSSKVFIVTHISETTSAMNMNQRSLLAESFSVLNLNLGKIENDGNESNEDYL- 466

Query: 465 AENFGNEQYYLEQILKHDKSKEKWIKFLXXXXXXXXXXXXTVITDAEREYLNDEYILYYQ 524
               GNE++YL +IL  ++SK +W K +              +TD ERE+LNDEY+LYY 
Sbjct: 467 ----GNEKFYLNEILPDEESKLRW-KRVFENSENDHDNEKNFLTDWEREFLNDEYVLYYS 521

Query: 525 NNNPETQPTWGNHSVTSTSLPYPLKFASFHKAKIEILRIMSIAYETIYSAKNKRVLAFNN 584
           N   +T     NH       P+PL+F+   +AKIEI+RI+SIAYETIY  KNKR LA  +
Sbjct: 522 NKKDDTNLA-QNHIP-----PFPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTD 575

Query: 585 QRQNLAVLSIFSPLIESWYSNHHGLLKLFECAPCDMSKYKDKNTVQKLSQAIEKESLIGD 644
           QR NL+VLS+FSPLIE W SN+  LL      P  ++  K+K  +      I  ES+I D
Sbjct: 576 QRHNLSVLSVFSPLIEGWLSNYRELLVPLSDVPFSLADRKNKKQIFDNIDRINGESIITD 635

Query: 645 YYYCQLYIYSLALKVDIKDNNLNLSEITKSAKYVYMAYNAAKEILTSAVRVNKLKLLRYL 704
           + YCQLYI+SLAL+VD K + LN++EI  SA+YV +AY +AKEIL+SA RV++  +L+Y+
Sbjct: 636 FNYCQLYIFSLALQVDGKTSRLNMNEIVTSARYVELAYRSAKEILSSAKRVSRQGMLKYM 695

Query: 705 PVRWVTRILRSVAFIVKCFXXXXXXXXXXXXXXXXXXRLSGIPVDEALELIETTSVTLND 764
           PVRWV RI+RS+AFIVKC+                  +LS I VDE  ++I  T+VTL +
Sbjct: 696 PVRWVIRIIRSIAFIVKCYLTLTGSELATNPDARNILKLSAISVDETFDIIRDTAVTLKE 755

Query: 765 ASPDELHLCKRYSSILLYMCKELRNKTQNL-----YMNEGVAAKQENADVKVGNKSLE-- 817
           A+PDELHLC+RY++IL+Y+C E++ + ++       + +G    + N +  +  + L   
Sbjct: 756 ATPDELHLCQRYAAILMYLCTEMKLRKKSYLERPPLLRDGTTPLESNRESSLEGQDLTKK 815

Query: 818 -------NLSSIENSQEPIEPFIMNEHPQTELPINTTEQIAIVGN--EHHGIEQTPILNP 868
                    +  E + EP E  +  E        N T    IV    E +    T +LN 
Sbjct: 816 PIFSKRIGYNKTETTFEPSERPLTEEINSNSQNSNDTSSKGIVDPFVEQNNDITTALLN- 874

Query: 869 NSMSFQG-----EVIDWFSSSADIGLEFVESWTEMIEQMYLRSSDGDQN 912
           N + FQG     EV DWF +S DIGLEFVE WTE+IEQ Y++  DGD N
Sbjct: 875 NEL-FQGPSLSDEVTDWFGASEDIGLEFVEPWTELIEQRYMQCGDGDNN 922

>ZYRO0D12518g Chr4 (1055521..1058166) [2646 bp, 881 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 881

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/915 (43%), Positives = 548/915 (59%), Gaps = 64/915 (6%)

Query: 10  EESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDV 69
           E SG+  TKWRR Y+AC++CR++K+KCD+GPLDNPH PPC+RC+RE +ECI P  KRR  
Sbjct: 9   ESSGSNPTKWRRIYKACISCRNKKMKCDMGPLDNPHGPPCMRCRRENKECILPENKRRGN 68

Query: 70  T------AKINN-----MKGSELERXXXXXXLPDVDKKSLNGGGSAGSDLKQNNIRKKPT 118
           T       KI N     M  SE E+      L        NG  S   DL          
Sbjct: 69  TDTEFKLGKIENGLVGVMNKSESEQSL----LSQTRAPPPNGSTSNNLDL---------V 115

Query: 119 DSNWQSDISTMQTALEFLANAVGVISKSDTRSLLNLNQNNTLIXXXXXXXXXXXXXXXXX 178
           D  W+ +I TM  ALEFLA A G +SK +   + +  QN + +                 
Sbjct: 116 DPKWKFEIGTMYNALEFLAKAAGSVSKEEPIEMKS-PQNRSDLGVGNMPDTALNGVMSDN 174

Query: 179 XXRSDSNTPKSRNSIFSLIHDDTASKVISPLMGTIESIRPKPTRNLSDIEYIGPNKLLTE 238
               D +     + +  L   + + +  +PL+  + S+RPK ++ L D++YIGP+KLL+E
Sbjct: 175 IGNLDIS---DESFLAPLTTANGSQRAAAPLIEKLSSMRPKSSKKLIDVDYIGPSKLLSE 231

Query: 239 DEARTLINVFFLTMHPYFPYIPLQLHNPDELVRYPILLCAILTVSSRYNSFNEIFINNEY 298
           DEA  LI++FFLTMHP+FP+IPLQL +PDELVRYPILLCAILT+S+RYN F E+   +  
Sbjct: 232 DEATRLIDIFFLTMHPFFPHIPLQLQDPDELVRYPILLCAILTISARYNPFGELGFYDGE 291

Query: 299 EKDRNIVVHEKLWFYCQRLISNTIWAEASTRSIGTILAFLLFTEWNPRAIHWTWSDYGNN 358
             +RNI VHE+LW YCQRLIS TIWAEASTRSIGT+LAFLLFTEWNPRAIHW WSDY NN
Sbjct: 292 AHNRNIEVHERLWIYCQRLISQTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANN 351

Query: 359 PELTCFTKNNENNMSEFKGEKT-TGFEAMRHSDRMAWMFTGSAVRLAQDMHFIDNNYKIF 417
           PEL   TK   +  +  +  +T TG  A+R SDRMAWM  G+AVRLAQDM FID + KIF
Sbjct: 352 PELNDVTKRETHGANTPRDTETFTGMAAVRRSDRMAWMLIGAAVRLAQDMSFIDTSSKIF 411

Query: 418 MATHISETFNAMNVNQRXXXXXXXXXXXXXXXRSHGKNNDDEEGHIFAENFGNEQYYLEQ 477
           +ATHI+E   AMN+NQ+                S   +  + E     ++ GNE +YLE 
Sbjct: 412 VATHIAEAHTAMNLNQKSIL-------------SESLSEVNREVLERLDDIGNENFYLEH 458

Query: 478 ILKHDKSKEKWIKFLXXXXXXXXXXXXTVITDAEREYLNDEYILYYQNNNPETQPTWGNH 537
           IL+ D+SKE+W  FL              +TD ERE+LNDEY+LYY N   +        
Sbjct: 459 ILQKDESKERWTNFLQNVSEGRRAKGTGPLTDMEREFLNDEYVLYYVNARNDAS------ 512

Query: 538 SVTSTSLPYPLKFASFHKAKIEILRIMSIAYETIY--SAKNKRVLAFNNQRQNLAVLSIF 595
           S +S +LP+PLKF+   +AKIE+LRI++I YE+IY  S K+K  L   N ++NLA+L I 
Sbjct: 513 SKSSLTLPFPLKFSHPQRAKIELLRILTIGYESIYYESEKDKTQLINGNPKRNLALLEII 572

Query: 596 SPLIESWYSNHHGLLKLFECAPCDMSKYKDKNTVQKLSQAIEKESLIGDYYYCQLYIYSL 655
           S LIE W++ +  LL      PC +   ++K  V +L+Q I++ESL  DY YCQLYIYSL
Sbjct: 573 STLIEKWHATYKDLLIPANATPCSLDMARNKRAVHELTQQIDRESLSCDYNYCQLYIYSL 632

Query: 656 ALKVDIKDNNLNLSEITKSAKYVYMAYNAAKEILTSAVRVNKLKLLRYLPVRWVTRILRS 715
           AL+ D+K+ +L + EI KSA+YV +AY AA+ IL SA R++ LK+LRY+PVRWVTRI+R+
Sbjct: 633 ALQNDVKNMDLKMPEIRKSARYVELAYRAAEGILDSAERIHSLKMLRYMPVRWVTRIVRA 692

Query: 716 VAFIVKCFXXXXXXXXXXXXXXXXXXRLSGIPVDEALELIETTSVTLNDASPDELHLCKR 775
           VAF+VKC+                  RL+ IP +E + +IE  +VTL +A+PDE+HL  R
Sbjct: 693 VAFLVKCYLVLTKDGLAANPVAGTILRLTVIPSEETVPIIERAAVTLQEAAPDEVHLGMR 752

Query: 776 YSSILLYMCKELRNKTQNLYMNEGVAAKQENADVKVGNKSLENLSSIENSQEPIEPFIMN 835
           YS IL ++C E++ +TQ           + + + +   K  + L      ++P E     
Sbjct: 753 YSKILKFLCAEVKMRTQ---------MSERDEEAEEERKQRQQLECYH--RQPRER--RQ 799

Query: 836 EHPQTELPINTTEQIAIVGNEHHGIEQTPILNPNSMSFQGEVIDWFSSSADIGLEFVESW 895
           +H Q  +  + +     V         +P   P  + F+ +  D F++S DIGL+FV++W
Sbjct: 800 QHAQPVISQSHSPPSPSVMLNSSMDPYSPSAPPADLPFE-DPFDLFAASDDIGLDFVDTW 858

Query: 896 TEMIEQMYLRSSDGD 910
           TEMIE  Y++   G+
Sbjct: 859 TEMIENRYMQDELGN 873

>Suva_2.598 Chr2 (1064757..1067654) [2898 bp, 965 aa] {ON} YDR421W
           (REAL)
          Length = 965

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/942 (43%), Positives = 559/942 (59%), Gaps = 45/942 (4%)

Query: 1   MSLSKRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECI 60
           MS +KR  SE +     K RR+Y+AC+NCRSRK+KCDLGP+DNPH PPC RCKRE + C+
Sbjct: 11  MSTTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCL 70

Query: 61  FPVTKR--RDVTAKINNMKGSELERXXXXXXLPDVDKKSLNGGGSAGSDLKQNNIRKKPT 118
           F   +     ++  + N+               D+   + +    +G +   N    K  
Sbjct: 71  FSSNREAMHTLSPSMINITSKSASSKSEQGVPNDLMSSTPSDMPLSGKN-TDNETLFKSE 129

Query: 119 DSNWQSDISTMQTALEFLANAVGVISKSDTRSLLNLNQNNT--LIXXXXXXXXXXXXXXX 176
              W+ ++S+MQ  LEFLA A G ++K   + ++      T   +               
Sbjct: 130 GMKWKLELSSMQNTLEFLAQAAGTVAKEGAKEIIKDESTTTTPFVNSLHSSCQPSTDEGL 189

Query: 177 XXXXR-----SDSNTPKSRNSIFSLIHDDTASKVISPLMGTIESIRPKPTRNLSDIEYIG 231
               R     SD+NTP   N   +L     A++  S L+  I  +RP PTR + D EYIG
Sbjct: 190 KPLSRSLSAASDTNTP-IENLTVALATTLNANRTTSQLIEEIGKVRPIPTRKIEDFEYIG 248

Query: 232 PNKLLTEDEARTLINVFFLTMHPYFPYIPLQLHNPDELVRYPILLCAILTVSSRYNSFNE 291
           P  LLT++EA  LI  FFLTMHP+FP IP QLH+P EL +YPIL CAILTVS+RY+ F+ 
Sbjct: 249 PANLLTKEEAIELIEAFFLTMHPFFPNIPFQLHDPKELAQYPILFCAILTVSARYHPFDT 308

Query: 292 IFINNEYEKDRNIVVHEKLWFYCQRLISNTIWAEASTRSIGTILAFLLFTEWNPRAIHWT 351
           + ++N     R++ VH+KLW YCQ+LIS TIWAEASTRSIGT+LAF++FTEWNPR+IH  
Sbjct: 309 LGLDNGENGTRHVEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHCK 368

Query: 352 WSDYGNNPELTCFTKNNENNMSEFKGEKT-TGFEAMRHSDRMAWMFTGSAVRLAQDMHFI 410
           WSDY N+PEL         +++  + E+  TG  A+R SDRM+WM TGSAVRLAQDM FI
Sbjct: 369 WSDYANDPELNNVNVRGGKHINTRRDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFI 428

Query: 411 DNNYKIFMATHISETFNAMNVNQRXXXXXXXXXXXXXXXRSHGKNNDDEEGHIFAENFGN 470
           +N+ +IF+ THISET +AMN+NQR               R     N++ E ++     GN
Sbjct: 429 ENSSRIFIVTHISETTSAMNMNQRSVLAESFSVLNLNLGRFDNDGNENNENYL-----GN 483

Query: 471 EQYYLEQILKHDKSKEKWIKFLXXXXXXXXXXXXTVITDAEREYLNDEYILYYQNNNPET 530
           E++YL++IL +D+SKE+W K L             V+TD ERE+LNDEY+LYY N   +T
Sbjct: 484 ERFYLDEILPNDESKERWKKVL-ENLEADSDNEKCVLTDWEREFLNDEYVLYYSNKKDDT 542

Query: 531 QPTWGNHSVTSTSLPYPLKFASFHKAKIEILRIMSIAYETIYSAKNKRVLAFNNQRQNLA 590
                NH       P+PL+F+   +AKIEI+RI+SIAYETIY  KNKR LA  +QR NL+
Sbjct: 543 NLA-QNHMP-----PFPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLS 596

Query: 591 VLSIFSPLIESWYSNHHGLLKLFECAPCDMSKYKDKNTVQKLSQAIEKESLIGDYYYCQL 650
           VLS+FSPL+E W SN+  +L      P  ++  K+K  V      I  ES+I D+ YCQL
Sbjct: 597 VLSVFSPLMEGWLSNYREVLVPLSDVPFSLADRKNKRQVLNNIDRINGESIITDFNYCQL 656

Query: 651 YIYSLALKVDIKDNNLNLSEITKSAKYVYMAYNAAKEILTSAVRVNKLKLLRYLPVRWVT 710
           YI+SLAL+VD K + LN+SEI KSAKYV +AY +AKEIL+SA RV++  +L+Y+PVRWV 
Sbjct: 657 YIFSLALQVDGKISRLNMSEIVKSAKYVELAYKSAKEILSSAKRVSRQCMLKYMPVRWVI 716

Query: 711 RILRSVAFIVKCFXXXXXXXXXXXXXXXXXXRLSGIPVDEALELIETTSVTLNDASPDEL 770
           RI+RS+AFIVKC+                  +LS I VDE  +LI  T+VTL +A+PDEL
Sbjct: 717 RIIRSIAFIVKCYLTLTGSEIATNPDARNILKLSAISVDETFDLIRDTAVTLKEATPDEL 776

Query: 771 HLCKRYSSILLYMCKELR------------NKTQNLYMNEGVAAKQENADVKVGNKSLEN 818
           HLC+RY++IL+Y+C E++            ++T    +     +  E A++ V   + + 
Sbjct: 777 HLCQRYAAILMYLCTEMKLRKKSHLERPPTSRTGIAPLKSSDESPLEGANL-VKGPTFDK 835

Query: 819 LSSIENSQEPIEPFIMNEHPQTELPINTTEQIAIVGNEHHGIEQTPILNP---NSMSFQG 875
            +   N++   +P       +T   +N + ++      +  +EQT  +     N+   QG
Sbjct: 836 TAGTSNAECIFDPVGKTSAEETSNNLNNSTELPFKTGLNSFVEQTNDITAMLLNNELIQG 895

Query: 876 -----EVIDWFSSSADIGLEFVESWTEMIEQMYLRSSDGDQN 912
                EV DWFS+S DIGLEFVE WTE+IEQ Y++  DGD N
Sbjct: 896 PSLSEEVTDWFSASEDIGLEFVEPWTELIEQRYMQCGDGDNN 937

>Skud_4.695 Chr4 (1233000..1235864) [2865 bp, 954 aa] {ON} YDR421W
           (REAL)
          Length = 954

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/955 (43%), Positives = 559/955 (58%), Gaps = 79/955 (8%)

Query: 5   KRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVT 64
           KR  SE   ++  K RR+Y+AC+NCRSRK+KCDLGP+DNPH PPC RCKRE ++C F  T
Sbjct: 4   KRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSST 63

Query: 65  KRRD-------VTAKINNMKGSELERXXXXXXLPDVDKKSLNGGGSAGSDLKQNNIRKKP 117
           +          +TA          ++       P     +L+G  +       N    K 
Sbjct: 64  RGETNGTSPNMITAASKTFLSKSEQQIRNRSTSPITADMTLSGKETG------NETSFKS 117

Query: 118 TDSNWQSDISTMQTALEFLANAVGVISKSDTRSLLNLNQNNT---LIXXXXXXXXXXXXX 174
               W+ ++S+MQ ALEFLA A G ++K   + ++  +++ T   L+             
Sbjct: 118 EGVKWKFELSSMQNALEFLAQAAGTVAKEGAKEIIE-DKSATPRPLVDPLDTSHQSATDG 176

Query: 175 XXXXXXRSDSNTPKS----RNSIFSLIHDDTASKVISPLMGTIESIRPKPTRNLSDIEYI 230
                 R DS    +     N    L     A++  S L+  I  +RP PTR + D +YI
Sbjct: 177 GLKRLSRGDSAASATCTPHENVTAMLAASLNANRTTSQLIREISGVRPSPTRKIEDFDYI 236

Query: 231 GPNKLLTEDEARTLINVFFLTMHPYFPYIPLQLHNPDELVRYPILLCAILTVSSRYNSFN 290
           GP+ LLT++EA  LI  FFLTMHP+FP IPLQLH+P EL  YPIL CAILTVS+RY+ F+
Sbjct: 237 GPDNLLTKEEAIELIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARYHRFD 296

Query: 291 EIFINNEYEKDRNIVVHEKLWFYCQRLISNTIWAEASTRSIGTILAFLLFTEWNPRAIHW 350
            + + N     R+I VH+KLW YCQ+LIS TIWAEASTRSIGT+LAF++FTEWNPR+IH+
Sbjct: 297 TLGLYNGENGLRHIEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHY 356

Query: 351 TWSDYGNNPELTCFTKNNENNMSEFKGEKT-TGFEAMRHSDRMAWMFTGSAVRLAQDMHF 409
            WSDY N+PEL         N+   K E+  TG  A+R SDRM+WM TGSAVRLAQDM F
Sbjct: 357 KWSDYANDPELNNVNVRGSKNICTRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGF 416

Query: 410 IDNNYKIFMATHISETFNAMNVNQRXXXXXXXXXXXXXXXR--SHGKNNDDEEGHIFAEN 467
           I+N+ KIF+ THISET +AMN+NQR               +  S GK N++         
Sbjct: 417 IENSSKIFIVTHISETTSAMNMNQRSLLAESFSVLNLNLEKFDSDGKENNENY------- 469

Query: 468 FGNEQYYLEQILKHDKSKEKWIKFLXXXXXXXXXXXXTVITDAEREYLNDEYILYYQNNN 527
           FGNE++YL++IL +D+ K++W K +             ++TD ERE+LNDEY+LYY N N
Sbjct: 470 FGNEKFYLDEILPNDEIKKRW-KGVFEDSADASDNEKYLLTDWEREFLNDEYVLYYSNKN 528

Query: 528 PETQPTWGNHSVTSTSLPYPLKFASFHKAKIEILRIMSIAYETIYSAKNKRVLAFNNQRQ 587
            +T     NH+      P+PL+F+   +AKIEI+RI+SIAYETIY  KNKR LA  +QR 
Sbjct: 529 DDTNLA-QNHTP-----PFPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRH 582

Query: 588 NLAVLSIFSPLIESWYSNHHGLLKLFECAPCDMSKYKDKNTVQKLSQAIEKESLIGDYYY 647
           NL+VLSIFSPL+E W SN+  +L      P  ++  K+K  V      I  ES+I D+ Y
Sbjct: 583 NLSVLSIFSPLMEGWLSNYREVLVPLSDVPFSLADRKNKKQVFDNIDRINGESIITDFNY 642

Query: 648 CQLYIYSLALKVDIKDNNLNLSEITKSAKYVYMAYNAAKEILTSAVRVNKLKLLRYLPVR 707
           CQLYI+SLAL+VD K + LN++EI  SA+YV +AY +AKEIL SA RV++  +L+++PVR
Sbjct: 643 CQLYIFSLALQVDGKISRLNMNEIVTSARYVELAYRSAKEILGSAKRVSRQAMLKFMPVR 702

Query: 708 WVTRILRSVAFIVKCFXXXXXXXXXXXXXXXXXXRLSGIPVDEALELIETTSVTLNDASP 767
           WV RI+RS+AFIVKC+                  +LS I VDE  +L+  T+VTL +A+P
Sbjct: 703 WVIRIIRSIAFIVKCYLTLTGSELATNPDARNILKLSAISVDETFDLMRDTAVTLKEATP 762

Query: 768 DELHLCKRYSSILLYMCKE--------------LRNKTQNLYMNEGVAAKQENADVKV-- 811
           DELHLC+RY++IL+Y+C E              LR+ T  L  N G +   E  DV    
Sbjct: 763 DELHLCQRYAAILMYLCTEMKLRKSSHLERPSLLRSSTTPLESNHGFSL--EGVDVTKKS 820

Query: 812 -------GNKSLENLSSIENSQEPIEPFIMNEHPQTELPINTTEQIAIVGN--EHHGIEQ 862
                  GNK+     + E  + P++    N +   +L        AIV +  E +    
Sbjct: 821 TFYRDIGGNKTDSKFETPE--KLPVDEIGDNLNNSNDL-----SGKAIVNSFVEQNNDIT 873

Query: 863 TPILNPNSMSFQG-----EVIDWFSSSADIGLEFVESWTEMIEQMYLRSSDGDQN 912
             +LN N + FQG     EV DWF +S DIGLEFVE WTE+IEQ Y++  DGD N
Sbjct: 874 AALLN-NEL-FQGPSLSEEVTDWFGASEDIGLEFVEPWTELIEQRYMQCGDGDNN 926

>Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421W
           (REAL)
          Length = 949

 Score =  714 bits (1842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/949 (42%), Positives = 560/949 (59%), Gaps = 65/949 (6%)

Query: 1   MSLSKRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECI 60
           MSL KR  SE + +   K RR+Y+AC+NCRSRK+KCDLGP+DNPH+PPC RCKRE REC+
Sbjct: 1   MSLKKR-FSENTTSALPKRRRTYQACINCRSRKVKCDLGPVDNPHEPPCARCKRELRECL 59

Query: 61  FP---VTKRRDVTAKINNMKGSELERXXXXXXLPDVDKKSLNGGGSAGSDLKQNNIRKKP 117
           F    V K       +N +  S+ E       +P+  ++ ++   +       +    K 
Sbjct: 60  FSSQKVVKNSTSPHMVNTICQSKGE-------IPNHSRRLISSEMALSEKGTNDETLFKS 112

Query: 118 TDSNWQSDISTMQTALEFLANAVGVISKSDTRSLLN-------LNQNNTLIXXXXXXXXX 170
               W+ ++S+MQ ALEFLA A G ++K   +  +         ++++            
Sbjct: 113 DGVKWKLELSSMQNALEFLAQAAGTVAKEGAKETIKDRSATPRPSESSLDTPHQSAANKE 172

Query: 171 XXXXXXXXXXRSDSNTPKSRNSIFSLIHDDTASKVISPLMGTIESIRPKPTRNLSDIEYI 230
                      S +NTP   N   +L     +++ +S L+  I   RP PTR + D EYI
Sbjct: 173 LKTLSISECDASATNTPH-ENITDTLAAALNSNQKMSQLIKEISRARPMPTRRIDDFEYI 231

Query: 231 GPNKLLTEDEARTLINVFFLTMHPYFPYIPLQLHNPDELVRYPILLCAILTVSSRYNSFN 290
           GP+ LLT++EA  LI  FFLTMHP+FP IPLQLH+P EL  YPIL C+ILTVS+RY+ F+
Sbjct: 232 GPDNLLTKEEAIELIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFCSILTVSARYHPFD 291

Query: 291 EIFINNEYEKDRNIVVHEKLWFYCQRLISNTIWAEASTRSIGTILAFLLFTEWNPRAIHW 350
            + ++N     R+I VH+KLW YCQ+LIS TIWAEASTRSIGT+LAF++FTEWNPR+IH+
Sbjct: 292 TLGLDNGENGIRHIEVHDKLWIYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHY 351

Query: 351 TWSDYGNNPELTCFTKNNENNMSEFKGEKT-TGFEAMRHSDRMAWMFTGSAVRLAQDMHF 409
            WSDY N+PEL         N+S  K E+  TG  A+R SDRM+WM TGSAVRLAQDM F
Sbjct: 352 KWSDYANDPELNNVGVRESKNISTKKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGF 411

Query: 410 IDNNYKIFMATHISETFNAMNVNQRXXXXXXXXXXXXXXXRSHGKNNDDEEGHIFAENF- 468
           I+N+ KIF+ THISET +AMN+NQR               +       D++G+   EN+ 
Sbjct: 412 IENSSKIFIVTHISETTSAMNMNQRPLLAESFSVLNLNVRKF------DDDGNKGNENYL 465

Query: 469 GNEQYYLEQILKHDKSKEKWIKFLXXXXXXXXXXXXTVITDAEREYLNDEYILYYQNNNP 528
           GNE++YL +IL  D+SK++W K               ++TD ERE+LNDEY+LYY N   
Sbjct: 466 GNEKFYLNEILPDDESKKRWKKVF-KDSEDDDDSEKNILTDWEREFLNDEYVLYYSNKKD 524

Query: 529 ETQPTWGNHSVTSTSLPYPLKFASFHKAKIEILRIMSIAYETIYSAKNKRVLAFNNQRQN 588
           +T      +   +   P PL+F+   +AKIEI+RI+SIAYETIY  KNKR LA  +QR N
Sbjct: 525 DT------NLAQNPMPPSPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHN 578

Query: 589 LAVLSIFSPLIESWYSNHHGLLKLFECAPCDMSKYKDKNTVQKLSQAIEKESLIGDYYYC 648
           L+VLS+FSPLIE W SN+  +L         ++  K+K  V      +  E++I D+ YC
Sbjct: 579 LSVLSVFSPLIEGWLSNYREVLVPISDVSFLLADRKNKKQVFDNINRLNGETIITDFNYC 638

Query: 649 QLYIYSLALKVDIKDNNLNLSEITKSAKYVYMAYNAAKEILTSAVRVNKLKLLRYLPVRW 708
           QLYI+SLAL+VD K + LN++EI  SA+YV +AY +AKEIL+SA RV++  +L+Y+PVRW
Sbjct: 639 QLYIFSLALQVDGKTSRLNMNEIMTSARYVELAYRSAKEILSSAKRVSRQGMLKYMPVRW 698

Query: 709 VTRILRSVAFIVKCFXXXXXXXXXXXXXXXXXXRLSGIPVDEALELIETTSVTLNDASPD 768
             RI+RS+AFIVKC+                  +LS I VDE  ++I  T+VTL +A+PD
Sbjct: 699 AIRIIRSIAFIVKCYLTLTGSELATNPDARNILKLSAISVDETFDIIRDTAVTLKEATPD 758

Query: 769 ELHLCKRYSSILLYMCKELRNKTQNLYMNEGVAAKQENADVKVGNKSLENLSSIENSQEP 828
           ELHLC+RY++IL+Y+C E++ + ++      ++    N    + +    +   ++ +++P
Sbjct: 759 ELHLCQRYAAILMYLCTEMKLRKKSYTERPPLST---NGTTPLESNCESSPEGVDFTKKP 815

Query: 829 IEPFIM-------NEHPQTELPINTTEQIAIVGNEHHGIEQTPILNP------------- 868
             P  +       N     + P+   E+I    N  + +    I NP             
Sbjct: 816 TFPKNIRSNKAECNSESSKKSPM---EEIDSNLNNPNNLSSKVIFNPFVEQNNDTTTTLL 872

Query: 869 NSMSFQG-----EVIDWFSSSADIGLEFVESWTEMIEQMYLRSSDGDQN 912
           N+  FQG     EV DWF +S DIGL FVE WTE+IEQ Y++  DGD N
Sbjct: 873 NNELFQGPSLSEEVTDWFGASEDIGLGFVEPWTELIEQRYMQCGDGDIN 921

>NCAS0F01070 Chr6 (211085..213799) [2715 bp, 904 aa] {ON} Anc_5.525
           YDR421W
          Length = 904

 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/918 (43%), Positives = 544/918 (59%), Gaps = 64/918 (6%)

Query: 18  KWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDVTAKINNMK 77
           KW+RS+RAC++CR RK+KCDLGPL+NPHKPPCVRC+RE + CIF        +A ++ M 
Sbjct: 26  KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGMSSANLSTMN 85

Query: 78  GSELERXXXXXXLP-DVDKKS-LNGGGSAGSDLKQNNIRKKPTDSNWQSDISTMQTALEF 135
           G   +           VD  S LN         K  N  K+     W+ ++++MQ +LEF
Sbjct: 86  GKNNQATFTGIKRALSVDANSTLNSQYHTTKIKKTENTYKRLPREKWKLELASMQNSLEF 145

Query: 136 LANAVGVISKSDTRSLLNLNQNNTLIXXXXXXXXXXXXXXXXXXXRSDSNTPKSR----- 190
           LA A   ++          +Q+N                       S+++TP  +     
Sbjct: 146 LAKAADSVA----------HQSNP----ESFKETAKLAKNGASNDTSENDTPVQQQDSPN 191

Query: 191 -NSIFSLIHDDTASKVISPLMGTIESIRPKPTRNLSDIEYIGPNKLLTEDEARTLINVFF 249
            N +  L     + +   P +    SIRPK ++ LSD+E+IGP+KLL+E+EAR LI++FF
Sbjct: 192 ENYLTPLTTPHNSRRSALPQLEKSISIRPKSSQTLSDMEFIGPSKLLSEEEARELIDLFF 251

Query: 250 LTMHPYFPYIPLQLHNPDELVRYPILLCAILTVSSRYNSFNEI--FINNEYEKDRNIVVH 307
           LTM+P+FP+IPLQL + DELVRYPILLCAILT+SSRY+ F+E   +      + RNI VH
Sbjct: 252 LTMNPFFPHIPLQLQDADELVRYPILLCAILTISSRYHPFDEFDGYNGTPGRQKRNIHVH 311

Query: 308 EKLWFYCQRLISNTIWAEASTRSIGTILAFLLFTEWNPRAIHWTWSDYGNNPELTCFTKN 367
           EKLW YCQRLIS T+WAEASTRSIGTI AF++FTEWNPRAIHW WSDY NNPE    TK 
Sbjct: 312 EKLWIYCQRLISQTVWAEASTRSIGTIFAFIIFTEWNPRAIHWKWSDYANNPEQYDMTKR 371

Query: 368 NENNMSEFKGEKT-TGFEAMRHSDRMAWMFTGSAVRLAQDMHFIDNNYKIFMATHISETF 426
              +    K E   TG  A+R SDRMAWM TG+AVRLAQD+  I+ + K+F+ATHISE++
Sbjct: 372 ESFSQEPNKDEDGLTGIAAIRRSDRMAWMLTGTAVRLAQDIGAIETSAKVFVATHISESY 431

Query: 427 NAMNVNQRXXXXXXXXXXXXXXXRSHGKNNDDEEGHIFAENFGNEQYYLEQILKHDKSKE 486
            A+N+NQ                 S   N  + +G        NE+ YLEQIL++D+SK 
Sbjct: 432 TAINMNQGLIL-------------SQSFNERNLDGIDNLNGVDNERLYLEQILQNDESKA 478

Query: 487 KWIKFLXXXXXXXXXXXXTVITDAEREYLNDEYILYYQNNNPETQPTWGNHSVTSTSLPY 546
           +W   L              + D ERE+LNDEY LYY +++ +TQ          T    
Sbjct: 479 RWNGILKLLDNEVGISEE-YLQDVEREFLNDEYTLYYADHDEDTQ--------QHTQQII 529

Query: 547 PLKFASFHKAKIEILRIMSIAYETIYSAKNKRVLAFNNQRQNLAVLSIFSPLIESWYSNH 606
           PLKF S  KAK+E+LRI+ + YETIY  K  + L   +QR NLAVL+I +PLIESWY+N+
Sbjct: 530 PLKFTSTQKAKLELLRILILGYETIYYEKGDQRLVSTDQRHNLAVLNILAPLIESWYNNY 589

Query: 607 HGLLKLFECAPCDMSKYKDKNTVQKLSQAIEKESLIGDYYYCQLYIYSLALKVDIKDNNL 666
             LL++ E     +++ ++K    ++S+ I  E++I DYYYCQLYIYSLAL+VD+++N L
Sbjct: 590 RSLLEIREGEVLSLNQRRNKRKAFEMSRQINTETMISDYYYCQLYIYSLALQVDVEENKL 649

Query: 667 NLSEITKSAKYVYMAYNAAKEILTSAVRVNKLKLLRYLPVRWVTRILRSVAFIVKCFXXX 726
            L+EI + A +V  AY AAKEIL SA RV+KL +L+Y+PVRWV RI+RSVAFIVKC+   
Sbjct: 650 KLNEIRRCASFVEKAYIAAKEILESAGRVHKLNMLKYMPVRWVLRIVRSVAFIVKCYLTL 709

Query: 727 XXXXXXXXXXXXXXXRLSGIPVDEALELIETTSVTLNDASPDELHLCKRYSSILLYMCKE 786
                          RLS I VDE ++ I+T ++TL +A+PDELHLC RYS+IL+Y+C+E
Sbjct: 710 TCSDLSTNPEANTILRLSAISVDETIQTIQTAAITLKEAAPDELHLCTRYSAILMYLCRE 769

Query: 787 LRNKTQNLYMNEGVAAKQENADVKVGN-KSLENLSSIENSQEPIEPFIMNEHPQTELPIN 845
           ++ + +    N     +++   ++  N   +E ++S   +     P      P       
Sbjct: 770 MKLRDKTNNNNNTGENEEQKILIENSNPDGVEGVASNFGNVPSTLP------PSYAQKST 823

Query: 846 TTEQIAIVGNEHHG-IEQTPILNPNSMSFQGEVIDWFSSSADIGLEFVESWTEMIEQMYL 904
           T EQ++  G      +++ P L+ N       V DWF+   DIGL+FVE WTEMIEQ YL
Sbjct: 824 TKEQLSDDGAHSMSFMDEGPSLSNN-------VTDWFNVGGDIGLDFVEPWTEMIEQRYL 876

Query: 905 RSSDGDQNIHVNSLFGHM 922
           +S  GD N     L+  +
Sbjct: 877 QS--GDVNTSFEELYRQL 892

>NDAI0H01580 Chr8 (382179..384908) [2730 bp, 909 aa] {ON} Anc_5.525
           YDR421W
          Length = 909

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/934 (42%), Positives = 547/934 (58%), Gaps = 77/934 (8%)

Query: 18  KWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDVTAKINNMK 77
           KW+R Y+AC NC+ RK+KCD+GPL+NPH PPC RC+RE + C+F  TK R   A +   K
Sbjct: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRK--ADLGTSK 76

Query: 78  GSELERXXXXXXLPDVDKKSLNGGGSAGSDLKQNNIRKKPTD----SNWQSDISTMQTAL 133
                          V KK L+      +++     +  P++    + W+  +++MQ +L
Sbjct: 77  IPSTTPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSPSNPISPTKWKIGLTSMQNSL 136

Query: 134 EFLANAVGVISKSDTRSLLNLNQ--NNTLIXXXXXXXXXXXXXXXXXXXRSDSNTPKSRN 191
           EFLA A G +      S  +  +  N+ ++                    SD     + +
Sbjct: 137 EFLAKAAGNVGFLSAPSAHSAREELNSAVVPKATSLPQEESLMNMTSSLHSDL---LNIS 193

Query: 192 SIFSLIHDDTASKVISPLMGTIESIRPKPTRNLSDIEYIGPNKLLTEDEARTLINVFFLT 251
            I  L H         PL+  +  +RP P R L+DI+YIGPN+LL+E +A  LI++FFLT
Sbjct: 194 PIGKLQHKSL------PLIDKLNIVRPTPRRKLTDIDYIGPNRLLSESDAIELIDLFFLT 247

Query: 252 MHPYFPYIPLQLHNPDELVRYPILLCAILTVSSRYNSFNEIF--INN-EYEKDRNIVVHE 308
           M P+FP IPLQL NP EL +YPILLCAILT+SSRY+SF+     INN +  K R+I VHE
Sbjct: 248 MFPFFPNIPLQLQNPKELAQYPILLCAILTISSRYHSFDTFADSINNGQNNKRRHIDVHE 307

Query: 309 KLWFYCQRLISNTIWAEASTRSIGTILAFLLFTEWNPRAIHWTWSDYGNNPELTCFTKNN 368
           KLW YCQRLIS TIWAEASTRSIGTILAF++FTEWNPRAIHW WSDY ++P L   +K N
Sbjct: 308 KLWIYCQRLISQTIWAEASTRSIGTILAFIIFTEWNPRAIHWNWSDYASDPALNDISKRN 367

Query: 369 -ENNMSEFKGEKTTGFEAMRHSDRMAWMFTGSAVRLAQDMHFIDNNYKIFMATHISETFN 427
            E  + + + E  TG +A+R SDRMAWM +G+AVRLAQD   I  N K+ +ATHIS+T  
Sbjct: 368 MEPQIIKREEEGLTGIDAIRRSDRMAWMLSGTAVRLAQDTGLIRTNTKVAIATHISDTHT 427

Query: 428 AMNVNQRXXXXXXXXXXXXXXXRSHGKNNDDEEGHIFAENFG-------NEQYYLEQILK 480
           AMN+NQR                SH  N+D  +    +   G       NE +YL QIL+
Sbjct: 428 AMNMNQRSAL-------------SHSFNSDFFDHLSKSRYIGKDSTQVVNENFYLTQILQ 474

Query: 481 HDKSKEKWIKFLXXXXXXXXXXXXTVITDAEREYLNDEYILYY--QNNNPETQPTWGNHS 538
           + +SKE+W K +              ++D E E+LNDEY LY+  ++N+   +P      
Sbjct: 475 NKESKERWKK-ISATFQKDNEETVGQLSDMEYEFLNDEYALYFSKEDNDSSQRP------ 527

Query: 539 VTSTSLPYPLKFASFHKAKIEILRIMSIAYETIYSAKNKRVLAFNNQRQNLAVLSIFSPL 598
                 P PLKF    +AK+E+LRI+++ YETIY    ++ L  ++QR+NLAVL+I SPL
Sbjct: 528 ------PLPLKFTFVQRAKLELLRIVTLGYETIYYENGEQRLVSDDQRRNLAVLNILSPL 581

Query: 599 IESWYSNHHGLLKLFECAPCDMSKYKDKNTVQKLSQAIEKESLIGDYYYCQLYIYSLALK 658
           I+SWYSN++ LLK     P     +K K    K+SQ I  E++I DYYYCQLYI+SLAL+
Sbjct: 582 IDSWYSNYNSLLKTDAVRPVSPGMHKRKQEAFKMSQNISGETMISDYYYCQLYIFSLALQ 641

Query: 659 VDIKDNNLNLSEITKSAKYVYMAYNAAKEILTSAVRVNKLKLLRYLPVRWVTRILRSVAF 718
           VD+  N L L+EIT+ A YV  AY AAKEIL SA RV+KLK+L+Y+PV+WV RI+RSVAF
Sbjct: 642 VDVGQNKLKLNEITRCAIYVEKAYVAAKEILESAGRVHKLKMLKYMPVKWVMRIVRSVAF 701

Query: 719 IVKCFXXXXXXXXXXXXXXXXXXRLSGIPVDEALELIETTSVTLNDASPDELHLCKRYSS 778
           IVKC+                   LS I VDE ++ I+ T++ L +A+PDELHL  RYS+
Sbjct: 702 IVKCYLTLTSGSFSSNPEARTILSLSAISVDETIQTIQDTAIILKEAAPDELHLSTRYSA 761

Query: 779 ILLYMCKELRNKTQNLYMNEGVAAKQEN----ADVKVGNKSLENLSSIENSQEPIEPFIM 834
           ILLY+C+E+++K ++   ++G  +K  +    +D  + N+S + +S         E  ++
Sbjct: 762 ILLYLCREMKSKHESSQQSKGYDSKSSSNAPLSDDVITNQSGDKMS---------EDILL 812

Query: 835 NEHPQTEL--PINTTEQIAIVGN----EHHGIEQTPILNPNSMSFQGEVIDWFSSSADIG 888
             H +     P  + E I +  N    +            N     G+V +WF++S +IG
Sbjct: 813 KSHAEVAAKDPRTSQENIELQMNKPNLDGKFASDMDFTTDNLNELPGDVANWFTTSGNIG 872

Query: 889 LEFVESWTEMIEQMYLRSSDGDQNIHVNSLFGHM 922
           LEFVE WTEMIEQMYL+S  GD N   + L+  +
Sbjct: 873 LEFVEPWTEMIEQMYLQS--GDANTTFDDLYKEI 904

>KLLA0A01804g Chr1 complement(159689..162526) [2838 bp, 945 aa] {ON}
           similar to uniprot|Q04052 Saccharomyces cerevisiae
           YDR421W ARO80 Zinc finger transcriptional activator of
           the Zn2Cys6 family activates transcription of aromatic
           amino acid catabolic genes in the presence of aromatic
           amino acids
          Length = 945

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/955 (39%), Positives = 543/955 (56%), Gaps = 107/955 (11%)

Query: 19  WRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDVTAKINNMKG 78
           ++R Y+AC+NC+ RK+KCDLGP DNPH PPCVRCKRE REC+F  TKR     ++     
Sbjct: 17  FKRGYKACLNCKMRKVKCDLGPFDNPHGPPCVRCKRESRECMFTETKRGGF--RVAKQSL 74

Query: 79  SELERXXXXXXLPDVDKKSLNG---GGSAGSDLKQNNIRKKPTDSNWQSDISTMQTALEF 135
             L+       + DV    + G        +DL +     K  D +  +D  T+Q A  F
Sbjct: 75  VSLKEESAGKSMADVITSVIQGQTLKKELDTDLDRLQTHTK-DDISINTDPPTLQNAFYF 133

Query: 136 LANAVGVISKSDTRSLLNLNQNNTLIXXXXXXXXXXXXXXXXXXXRSDSNTPKS------ 189
           LA A G ++K D R  ++       I                    + S  P S      
Sbjct: 134 LAKAAGSVAKEDLRDQVDAATKYDEIEPTDAVSRQPSVSSYGNKQATGSMEPSSIPKMLT 193

Query: 190 RNSIFSLIHDDTASKVISPLMGTIESIRPKPTRNLSDIEYIGPNKLLTEDEARTLINVFF 249
            + + S +  +       PL+  + S+RPKP+  L DIEYIGP +LLTE EAR  I+ FF
Sbjct: 194 DSYVTSFVEPEGQKPGTIPLIEKLSSVRPKPSMKLGDIEYIGPYQLLTEAEARKRIDAFF 253

Query: 250 LTMHPYFPYIPLQLHNPDELVRYPILLCAILTVSSRYNSFNEIFINNEYEKDRNIVVHEK 309
           LTMHP+ PYIPLQL + DEL RYP+LLC ILT+S+RY++ +++ + NE +   ++ +HE+
Sbjct: 254 LTMHPFSPYIPLQLQDADELARYPLLLCTILTISARYHTLHDLGL-NEIDNTVHVELHER 312

Query: 310 LWFYCQRLISNTIWAEASTRSIGTILAFLLFTEWNPRAIHWTWSDYGNNPELTCFTKNNE 369
           LW YCQRL+S T+WAEASTRSIGTILAFL+FTEWNPRAIHW  SDY N P+++   K   
Sbjct: 313 LWIYCQRLVSQTVWAEASTRSIGTILAFLIFTEWNPRAIHWKGSDYANYPDISDLPKRPS 372

Query: 370 NNMSEFKGEKT-TGFEAMRHSDRMAWMFTGSAVRLAQDMHFIDNNYKIFMATHISETFNA 428
           +  S+ +G  + TG  AMR SDRM+W+ TG+AVRLAQD++ I+ + KIF+ THI ET  A
Sbjct: 373 SQTSQPQGSDSLTGLAAMRRSDRMSWLLTGNAVRLAQDLNVIEFSSKIFVMTHICETHTA 432

Query: 429 MNVNQRXXXXXXXXXXXXXXXRSHGKNNDDEEGHIFAENFGNEQYYLEQILKHDKSKEKW 488
           MN+N+R               R +G  ++D           NEQ++LE+IL++DKSKE+W
Sbjct: 433 MNLNKR-----SSLSESLSEVRLNGFEDND---------LDNEQFFLERILQNDKSKERW 478

Query: 489 IKFLXXXXXXXXXXXXTVITDAEREYLNDEYILY-YQNNNPETQPTWGNHSVTSTSLPYP 547
            +FL              +TD ERE+LNDEY+LY Y   NP TQ          +   + 
Sbjct: 479 ARFLERVGERSKKGS---LTDIEREFLNDEYLLYHYNTENPNTQ----------SDPEFR 525

Query: 548 LKFASFHKAKIEILRIMSIAYETIYSAKNKRVLAFNNQRQNLAVLSIFSPLIESWYSNHH 607
           LKF+   + K+E+L+I+S+ YE +Y+ K    L+ +++ Q L++LS+ SPLIE WY+ + 
Sbjct: 526 LKFSKIQRGKVELLKIVSLGYENVYNGK----LSSHDRHQRLSMLSVLSPLIEGWYNIYK 581

Query: 608 GLLKLFECAPCDMSKYKDKNTVQKLSQAIEKESLIGDYYYCQLYIYSLALKVDIKDNN-- 665
            LL     A C ++K  +K+ V ++++ +E ESLI DYYYCQLYIYSLAL+ D +D +  
Sbjct: 582 SLLVPCGGAACSIAKSSNKSFVFEMTEKVEHESLISDYYYCQLYIYSLALQWDHQDTSTS 641

Query: 666 -LNLSEITKSAKYVYMAYNAAKEILTSAVRVNKLKLLRYLPVRWVTRILRSVAFIVKCFX 724
            L L+EITKSA+YV +AYNAAKEIL SA RV+KLK+L+Y+PVRWV RI+RS+ F++KC+ 
Sbjct: 642 KLRLNEITKSARYVELAYNAAKEILNSAQRVHKLKMLKYMPVRWVMRIVRSIVFMIKCYL 701

Query: 725 XXXXXXXXXXXXXXXXXRLSGIPVDEALELIETTSVTLNDASPDELHLCKRYSSILLYMC 784
                             +S +P DE ++ I+ T++ L  A+PDELHLC RYS+IL+Y+C
Sbjct: 702 TLTGNGITQNPEANTILTMSVLPTDEIIQTIQRTAIILRAAAPDELHLCSRYSTILMYLC 761

Query: 785 KELRNKTQ------------NLYMNEGVAAKQENAD-----VKVGNKSLENLSSIENSQE 827
            E++++ +            N Y+++     +  AD       VG   + + +++ +S  
Sbjct: 762 TEMKHRCKPNMQPPVPRSISNDYLDKTSNRSENVADNSARHFSVGGYQVSDTANVSSS-- 819

Query: 828 PIEPFI---------MNEHPQTE-----------LPINTTEQIAIVG------------- 854
              PFI           E+ Q E             +++   +A +              
Sbjct: 820 ---PFINKGTNVRFGSTEYKQQETTNDEQQRPDTFTVDSALGVASINSAPPAPVPEPAPD 876

Query: 855 -NEHHGIEQTPILNPNSMSFQGEVIDWFSSSADIGLEFVESWTEMIEQMYLRSSD 908
            N    I   P  N +      +++DWF+ + +IGL+FV  WTEM+E+ ++   D
Sbjct: 877 TNPASAINTGP--NSSGGYLPPQLVDWFNDNNEIGLDFVGPWTEMVEKQFVNKVD 929

>KLTH0G03718g Chr7 (292858..295431) [2574 bp, 857 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 857

 Score =  610 bits (1572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/909 (37%), Positives = 499/909 (54%), Gaps = 86/909 (9%)

Query: 18  KWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDVTAKINNMK 77
           K+RR Y+AC+NCRSRK +CDLGP D+P  PPCVRCKRE++EC+F    +R    +I    
Sbjct: 16  KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWTV 75

Query: 78  GSELERXXXXXXLPDVDKKSLNGGGSAGSDLKQNNIRKKPTDSNWQSDISTMQTALEFLA 137
               +           DK          + +K+ ++           ++++M  ALEFLA
Sbjct: 76  DGNTD-VNATARFEAEDKYIPVATLKDTTSIKEGSL---------TPELNSMHNALEFLA 125

Query: 138 NAVGVISKSDTRSLL-NLNQNNTLIXXXXXXXXXXXXXXXXXXXRSDSNTPKSRNSIFSL 196
            A G  +K D+RS + +  + +  I                   R+   TP         
Sbjct: 126 KAAGSAAKEDSRSRIPSYERQDKTIREKTYHREESPNQHASGSKRASLATP--------- 176

Query: 197 IHDDTASKVISPLMGTIESIRPKPTRNLSDIEYIGPNKLLTEDEARTLINVFFLTMHPYF 256
                       L+  +   +P    +L D+EYIG +KLLTE EA  LI++FFL MHP+F
Sbjct: 177 ----------GKLIEKLSDWKPGSLYDLGDVEYIGGHKLLTEKEATRLIDLFFLNMHPFF 226

Query: 257 PYIPLQLHNPDELVRYPILLCAILTVSSRYNSFNEIFINNEYEKDRNIVVHEKLWFYCQR 316
           PYIP QL    EL RYPILLCAILT+S+RY++F E  ++      RNI VH++LW YCQR
Sbjct: 227 PYIPFQLRCSQELKRYPILLCAILTISARYHNFAEHKVSEGERSSRNIEVHDRLWIYCQR 286

Query: 317 LISNTIWAEASTRSIGTILAFLLFTEWNPRAIHWTWSDYGNNPELTCFTKNNENNMSEFK 376
           LIS ++WAEASTRS+GTILAFLLFTEWNPRAIHW W+DY N+  L+  ++ + ++ ++  
Sbjct: 287 LISQSVWAEASTRSVGTILAFLLFTEWNPRAIHWHWTDYANDTSLSDISRRDYHSEAKRS 346

Query: 377 GEKT-TGFEAMRHSDRMAWMFTGSAVRLAQDMHFIDNNYKIFMATHISETFNAMNVNQRX 435
              + TG  AMR SDRMAWM TG+AVRLAQDM F++N+ KIF A HI+ET  AMN+NQR 
Sbjct: 347 DNTSLTGMGAMRRSDRMAWMLTGTAVRLAQDMGFMNNSPKIFTALHITETQTAMNMNQRS 406

Query: 436 XXXXXXXXXXXXXXRSHGKNNDDEEGHIFAENFGNEQYYLEQILKHDKSKEKWIKFLXXX 495
                           +G + D           G     +E+I +++ SK +W  +    
Sbjct: 407 ILSQSLAEVSL-----NGHDGDS----------GLSSACIEEIFRNEDSKRRWKSY--TQ 449

Query: 496 XXXXXXXXXTVITDAEREYLNDEYILYYQNNNPETQ--PTWGNHSVTSTSLPYPLKFASF 553
                        D E+E+L DEY  ++  ++   +     G H  +  S    L F   
Sbjct: 450 QRDSVEGKSVGFCDNEKEFLIDEYAFFHNEDSDAYRDLSNLGTHEKSKLSAADKLLFTPR 509

Query: 554 HKAKIEILRIMSIAYETIYSAKNKRVLAFNNQRQNLAVLSIFSPLIESWYSNHHGLLKLF 613
            +AK+E+LRIMSI YE IY    K  L   + +  LAVL I +P+I+ W++ +  LL  F
Sbjct: 510 QRAKVELLRIMSIGYEAIYYKDTK--LTLIDHKHKLAVLGILAPMIKGWHNTYKHLLVPF 567

Query: 614 ECAPCDMSKYKDKNTVQKLSQAIEKESLIGDYYYCQLYIYSLALKVDI---KDNNLNLSE 670
               C  ++ ++KN        I+ ESLI DY+YCQLYIYSLAL+++    KD   N++E
Sbjct: 568 AGGQCPPTRDENKNATYDTPSKIDSESLISDYFYCQLYIYSLALQIEAGTEKDKKPNINE 627

Query: 671 ITKSAKYVYMAYNAAKEILTSAVRVNKLKLLRYLPVRWVTRILRSVAFIVKCFXXXXXXX 730
           +TKSAKYV +AYNAAKE+L SA+RV+KL+ L+Y+PVRW  RI+R+VAF+V+C+       
Sbjct: 628 LTKSAKYVELAYNAAKEVLHSAIRVHKLRALKYMPVRWAARIIRAVAFVVRCYMTLTGSG 687

Query: 731 XXXXXXXXXXXRLSGIPVDEALELIETTSVTLNDASPDELHLCKRYSSILLYMCKELRNK 790
                       +  I  +E +E+I+  ++TL +ASPDELHLC R+S++L+++C E++ K
Sbjct: 688 LGSDPRATTILAVCVISAEEIIEMIQKAAITLREASPDELHLCSRFSTVLMFLCTEMKRK 747

Query: 791 TQNLYMNEGVAAKQENADVKVGNKSLENLSSIENSQEPIEPFIMNEHPQTELPINTTEQI 850
                      ++ +N++++         SS  +   P +           +P    E  
Sbjct: 748 QH---------SEPQNSELR--------RSSSHSLHNPTD-------APARMPTTPAENY 783

Query: 851 AIVGNEHHGIEQTPILNPNSMSFQGEVIDWFSSSADIGLEFVESWTEMIEQMYLRSSDGD 910
           A          +TP  +P+ +    E+ DWF +S D+GL+FVE W EM+EQ ++   + D
Sbjct: 784 AATDFAIPAFLETP--HPSHLP--SELEDWFCTSDDVGLDFVEPWAEMLEQQFI---NND 836

Query: 911 QNIHVNSLF 919
           +N+   +L+
Sbjct: 837 KNMTFENLY 845

>TBLA0D01670 Chr4 complement(413360..416416) [3057 bp, 1018 aa] {ON}
           Anc_5.525 YDR421W
          Length = 1018

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/842 (40%), Positives = 486/842 (57%), Gaps = 56/842 (6%)

Query: 1   MSLSKRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECI 60
           + LSKR   ++S  +  +WRRSY+AC+NCR +K+KCDLGPL+NPH PPCVRCKRE R+CI
Sbjct: 6   LRLSKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCI 65

Query: 61  F--PVTKRR---------DVTAKINNMKGSELERXXXXXXLPDVDKKSLNGGGSAGSDLK 109
           F  P+ K           D   ++ N    E+++        D+ ++ ++   +      
Sbjct: 66  FDEPLKKLGTVENENDSIDDNQRVPNSPEDEIQQNT------DIIQERISSIVATNESRF 119

Query: 110 QNNI--------RKKPTD--SNWQSDISTMQTALEFLANAVGVISKSDTRSLLNLNQNNT 159
            N+I        + KP++  SN + + + M+ ALEFLANA G  ++    S      NN 
Sbjct: 120 NNDISNSQKHERKDKPSERKSNLKVNFTNMRNALEFLANAAGQAAEE-RLSEEEEELNNK 178

Query: 160 LIXXXXXXXXXXXXXXXXXXXRSDS--NTPKSRNSIFSLI--HDDTASKVISPLMGTIES 215
                                 +DS  +   S  SI SL    ++T  K ++ L+  + +
Sbjct: 179 FEKELNDDHISIDSPATQSTTSTDSVKHLDLSDESIASLFLSENETNRKKVTSLIEAVIA 238

Query: 216 IRPKPTRNLSDIEYIGPNKLLTEDEARTLINVFFLTMHPYFPYIPLQLHNPDELVRYPIL 275
            RP   R L+D +YIG +K+++E EA  LIN FFLTMHP++PY+P QL +P EL RYPIL
Sbjct: 239 ARPISNRKLTDYDYIGKSKMISEFEAIQLINAFFLTMHPFYPYLPDQLQDPHELARYPIL 298

Query: 276 LCAILTVSSRYNSFNEIFINNEYEKDRNIVVHEKLWFYCQRLISNTIWAEASTRSIGTIL 335
           LC ILT+SSR++ FNE+   N     R+I VHEKLW YCQ++IS T+WAEASTRS+GT+L
Sbjct: 299 LCTILTISSRHHKFNELGTYNGVNDKRHIDVHEKLWVYCQKMISQTVWAEASTRSLGTVL 358

Query: 336 AFLLFTEWNPRAIHWTWSDYGNNPELTCFTKNNENNMSEFK-GEKTTGFEAMRHSDRMAW 394
           AFLLFTEWNPRAIHW W+DY NNP+L  F+ ++       K G++TTG  A+R SDRMAW
Sbjct: 359 AFLLFTEWNPRAIHWKWADYANNPKLNDFSTSDTGINDYLKVGKRTTGLGAIRRSDRMAW 418

Query: 395 MFTGSAVRLAQDMHFIDNNYKIFMATHISETFNAMNVNQRXXXXXXXXXXXXXXXRSHGK 454
           M  G++VR+AQDM FI+N+  +F+ATH SETF+AMNV QR               R    
Sbjct: 419 MLCGTSVRIAQDMGFIENSSNVFVATHTSETFHAMNVGQRSSLNESLNDTYYSQGRMSSY 478

Query: 455 NNDDEEGHIFAENFGNEQYYLEQILKHD---KSKEKWIKFLXXXXXXXXXXXXTV-ITDA 510
            N  +      +   NE +Y+E I   +     +  W   L             + ++D 
Sbjct: 479 RNKQQ------QTLKNEIFYIENIFSENFKITERNYWKSQLQENIENKIDIDDKIALSDK 532

Query: 511 EREYLNDEYILYYQNNNPETQPTWGNHS-----VTSTSLPYPLKFASFHKAKIEILRIMS 565
            R +LNDE+ L+Y N N    PT+ N        + ++LP P+  +   +A IE+LRI S
Sbjct: 533 VRGFLNDEFALFYSNGN---DPTYSNERNNQPYSSFSTLPLPVNLSKSQQANIELLRIFS 589

Query: 566 IAYETIYSAKNKRVLAFNNQRQNLAVLSIFSPLIESWYSNHHGLLKLFE-CAPCDMSKYK 624
            AY+TIYS    + L+ NNQ  N+++L IF+PL+ +W      LL+  + C P +++   
Sbjct: 590 TAYKTIYSRNQNQKLSSNNQSHNISLLDIFAPLLHNWTIAFGDLLQPSDVCEPINLNNRN 649

Query: 625 DKNTVQKLSQAIEKESLIGDYYYCQLYIYSLALKVDIKDNNLNLSEITKSAKYVYMAYNA 684
           +K  V++ ++ IE ESLI DY YCQLYI+SLAL++ +    L ++EITKS+ Y+ +AY +
Sbjct: 650 NKRVVKEFNKIIEGESLICDYNYCQLYIFSLALQIGLDGEILTVNEITKSSTYINLAYQS 709

Query: 685 AKEILTSAVRVNKLKLLRYLPVRWVTRILRSVAFIVKCFXXXXXXXXXXXXXXXXXX--R 742
           AKE + S  RV  LK+L+Y+PVRW+TR++R+ AF+VKC+                    +
Sbjct: 710 AKEYILSTERVFTLKMLKYMPVRWLTRLIRATAFLVKCYLSVAGTDQELNSISEINMIFK 769

Query: 743 LSGIPVDEALELIETTSVTLNDASPDELHLCKRYSSILLYMCKELRNKTQNLYMNEGVAA 802
           L G   +E LELI+ +++ L  +SPDELHLC RYSSI++   KE+  K  NL    G   
Sbjct: 770 LGGTSANEVLELIKKSAILLGSSSPDELHLCSRYSSIIMCFYKEMSEK--NLTRKRGSTD 827

Query: 803 KQ 804
           K 
Sbjct: 828 KH 829

 Score = 61.6 bits (148), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 39/67 (58%), Gaps = 7/67 (10%)

Query: 842  LPINTTEQIAIVGNEHHGIEQTPILNPNSMSFQGEVIDWFSSSADIGLEFVESWTEMIEQ 901
            L  NT E     G  H G+   P     + S   E +DWFS+S DIGLEFVESWTEM+EQ
Sbjct: 953  LSYNTRETSPNTG--HTGVTGEP-----TGSHANEFLDWFSASGDIGLEFVESWTEMLEQ 1005

Query: 902  MYLRSSD 908
             Y++  D
Sbjct: 1006 RYMKDDD 1012

>KNAG0C03250 Chr3 complement(635995..638805) [2811 bp, 936 aa] {ON}
           Anc_5.525 YDR421W
          Length = 936

 Score =  596 bits (1537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/962 (38%), Positives = 509/962 (52%), Gaps = 95/962 (9%)

Query: 17  TKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDVTAKINNM 76
           T W R ++AC NCR +K++CD GP DNPH PPC RCKRE + C F        T K  +M
Sbjct: 17  THWIRGFKACTNCRIKKVRCDFGPSDNPHPPPCARCKRESKNCTFTAK-----TGKEQDM 71

Query: 77  KGSELERXXXXXXLPDVDKKSLNGGGSA---GSDLKQNNIR---KKPTDSNWQSDISTMQ 130
              E            V K  L     A      L QN      +   ++ W+ ++++M 
Sbjct: 72  VTGEATNGIPTVDTVPVKKNELALPALAVTVSPGLIQNRSEMGNEANPNTGWKLELTSMH 131

Query: 131 TALEFLANAVGVISKSDTRSLLNLNQNNTLIXXXXXXXXXXXXXXXXXXXRSDSNTPKSR 190
             L FLA A G +S +  + L+                            R  S TP   
Sbjct: 132 NTLAFLAQAAGTVSNTLNKGLMK------------KTLPSDRSTPSLEISRLGSKTPTGF 179

Query: 191 NSIFSLIHDDTASKVI---------SPLMGTIESIRPKPTRNLSDIEYIGPNKLLTEDEA 241
            S   L      +K +           L+   ++ + K  + L DI+ IG N LL+E EA
Sbjct: 180 ASSLGLGMPSNPTKTLLQEIETQNKVQLIEKSKNTKSKVPKTLKDIKCIGENGLLSEQEA 239

Query: 242 RTLINVFFLTMHPYFPYIPLQLHNPDELVRYPILLCAILTVSSRYNSFNEI-FINNEYEK 300
              I+ FF TMHP+FPYIPLQL +P EL+ YPILLCAILT+S+RY+SF+E  F N +Y K
Sbjct: 240 TAFIDAFFCTMHPFFPYIPLQLQDPLELLEYPILLCAILTISTRYHSFSEFGFDNGDYNK 299

Query: 301 DRNIVVHEKLWFYCQRLISNTIWAEASTRSIGTILAFLLFTEWNPRAIHWTWSDYGNNPE 360
            RN  VHEKLW  CQ ++S TIW EASTRSIGT+LAF+LFTEWNPR IHW  SDY N+ +
Sbjct: 300 -RNFEVHEKLWDNCQVMLSKTIWGEASTRSIGTVLAFILFTEWNPRQIHWKKSDYANDDD 358

Query: 361 LTCFTKNNENNMSEFKGEKTTGFEAMRHSDRMAWMFTGSAVRLAQDMHFIDNNYKIFMAT 420
                    + +S  + E+ TG +A+R SDRMAWM TGSAVRLAQDM F++ N K+ +AT
Sbjct: 359 EAV------SELSNDEAEELTGTKAIRRSDRMAWMLTGSAVRLAQDMGFMETNAKVCVAT 412

Query: 421 HISETFNAMNVNQRXXXXXXXXXXXXXXXR-SHGKNNDDEEGHIFAENFGNEQYYLEQIL 479
           HIS+ F +MN+NQ+                 +    N     H   E+  +EQ +++Q+L
Sbjct: 413 HISDAFASMNMNQKPVLSGNFNVLQGGTNNYTSDPLNSSGSSH---ESTCSEQAFMKQML 469

Query: 480 KHDKSKEKWIKFLXXXX-----XXXXXXXXTVITDAEREYLNDEYILYY----QNNNPET 530
           ++  S  +W   L                   ++D ERE+LNDE+ILYY    +++N ET
Sbjct: 470 ENTNSHTRWRHILSSLQMEDLFQRQRNEYSNDLSDLEREFLNDEFILYYSLERRSDNQET 529

Query: 531 QPTWGNHSVTSTSLPYPLKFASFHKAKIEILRIMSIAYETIYSAKNKRVLAFNNQRQNLA 590
                         P+PL+F+   KAKIE+  IM + Y+TIY  + ++ LA NNQ  NL+
Sbjct: 530 P-------------PFPLQFSYAQKAKIELTNIMLLGYDTIYYDRGRKKLASNNQLHNLS 576

Query: 591 VLSIFSPLIESWYSNHHGLLKLFECAPCDMSKYKDKNTVQKLSQAIEKESLIGDYYYCQL 650
           VLSI SPL+E W++ +  LL      P   +   DK  + +LS+ I+ ES+I DY Y QL
Sbjct: 577 VLSILSPLMEGWHNVYKNLLIAPSANPYTTTTRGDKRAMYELSKNIDSESIICDYRYSQL 636

Query: 651 YIYSLALKVDIKDNNLNLSEITKSAKYVYMAYNAAKEILTSAVRVNKLKLLRYLPVRWVT 710
           YIYSLAL+ D K   L +SEIT++AKYV +A+NAAKEI+ SA RV+KL LL+Y+PVRWV 
Sbjct: 637 YIYSLALQADFKRAELTVSEITQNAKYVEIAFNAAKEIIFSAFRVHKLNLLKYMPVRWVM 696

Query: 711 RILRSVAFIVKCFXXXXXXXXXXXXXXXXXXR----LSGIPVDEALELIETTSVTLNDAS 766
           R++R+V+F+VKC                   R    L  I V +    I+  ++TL +A+
Sbjct: 697 RLVRAVSFLVKCCLILNATSIGGGGSSEAEVRTILKLCSISVKDTANTIKMAAMTLKEAT 756

Query: 767 PDELHLCKRYSSILLYMCKELRNKTQ---------NLYMNEGVAAKQENADVKVGNKS-- 815
           PDELHL  RYS+ILLY+C+EL ++           N      ++   E  D ++   S  
Sbjct: 757 PDELHLSMRYSAILLYLCRELESEKDSSKKIPFPNNATTKYAISPTYEGRDGEIAAGSAG 816

Query: 816 -LENLSSIENSQEPIEPFI-MNEHPQTELPINTTEQI---AIVGNEHH-------GIEQT 863
              N + I  ++    P   +NE             I   ++ G+ +H       G    
Sbjct: 817 GCANTAHITANRLRTVPLSDINETTGRNTEDTANNNIVNGSLNGDRNHLGTTEGTGAASQ 876

Query: 864 PILNPNSMSFQGEVIDWFSSSADIGLEFVESWTEMIEQMYLRSSDGDQNIHVNSLFGHMD 923
              +  + S   EV +WFS +A+IGLEFVE WT+MIEQ +L+S  G  N     L+ + D
Sbjct: 877 STTDRLTGSLPDEVTNWFSGNAEIGLEFVEPWTDMIEQRFLQSGTG--NDVFEELYQYFD 934

Query: 924 RN 925
           +N
Sbjct: 935 QN 936

>CAGL0F03025g Chr6 (295783..298569) [2787 bp, 928 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421w
           positive transcription regulator of ARO9 and ARO10
          Length = 928

 Score =  555 bits (1430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/969 (34%), Positives = 522/969 (53%), Gaps = 123/969 (12%)

Query: 2   SLSKRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
           S S  P+   S +QG K + ++ AC+ C+ +KIKCDLGP D P  PPC  C+R +  C F
Sbjct: 14  SRSTTPVGGSSSSQGQKHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFF 73

Query: 62  PVTKRR----------------------------DVTAKINN---MKGSELERXXXXXXL 90
              K +                             +T  + N   M G++         L
Sbjct: 74  NAPKVKIGKLGNILDSQGLQSSQSTSPTSASMLNAITQSLQNHRAMNGNQNMHLNNLSNL 133

Query: 91  PDVDKKSLNGGG--SAGSDLKQNNIRKKPTDSNWQSDISTMQTALEFLANAVGVISKSDT 148
             +  ++L G    S  + L +   R K +D+ W+ ++++MQ+ALEFLA A         
Sbjct: 134 VGLKNQNLEGVSLNSPNTALIEACDRVK-SDTAWKLELTSMQSALEFLAKAT-------- 184

Query: 149 RSLLNLNQNNTLIXXXXXXXXXXXXXXXXXXXRSDSNTPKSRNSIFSLIHDDTASKVISP 208
             L N  +NN                      + + N   S  +  S    DT+++   P
Sbjct: 185 -KLRNDYKNNEPFGSTRSDAASTTSETRDLSEKDNGNESDSTTNSTS---KDTSTRSSYP 240

Query: 209 LMGTIESIRPK-PTRNLSDIEYIGPNKLLTEDEARTLINVFFLTMHPYFPYIPLQLHNPD 267
              +IE+I+P+ PT +  + + +G  KL+T DEAR L+N+FF  MHP++PYIPL L + D
Sbjct: 241 ---SIEAIKPEVPTPSNHNYDLLGDGKLVTMDEARMLVNIFFNFMHPFYPYIPLHLQDFD 297

Query: 268 ELVRYPILLCAILTVSSRYNSFNEIFINNEYEKDRNIVVHEKLWFYCQRLISNTIWAEAS 327
           EL +YP+LL  IL +S+RYN F+++  +N  E +RN+++H KLW +CQ+L+S T+W++AS
Sbjct: 298 ELFKYPLLLHCILAISARYNPFDKVGFDNGIEGNRNVIIHNKLWTHCQQLLSQTVWSQAS 357

Query: 328 TRSIGTILAFLLFTEWNPRAIHWTWSDYGNNPELTCFTKNNENNMSEFKGEKTTGFEAMR 387
           TRSIGT LAFLLFTEWNPRAIHW  SD  +      +  +N  + S+   +   G   ++
Sbjct: 358 TRSIGTTLAFLLFTEWNPRAIHWEVSDTAH------YLSDNNVSSSKEDPDGLGGIATVK 411

Query: 388 HSDRMAWMFTGSAVRLAQDMHFIDNNYKIFMATHISETFNAMNVNQRXXXXXXXXXXXXX 447
            SDRMAWMFTG+A+RLAQ+M  ++NN KI+ A +I+E   A N+N +             
Sbjct: 412 RSDRMAWMFTGTAIRLAQEMDILENNAKIYTAANIAEICYASNMNLKPTLGESLVSIDGG 471

Query: 448 XXR---SHGKNNDDEEGHIFAENFGNEQYYLEQILKHDKSKEKWIKFLXXXXXXXXXXXX 504
                  + K+ DD E     +       +++ + ++ +S +KW                
Sbjct: 472 MKEFEIDNPKSQDDIENEDLLK-------FVQLVAQNKESTKKW-AIHKAYSDKLKEENP 523

Query: 505 TVITDAEREYLNDEYILYYQNNNPETQPTWGNHSVTSTSLPYPLKFASFHKAKIEILRIM 564
            +I D E E+LNDEY + Y + N             S+ L  P+ + ++ KA++E+LRI+
Sbjct: 524 DLIIDLETEFLNDEYSINYLDEN-------------SSFLKNPIPYTTYQKAQLELLRIV 570

Query: 565 SIAYETIYSAKNKRVLAFNNQRQNLAVLSIFSPLIESWYSNHHGLLK-LFECAPC----- 618
           +I Y+TIY  K K+ ++  +Q++NL +L + SP++ +WY N++ L+K + +  P      
Sbjct: 571 TITYQTIYYEKMKKRVSSVDQKKNLMILDVLSPILNAWYLNYYKLMKPVSDEKPVIISLD 630

Query: 619 DMSKYKDKNTVQKLSQAIEKESLIGDYYYCQLYIYSLALKVDIKDNNLNLSEITKSAKYV 678
           D+SK+K        +  I  ES I DYYYCQLY +SLAL+V++K++ L L+E+ KSA++V
Sbjct: 631 DLSKFKR-------TANIRGESFISDYYYCQLYTFSLALQVEVKESKLTLNEMIKSARFV 683

Query: 679 YMAYNAAKEILTSAVRVNKLKLLRYLPVRWVTRILRSVAFIVKCFXXXXXXXXXXXXXXX 738
             AY AAKEIL SA+RV+K+ +L+Y+PVRWV RI+RS +FIVKC+               
Sbjct: 684 EQAYRAAKEILKSAIRVHKVDMLKYMPVRWVMRIVRSASFIVKCYITLCDHSMATNSEAK 743

Query: 739 XXXRLSGIPVDEALELIETTSVTLNDASPDELHLCKRYSSILLYMCKEL---RNKTQNLY 795
              +LSGI VD+ + +I   +V L +++PDELHL  ++S+IL+++CKE+   +   +NL 
Sbjct: 744 SILKLSGILVDDTVHMIRQAAVILKESTPDELHLASKFSTILMFLCKEIDERKRDNENLM 803

Query: 796 MNEGVAAKQENADVKVGNKSLE--NLSSI-ENSQEPIEPFIMNEHPQTELPINTTEQIAI 852
              G+             +SLE  N  +I  ++QEP      +    T+   N+T ++  
Sbjct: 804 TGNGLNNDPSLESQTTHKESLEASNHDTISSDAQEPPSENDSSHDTTTQGTANSTRKVG- 862

Query: 853 VGNEHHGIEQTPILNPNSMSFQGE--------VIDWFSSSADIGLEFVESWTEMIEQMYL 904
                          PNS+   G+        VIDWFS+S +IGL+FVE WTE+IEQ Y+
Sbjct: 863 ---------------PNSIDEIGQFTAYLPEDVIDWFSASNNIGLDFVEPWTELIEQKYI 907

Query: 905 RSSDGDQNI 913
           ++ DG Q+ 
Sbjct: 908 QNKDGFQDF 916

>ADR199C Chr4 complement(1048528..1051362) [2835 bp, 944 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR421W
           (ARO80)
          Length = 944

 Score =  518 bits (1333), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 341/982 (34%), Positives = 482/982 (49%), Gaps = 131/982 (13%)

Query: 13  GNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFP---VTKRRDV 69
              G KWRR Y+AC+NCR+RK++CDLGP+D P +PPCVRC RE++ECIF      + R +
Sbjct: 19  AGSGRKWRRIYKACLNCRTRKVRCDLGPVDKPREPPCVRCSRERKECIFTELRRGRNRRI 78

Query: 70  TAKINNMKGSELERXXXXXXLPDVDKKSLNG-------GGSAGSDLKQNNIRKKPTDS-- 120
               N+  G               D  S  G         SAGSD   ++   +  D   
Sbjct: 79  RVAKNDRAGHAEPDGGICVANAHGDPSSATGRFSGEPTALSAGSDPSPDSASNRGRDDQS 138

Query: 121 --------------NWQSDISTMQTALEFLANAVGVISKSDTRSLLNLNQNNTLIXXXXX 166
                         +  S+ +T+   LEFL  A G ++K + R L     ++T +     
Sbjct: 139 SNSDEPEFSERPELSLSSEFTTLHNTLEFLTKAAGSVAKDNGRLL----SSSTAVGKHSA 194

Query: 167 XXXXXXXXXXXXXXRSDSNTPKSRNSIFSLIHDDTASKVISPLMGTIESIRPKPTRN--- 223
                               P       S++      + I+       + + +P      
Sbjct: 195 AICESITLQLY--------NPLHNGQYASVVSGPRNPEAITDQAAASRTPQEEPESTKYP 246

Query: 224 -LSDIEYIGPNKLLTEDEARTLINVFFLTMHPYFPYIPLQLHNPDELVRYPILLCAILTV 282
            L +IEY+GPN  LT +E   L  +FF+T +P+FP+IPL + +P+EL RYPILLC +L++
Sbjct: 247 LLRNIEYVGPNNTLTVEEVIRLTELFFVTHYPFFPHIPLHMQDPEELARYPILLCGVLSI 306

Query: 283 SSRYNSFNEIFINNEYEKDRNIVVHEKLWFYCQRLISNTIWAEASTRSIGTILAFLLFTE 342
           S+RY+ F +I ++N     RNI VHE LW YCQ++IS T+W EASTRSIGT+L FL+FTE
Sbjct: 307 SARYHKFEDIGLSNRGSPTRNIDVHEYLWRYCQQMISQTVWTEASTRSIGTVLVFLIFTE 366

Query: 343 WNPRAIHWTWSDYGNNPELTCFTKNNENNMSE-----------------------FKGEK 379
           WNPRAIH   +DY N  +     + NE + SE                          + 
Sbjct: 367 WNPRAIHRKCNDYANATD-----RQNEQSHSEKANTAHCGSGIPATERNGPRRFVLADQG 421

Query: 380 TTGFEAMRHSDRMAWMFTGSAVRLAQDMHFIDNNYKIFMATHISETFNAMNVNQRXXXXX 439
           ++G  AMR S RMAWM  G+AVRLAQDM FI+ + KIF+ATH SET  AMN+ Q      
Sbjct: 422 SSGLSAMRRSKRMAWMLVGNAVRLAQDMDFINTSSKIFVATHTSETNCAMNMGQNSTL-- 479

Query: 440 XXXXXXXXXXRSHGKNNDDEEGHIFAENFGNEQYYLEQILKHDKSKEKWIKFLXXXXXXX 499
                      SH   N +  G   +    N     E   ++    ++  K +       
Sbjct: 480 -----------SHSLMNANIIGSESSTAISNPPMPSETEERYKSVLQRLGKHVPRGRG-- 526

Query: 500 XXXXXTVITDAEREYLNDEYILYYQNNNPE--------TQPTWGNHSVTSTSLPYPLK-- 549
                  ++    E+L DE ILY      E           T  N S+ +      L+  
Sbjct: 527 -------LSQLYNEFLEDERILYGLGGGSEYVEAYCDSLDQTKNNVSIETAYESSLLERG 579

Query: 550 ----FASF-HKAKIEILRIMSIAYETIYSAKNKRVLAFNNQRQNLAVLSIFSPLIESWYS 604
               F SF  +AKIE+LRIMS+ YETIYS   K VL    +   L+VL + SP IE+WY+
Sbjct: 580 GQQVFLSFAQRAKIELLRIMSVGYETIYSNHAKLVL--REKHHILSVLGLLSPQIENWYT 637

Query: 605 NHHGLLKLFECAPCDMSKYKDKNTVQKLSQAIEKESLIGDYYYCQLYIYSLALKVDIKD- 663
            ++ LL     AP + +    +     L + I+ ES+I DYYYCQLYIYSLAL VD +  
Sbjct: 638 QYNSLLVPAGGAPFNPTADFSRINPLDLVRRIDAESIICDYYYCQLYIYSLALTVDFRKP 697

Query: 664 ---NNLNLSEITKSAKYVYMAYNAAKEILTSAVRVNKLKLLRYLPVRWVTRILRSVAFIV 720
              N   L  + KSA+YV +AYNAA+E+L SA+RV+++++L+Y+P RWV RI+ +VAFIV
Sbjct: 698 RHPNASWLDRLMKSARYVELAYNAAREVLRSAIRVHRIRMLKYMPTRWVERIVGAVAFIV 757

Query: 721 KCFXXXXXXXXXXXXXXXXXXRLSGIPVDEALELIETTSVTLNDASPDELHLCKRYSSIL 780
           KC+                   LS IP DE +  I+  ++TL +ASPD++HLC +YS+IL
Sbjct: 758 KCYLTMAAHLTASHEASAILT-LSAIPPDEVVNTIQRAAITLREASPDDVHLCNKYSTIL 816

Query: 781 LYMCKE--LRN-KTQNLYMNEGVAAKQENADVKVGNKSLENLSSIENSQEPIEPFIMNEH 837
           +Y+C E  LRN  T    +   V+   E   V V   S    + I         F    H
Sbjct: 817 MYLCSEMKLRNWPTPTPPLPRSVSG--EPIRVPVFECSATPAARI---------FSPPHH 865

Query: 838 PQTELPINTTEQIAIVGNEHHGIEQTPILNPNSMSFQGEVIDWFSSSADIGLEFVESWTE 897
           P        T+   +  +        P     +     E+IDW  +S +IGL+FVE WT+
Sbjct: 866 PAESQTTGGTDPPPLPDHTLAAPSSDPAPFDTTSHLPWELIDWLHTSDEIGLDFVEPWTD 925

Query: 898 MIEQMYLRSSDGDQNIHVNSLF 919
           +IE++      G  NI  NSL+
Sbjct: 926 VIERLM---ESGPDNIDTNSLY 944

>KNAG0E04100 Chr5 (814663..817374) [2712 bp, 903 aa] {ON}
          Anc_4.344 YML076C
          Length = 903

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 38/60 (63%), Gaps = 1/60 (1%)

Query: 7  PLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKR 66
          P + E G +G K +R+  ACV C S K KC     ++ ++ PCVRC R++++C F ++KR
Sbjct: 41 PTTMEVG-RGGKNKRNTFACVGCHSLKQKCVPSDFNDIYRKPCVRCFRQRKKCKFDLSKR 99

>TBLA0E04750 Chr5 (1222163..1226014) [3852 bp, 1283 aa] {ON}
           Anc_4.344 YML076C
          Length = 1283

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 32/52 (61%)

Query: 15  QGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKR 66
           +G   +R+  ACV+C S K+KC    LD+ ++ PC RC +  + C F ++KR
Sbjct: 111 EGGSSKRNTFACVSCHSSKVKCIPSQLDDIYRKPCQRCLKNGKVCTFDLSKR 162

>KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co- inducer
          Length = 775

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 36/67 (53%), Gaps = 7/67 (10%)

Query: 2   SLSKRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
           +L+ +P S  S  +  K + S   C  C+ R++KCD G      KP C +C R  REC++
Sbjct: 125 TLASQPASSNSNGKTVKRKYSRNGCTECKRRRMKCDEG------KPTCWQCARLNRECVY 178

Query: 62  PV-TKRR 67
            + TK R
Sbjct: 179 IIRTKNR 185

>TPHA0B00410 Chr2 complement(84722..87559) [2838 bp, 945 aa] {ON}
          Anc_4.344 YML076C
          Length = 945

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 18 KWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKR 66
          K +R+  AC+ C S K KC    L+N    PC+RC + +R+C F ++KR
Sbjct: 34 KRKRNTVACITCHSSKQKCVPSDLNNIFWKPCIRCLKSKRQCTFDLSKR 82

>Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W
          (REAL)
          Length = 1012

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 28/61 (45%), Gaps = 7/61 (11%)

Query: 7  PLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKR 66
          P   + G Q  K RR  RAC  CR +K+KCD        + PC+ C     EC +    +
Sbjct: 2  PEQAQQGEQSVKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYKKPTK 54

Query: 67 R 67
          R
Sbjct: 55 R 55

>TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3.109
           YOL089C
          Length = 1086

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 37/70 (52%), Gaps = 5/70 (7%)

Query: 10  EESGNQGTKW--RRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRR 67
           +E   Q T +  +R+ RAC +CR RKIKCD  P+D P    C  C +    C+F   KR+
Sbjct: 123 QEKIQQDTYYSKKRATRACESCRKRKIKCD--PVD-PITNKCSNCTKFHMICVFDNRKRK 179

Query: 68  DVTAKINNMK 77
              A  N+ K
Sbjct: 180 ATNANTNSNK 189

>YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc
          cluster protein proposed to function as a
          transcriptional regulator involved in the stress
          response; null mutants have a respiratory deficiency,
          calcofluor white sensitivity and slightly increased
          cycloheximide resistance
          Length = 964

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 28/61 (45%), Gaps = 7/61 (11%)

Query: 7  PLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKR 66
          P   + G Q  K RR  RAC  CR +K+KCD        + PC+ C     EC +    +
Sbjct: 2  PEQAQQGEQSVKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYKKPTK 54

Query: 67 R 67
          R
Sbjct: 55 R 55

>Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W
          (REAL)
          Length = 926

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 28/61 (45%), Gaps = 7/61 (11%)

Query: 7  PLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKR 66
          P   + G Q  K RR  RAC  CR +K+KCD        + PC+ C     EC +    +
Sbjct: 2  PEQAQQGEQSVKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYKKPTK 54

Query: 67 R 67
          R
Sbjct: 55 R 55

>Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W
          (REAL)
          Length = 954

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 28/61 (45%), Gaps = 7/61 (11%)

Query: 7  PLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKR 66
          P   + G Q  K RR  RAC  CR +K+KCD        + PC+ C     EC +    +
Sbjct: 2  PEQPQQGEQSVKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYKKPTK 54

Query: 67 R 67
          R
Sbjct: 55 R 55

>TPHA0B01585 Chr2 complement(352396..354834) [2439 bp, 812 aa]
          {ON}
          Length = 812

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 27/43 (62%)

Query: 25 ACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRR 67
          ACV C   K KC    L + ++ PC +CKR + +C+F +TKR+
Sbjct: 48 ACVRCHRLKQKCLPSDLADIYRKPCSKCKRMRLKCVFDLTKRK 90

>KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 916

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 26/53 (49%), Gaps = 7/53 (13%)

Query: 18 KWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDVT 70
          K RR  RAC  CR +K+KCD        K PC+ C     EC +    RR VT
Sbjct: 6  KRRRVTRACDECRKKKVKCD-------GKQPCIHCTVYNYECTYNQPTRRTVT 51

>Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {ON}
           YDR034C (LYS14) - 1:1 [contig 183] FULL
          Length = 775

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 32/62 (51%), Gaps = 9/62 (14%)

Query: 9   SEESGNQGTKWRRSYR--ACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPV-TK 65
           +  SG  G   +R Y    C  C+ R++KCD G      KP C +C R  REC++ + TK
Sbjct: 130 TSSSGADGKTVKRKYSRNGCTECKRRRMKCDEG------KPTCWQCARLNRECVYVIRTK 183

Query: 66  RR 67
            R
Sbjct: 184 NR 185

>SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 848

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 6/50 (12%)

Query: 10 EESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQREC 59
          E+S  +  +  +++  C  CRSRK+KCDLG      +P C RC+R   EC
Sbjct: 4  EKSDIRKPRRAKTFTGCWTCRSRKVKCDLG------RPSCKRCERSGFEC 47

>CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130w
          Length = 847

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 64/155 (41%), Gaps = 21/155 (13%)

Query: 15  QGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF--PVTK--RRDVT 70
           Q  K R+  RAC +CR +K+KCD          PC+ C     EC +  P+ +   R  +
Sbjct: 9   QEGKRRKVTRACDDCRKKKVKCD-------GNQPCIHCTVYSYECTYNHPLKRLQSRSGS 61

Query: 71  AKINNMKGSELERXXXXXXLPDVDKKSLN------GGGSAGSDLKQNNIRKKPTDSN--W 122
             ++ ++G  L           V   SLN      G GS  S +++N   +K    N   
Sbjct: 62  GSVSTLRG--LSNSNSNSNSSIVSLASLNQSMQGLGTGSGVSKVQKNLSSRKYNTKNAKL 119

Query: 123 QSDISTMQTALEFLANAVGVISKSDTRSLLNLNQN 157
           Q+++   +T  E L      I   D  + L + QN
Sbjct: 120 QAELDVYKTIFEALFPNAPNIKDIDVPTFLQIFQN 154

>Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar to
          Ashbya gossypii AER370W
          Length = 826

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 34/71 (47%), Gaps = 9/71 (12%)

Query: 10 EESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDV 69
          E  G++  K RR  RAC  CR +K+KC     DN H  PC+ C     EC +    RR  
Sbjct: 6  ERQGSRIAKRRRITRACDECRKKKVKC-----DNRH--PCIHCTVYSYECTYNQPARR-- 56

Query: 70 TAKINNMKGSE 80
          T    N +G E
Sbjct: 57 TGGNKNSEGGE 67

>KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 833

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 8/50 (16%)

Query: 12 SGNQGTKWRR--SYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQREC 59
          +G +  + RR  ++  C  CRSRK+KCDLG      KP C RC +   EC
Sbjct: 7  AGGKAKEVRRVKTFTGCWTCRSRKVKCDLG------KPTCQRCDKSGLEC 50

>Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}
          YML099C (ARG81) - zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type [contig
          336] FULL
          Length = 841

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 30/52 (57%), Gaps = 8/52 (15%)

Query: 10 EESGNQGTKWRR--SYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQREC 59
          + S  +G + RR  ++  C  CRSRK+KCDLG      KP C RC++   EC
Sbjct: 5  KSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLG------KPNCQRCEKSGLEC 50

>Smik_15.350 Chr15 (610312..612666) [2355 bp, 784 aa] {ON} YOR172W
          (REAL)
          Length = 784

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 7/54 (12%)

Query: 9  SEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQR-ECIF 61
          SE+SG +  K R+  R+C  CR RK++CD        KP C  CK + R +CI+
Sbjct: 14 SEDSGKKTQKRRKPIRSCAFCRKRKLRCD------RQKPICSTCKTKGRSDCIY 61

>TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON}
          Anc_6.60 YLR266C
          Length = 795

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 6/48 (12%)

Query: 14 NQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
          N+  K R+  +ACV CR RK+KCDL       KP C +C      CI+
Sbjct: 2  NKTRKRRKIIKACVFCRKRKLKCDLT------KPKCKQCSSRNLNCIY 43

>SAKL0G17908g Chr7 (1552344..1554773) [2430 bp, 809 aa] {ON} similar
           to uniprot|Q03631 Saccharomyces cerevisiae YML076C WAR1
           zinc finger transcription factor
          Length = 809

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%)

Query: 12  SGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVT 64
           S N G K +R+  AC NC S K KC    ++N +  PC RC +  R C F ++
Sbjct: 50  SKNDGGKPKRNTFACTNCHSLKQKCVPSDINNIYGRPCQRCMKCNRTCKFDLS 102

>CAGL0H06875g Chr8 complement(682518..684626) [2109 bp, 702 aa]
          {ON} some similarities with uniprot|P05085
          Saccharomyces cerevisiae YML099c ARG81
          Length = 702

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 28/45 (62%), Gaps = 6/45 (13%)

Query: 15 QGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQREC 59
          + T+  ++Y  C  CR+RK+KCDL       +P C+RC+R + +C
Sbjct: 4  KSTRSVKTYSGCWTCRARKVKCDLV------RPSCLRCRRSKVQC 42

>KLLA0E02663g Chr5 (244696..248025) [3330 bp, 1109 aa] {ON}
          conserved hypothetical protein
          Length = 1109

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 36/69 (52%), Gaps = 3/69 (4%)

Query: 1  MSLSKRPLSEESGNQGTKWRR-SYRACVNCRSRKIKCDLGPLDNPHKPP--CVRCKREQR 57
          M +S    + +S +  ++ R+ + RAC+ CR RKIKCD     +P   P  C  C R   
Sbjct: 1  MKISNEESARDSRHPDSRKRKVAKRACLACRERKIKCDGEANPDPSGGPGKCTNCVRSTL 60

Query: 58 ECIFPVTKR 66
          EC+F  + R
Sbjct: 61 ECVFVASNR 69

>TBLA0H00680 Chr8 complement(144914..147556) [2643 bp, 880 aa] {ON}
           Anc_8.423 YLR228C
          Length = 880

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 36/67 (53%), Gaps = 7/67 (10%)

Query: 1   MSLSKRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECI 60
           +++  + +S+ S  +     +S   C NC+ R++KCD G      KP C +C   + +C+
Sbjct: 81  ITVDGKKVSKTSKGKRKFHNKSKNGCANCKRRRVKCDEG------KPTCQKCLNMKLQCV 134

Query: 61  F-PVTKR 66
           + PVT R
Sbjct: 135 YLPVTAR 141

>YML076C Chr13 complement(112513..115347) [2835 bp, 944 aa] {ON}
           WAR1Homodimeric Zn2Cys6 zinc finger transcription
           factor; binds to a weak acid response element to induce
           transcription of PDR12 and FUN34, encoding an acid
           transporter and a putative ammonia transporter,
           respectively
          Length = 944

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 7   PLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKR 66
           P   E+  +G   R S+ ACV C S K KC+   +++ ++ PC RC + ++ C F ++KR
Sbjct: 58  PTKLETTEKGKTKRNSF-ACVCCHSLKQKCEPSDVNDIYRKPCRRCLKHKKLCKFDLSKR 116

>KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa]
          {ON} Anc_8.423 YLR228C
          Length = 730

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 6/55 (10%)

Query: 21 RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDVTAKINN 75
          +S   C NC+ R++KCD G      KP C +C   + EC+F   + R   +K++N
Sbjct: 29 KSKNGCDNCKRRRVKCDEG------KPFCQKCANMRLECVFTPPQPRRKKSKVSN 77

>KLLA0B04620g Chr2 complement(413129..415888) [2760 bp, 919 aa] {ON}
           similar to uniprot|Q03631 Saccharomyces cerevisiae
           YML076C WAR1 zinc finger transcription factor
          Length = 919

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 35/58 (60%), Gaps = 1/58 (1%)

Query: 7   PLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVT 64
           P+S+E+   G K +RS  AC++C S K KC+     + ++ PC+RC +  + C F ++
Sbjct: 46  PMSKETNADG-KVKRSTFACISCHSMKQKCNPTDPTDIYRHPCIRCAKLNKICQFDLS 102

>SAKL0H13024g Chr8 complement(1119585..1121849) [2265 bp, 754 aa]
          {ON} similar to gnl|GLV|KLLA0A04169g Kluyveromyces
          lactis KLLA0A04169g and some similarites with YDR213W
          uniprot|Q12151 Saccharomyces cerevisiae YDR213W UPC2
          involved in sterol uptake zinc finger transcription
          factor of the Zn(2)-Cys(6) binuclear cluster domain
          type
          Length = 754

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 7/48 (14%)

Query: 21 RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF-PVTKRR 67
          +S   C NC+ R++KCD G      KP C +C   + EC++ P+T+R+
Sbjct: 49 KSKNGCDNCKRRRVKCDEG------KPCCQKCINMKLECVYTPITQRK 90

>Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON}
          (126243..128966) [2724 nt, 908 aa]
          Length = 907

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 6/41 (14%)

Query: 14 NQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKR 54
          N+ T  R+S+  C  CRSRK+KCDL      ++P C RC R
Sbjct: 5  NEMTTKRKSFNGCWTCRSRKVKCDL------NRPKCQRCDR 39

>Kpol_1001.3 s1001 complement(9551..12121) [2571 bp, 856 aa] {ON}
           complement(9551..12121) [2571 nt, 857 aa]
          Length = 856

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 29/49 (59%)

Query: 18  KWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKR 66
           K +R+  AC++C + K KC    LD+    PC RC R ++ C F ++KR
Sbjct: 59  KRKRNTFACISCHASKQKCVPSDLDDIFLKPCQRCFRSKKICAFDLSKR 107

>TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON}
           Anc_3.109 YOL089C
          Length = 1178

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 2/70 (2%)

Query: 14  NQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDVTAKI 73
           N  +  +R  RAC +CR RKIKCD     +P+   C  C +   EC F   ++ D  A  
Sbjct: 241 NPRSAKKRVSRACDHCRKRKIKCDEK--RDPNTNKCSNCIKYNSECTFKNWEQNDAIAAA 298

Query: 74  NNMKGSELER 83
           N+++ S +++
Sbjct: 299 NSIQRSTIKQ 308

>SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 801

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 9/54 (16%)

Query: 17  TKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF---PVTKRR 67
           +K + S   C  C+ R++KCD G      KP C +C R  REC++   P  K+R
Sbjct: 155 SKRKYSRNGCTECKKRRMKCDEG------KPSCWQCTRLNRECVYILNPKNKKR 202

>KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa]
          {ON} 
          Length = 847

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 7/51 (13%)

Query: 18 KWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRD 68
          K R SY  CV CR++K+KCD        +P C RC + +R+C++ +    D
Sbjct: 8  KIRPSY-VCVTCRTQKLKCD------KQRPSCGRCLKNKRKCVYEINSSLD 51

>KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3.109
           YOL089C
          Length = 1006

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 48/124 (38%), Gaps = 16/124 (12%)

Query: 10  EESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF----PVTK 65
           +++ N     RR  +AC +CR RKIKC  GP+ NP K  C  C +    C F       K
Sbjct: 87  DDTTNVAIAKRRVSKACDHCRKRKIKC--GPI-NPAKNKCDNCIKYSSACTFTHQPSNQK 143

Query: 66  RRDVTAKINNMKGSEL-----ERXXXXXXLPDVDKKSLNGGGSAGSDLKQNNIRKKPTDS 120
           R+D          S +     E          V K   N  GS        N+R    D+
Sbjct: 144 RQDNGGASQGTAASHINVAQPESLVSIAEAQKVGKPRKNAAGSPS----MQNLRNSQYDN 199

Query: 121 NWQS 124
           N +S
Sbjct: 200 NLKS 203

>NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879
          Length = 839

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 6/39 (15%)

Query: 21 RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQREC 59
          +++  C  CRSRK+KCDL       +P CVRC +   EC
Sbjct: 16 KTFTGCWTCRSRKVKCDL------RRPGCVRCDKSGLEC 48

>NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}
          Anc_7.17 YAL051W
          Length = 944

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 30/56 (53%), Gaps = 10/56 (17%)

Query: 14 NQGTKWRRSYR---ACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKR 66
          +Q TK +R YR    C  CR  K+KCD        KP C RC +   EC++ VTK+
Sbjct: 26 SQVTKKKR-YRLSFVCQGCRRSKVKCD------QEKPVCSRCSKHDLECVYDVTKQ 74

>AFR171W Chr6 (752589..754427) [1839 bp, 612 aa] {ON} NOHBY629; No
           homolog in Saccharomyces cerevisiae
          Length = 612

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 45/107 (42%), Gaps = 16/107 (14%)

Query: 11  ESGNQGTKWRRSYR--ACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRD 68
           E+G +G   R  Y    C  C+ RK+KCD        KP C +C    + C++ V   + 
Sbjct: 5   EAGRKGVARRSKYSKNGCSECKRRKVKCD------ETKPACWQCSHLGKRCVYMVNNSKI 58

Query: 69  VTAKINNMKGSELERXXXXXXLPDVDKKSLNGGGSAGSDLKQNNIRK 115
              +IN +     ER          DKK+    G+  SD  +  +R+
Sbjct: 59  RFKEINVLSLRGRERV--------TDKKACARNGTGSSDPARVTMRE 97

>AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YIL130W
          Length = 801

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 7/51 (13%)

Query: 11 ESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
          ES   G K RR  RAC  CR +K+KCD        + PC+ C     EC +
Sbjct: 3  ESAGLGLKRRRVTRACDECRKKKVKCD-------SRHPCIHCTVYSYECTY 46

>TDEL0D00820 Chr4 (151394..153451) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 5/53 (9%)

Query: 20 RRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDVTAK 72
          ++  R CV+C+ +K+KC           PC RC +    C FP T+++  TAK
Sbjct: 7  KKRTRPCVSCKRQKLKCQYK-----ESLPCERCIKHGMACYFPTTQKQSATAK 54

>KAFR0I00280 Chr9 complement(57061..59871) [2811 bp, 936 aa] {ON}
          Anc_4.344 YML076C
          Length = 936

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 5  KRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVT 64
          + P   E+   G   R ++ ACV C S K KC     ++ ++ PC RC R++  C F ++
Sbjct: 34 REPTKLETKKDGKTKRHAF-ACVRCHSLKQKCVPSDSNDIYRKPCQRCLRQKIVCKFDLS 92

Query: 65 KR 66
          KR
Sbjct: 93 KR 94

>KNAG0A04480 Chr1 complement(626229..629270) [3042 bp, 1013 aa] {ON}
           Anc_8.423 YLR228C
          Length = 1013

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 35/66 (53%), Gaps = 12/66 (18%)

Query: 21  RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF-----PVTKRRDVTAKINN 75
           +S   C+NC+ R++KCD G      KP C +C      C++     P+ K+  V+A  N+
Sbjct: 92  KSKTGCINCKKRRVKCDEG------KPACKKCTNMSLSCVYISASTPIVKQDYVSAS-NS 144

Query: 76  MKGSEL 81
            +G+ L
Sbjct: 145 REGTPL 150

>KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]
          {ON} some similarities with uniprot|P52960
          Saccharomyces cerevisiae YOR363C PIP2 peroxisome
          induction pathway 2 (PIP2) transcriptional activator of
          peroxisome proliferation may form heterodimer with Oaf1
          to activate oleate-inducible gene expression activator
          of peroxisome proliferation
          Length = 619

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 6/69 (8%)

Query: 14 NQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDVTAKI 73
          N+ TK  R    C  CR RK+KCD        KP C RC +   ECI+   ++++    +
Sbjct: 3  NKQTKRNRRLHVCDACRIRKLKCDKA------KPNCSRCAKHGLECIYNPYRQKEEPETV 56

Query: 74 NNMKGSELE 82
            +K   LE
Sbjct: 57 VALKKELLE 65

>KLTH0D16852g Chr4 (1392572..1395007) [2436 bp, 811 aa] {ON} similar
           to uniprot|Q03631 Saccharomyces cerevisiae YML076C WAR1
           zinc finger transcription factor
          Length = 811

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 6   RPLSEESGNQGT-KWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
           +P + E+   G  K +R+  AC NC S+K KC    + + ++ PCVRC + ++ C F
Sbjct: 91  QPTALEAAPTGAGKPKRNTFACTNCHSQKSKCVPSDVSDIYRKPCVRCHKRRKLCKF 147

>NCAS0A06190 Chr1 (1226184..1228868) [2685 bp, 894 aa] {ON}
           Anc_4.344 YML076C
          Length = 894

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%)

Query: 14  NQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKR 66
           N+  K +R+  ACV C S K KC    +++ +  PC RC R ++ C F ++KR
Sbjct: 50  NEVGKLKRNTFACVRCHSLKQKCVPSDVNDIYLKPCQRCSRNKQVCKFDLSKR 102

>Suva_10.323 Chr10 complement(566314..568755) [2442 bp, 813 aa]
          {ON} YLR228C (REAL)
          Length = 813

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 7/48 (14%)

Query: 21 RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF-PVTKRR 67
          +S   C NC+ R++KCD G      KP C +C   + EC++ P+  RR
Sbjct: 38 KSKTGCDNCKRRRVKCDEG------KPFCKKCTNMKLECVYSPIQPRR 79

>Kwal_23.3122 s23 complement(166388..168754) [2367 bp, 788 aa]
          {ON} YDR213W (UPC2) - zinc finger transcription factor
          of the Zn(2)-Cys(6) binuclear cluster domain type
          [contig 249] FULL
          Length = 788

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 7/49 (14%)

Query: 20 RRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF-PVTKRR 67
          ++S   C NC+ R++KCD        KP C +C   + EC++ PVT R+
Sbjct: 44 KKSKNGCDNCKRRRVKCD------EDKPSCQKCLNMKLECVYTPVTSRK 86

>TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON}
          Anc_8.879 YML099C
          Length = 1132

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 6/46 (13%)

Query: 14 NQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQREC 59
          N  T   R+Y  C  CRSRKIKCD        KP C RC +   +C
Sbjct: 4  NDETARNRTYSGCWTCRSRKIKCD------QQKPQCKRCLKANLKC 43

>TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON}
          Anc_2.231 YIL130W possible pseudogene; NNN added to
          avoid internal stop codon
          Length = 852

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 8/67 (11%)

Query: 18 KWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF-PVTKRRDVTAKINNM 76
          K RR  RAC  CR +K+KCD        + PC+ C     EC +   TKR + +A   + 
Sbjct: 12 KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPTKRSNTSASTQSP 64

Query: 77 KGSELER 83
          + +  +R
Sbjct: 65 QSANQQR 71

>Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}
           similar to Ashbya gossypii AER183C
          Length = 898

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 43/95 (45%), Gaps = 16/95 (16%)

Query: 20  RRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFP--VTKRRDVTAKINNMK 77
           +R  +AC  CR++KIKC+        + PC  C +   EC +   + +RR V  +I+N K
Sbjct: 21  KRVSKACDTCRAKKIKCN-------GEEPCSNCGKHDLECAYTHVIKRRRPVPTRISNRK 73

Query: 78  -----GSELERXXXXXXLPDVDKKSLNGGGSAGSD 107
                 S L+R      L  V  K   G G  G +
Sbjct: 74  LLGDLSSRLQR--LEQLLERVSSKLGAGAGRQGKE 106

>NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON}
          Anc_8.879 YML099C
          Length = 953

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 6/39 (15%)

Query: 21 RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQREC 59
          +++  C  CRSRK+KCDL       +P C RC+R + +C
Sbjct: 7  KTFTGCWTCRSRKVKCDL------RRPNCSRCERSELQC 39

>KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.879
          YML099C
          Length = 861

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 6/39 (15%)

Query: 21 RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQREC 59
          +++  C  CRSRK+KCDL       +P C+RC++   EC
Sbjct: 18 KTFTGCWTCRSRKVKCDL------RRPGCLRCEKSSLEC 50

>KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {ON}
           Anc_2.231 YIL130W
          Length = 848

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 10/89 (11%)

Query: 18  KWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDVTAKINNMK 77
           K RR  RAC  CR +K+KCD        + PC+ C     EC +    +R  ++   +M 
Sbjct: 10  KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPSKRTNSSVTGSMS 62

Query: 78  GSELERXXXXXXLPDVDKKSLNGGGSAGS 106
            + +        L  ++ +S +   SAG+
Sbjct: 63  ATNIS---SQNMLSTLNIQSGSAASSAGT 88

>Smik_4.460 Chr4 (833609..836365) [2757 bp, 918 aa] {ON} YDR213W
          (REAL)
          Length = 918

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 7/54 (12%)

Query: 21 RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF-PVTKRRDVTAKI 73
          +S   C NC+ R++KCD G      KP C +C   + EC++ P+  R+   A +
Sbjct: 46 KSKNGCDNCKRRRVKCDEG------KPACKKCTNMKLECVYTPIHLRKGRGATV 93

>NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa]
          {ON} Anc_2.231 YIL130W
          Length = 930

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 37/85 (43%), Gaps = 14/85 (16%)

Query: 6  RPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTK 65
          R L + +     K RR  RAC  CR +K+KCD        + PC+ C     EC +    
Sbjct: 19 RLLQDPAQQHMAKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPT 71

Query: 66 RRDV-------TAKINNMKGSELER 83
          +R +        +K NN   S L++
Sbjct: 72 KRSLQHLTTYAPSKTNNSSSSPLKQ 96

>NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa]
          {ON} Anc_4.113
          Length = 1043

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 29/57 (50%), Gaps = 9/57 (15%)

Query: 24 RACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDVTAKINNMKGSE 80
          +AC NCR RKIKC         K PC  C+  Q  CI+   KR+  T+K NN    E
Sbjct: 46 KACDNCRKRKIKCT-------GKQPCATCEAYQCPCIYSTQKRK--TSKRNNTAKME 93

>TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {ON}
           Anc_2.231 YIL130W
          Length = 1000

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 30/63 (47%), Gaps = 13/63 (20%)

Query: 12  SGNQGT----KWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF--PVTK 65
           S  QG     K RR  RAC  CR +K+KCD        + PC+ C     EC +  P T+
Sbjct: 48  SNTQGNPIQLKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPSTR 100

Query: 66  RRD 68
           R +
Sbjct: 101 RNN 103

>Kwal_47.16862 s47 complement(147009..149240) [2232 bp, 743 aa]
          {ON} YML076C (WAR1) - ORF [contig 219] FULL
          Length = 743

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 7  PLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
          PL   + + G   R ++ AC NC ++K KC    + + ++ PCVRC++  + C F
Sbjct: 42 PLDSPTTSAGRPKRNTF-ACTNCHAQKSKCVPSDVLDIYRKPCVRCRKRNKLCTF 95

>NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa]
          {ON} Anc_2.231
          Length = 906

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 7/59 (11%)

Query: 3  LSKRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
          +   P   ++ +Q  K RR  RAC  CR +K+KCD        + PC+ C     EC +
Sbjct: 14 IKNEPSPRQTEHQIVKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTY 65

>TBLA0I02540 Chr9 (590352..594131) [3780 bp, 1259 aa] {ON} Anc_8.423
           YLR228C
          Length = 1259

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 6/41 (14%)

Query: 21  RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
           +S   CVNC+ R++KCD G      KP C +C   + +C++
Sbjct: 198 KSKNGCVNCKRRRVKCDEG------KPTCKKCLNMKLDCVY 232

>Smik_13.64 Chr13 complement(110338..113172) [2835 bp, 944 aa] {ON}
           YML076C (REAL)
          Length = 944

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 7   PLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKR 66
           P   E+  +G K +R+  ACV C S K KC+    ++ ++ PC RC + ++ C F ++KR
Sbjct: 57  PTKLETTEKG-KIKRNSFACVCCHSLKQKCEPSDANDIYRKPCRRCLKHRKLCKFDLSKR 115

>KLTH0E03256g Chr5 complement(294997..297021) [2025 bp, 674 aa]
          {ON} weakly similar to uniprot|P39529 Saccharomyces
          cerevisiae YJL206C Hypothetical ORF
          Length = 674

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 8/50 (16%)

Query: 20 RRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRC--KREQRECIFPVTKRR 67
          +RS +AC  C ++K+KC LG      KPPC  C   + Q  CIFPV  R+
Sbjct: 11 KRSKKACQRCSAQKVKC-LG-----EKPPCRACVLSKNQDNCIFPVKPRK 54

>TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879
          YML099C
          Length = 835

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 6/52 (11%)

Query: 8  LSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQREC 59
          ++E S  Q  K  +++  C  CRSRK+KCDL       +P C RC++   +C
Sbjct: 10 ITERSYVQKGKRAKTFTGCWTCRSRKVKCDL------QRPNCGRCEKSGLDC 55

>Skud_13.66 Chr13 complement(111847..114666) [2820 bp, 939 aa] {ON}
           YML076C (REAL)
          Length = 939

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 7   PLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKR 66
           P   E+   G K +R+  ACV C S K KC+    ++ ++ PC RC + ++ C F ++KR
Sbjct: 57  PTKLETTENG-KIKRNSFACVCCHSLKQKCEPSDTNDIYRKPCQRCLKHKKLCKFDLSKR 115

>TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.264
           YDR034C
          Length = 724

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 8/54 (14%)

Query: 8   LSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
           + + +GN   K+ R+   C  C+ R+IKCD        KP C +C R  RECI+
Sbjct: 107 VKDSNGNVKRKYSRN--GCTECKRRRIKCD------ETKPTCWQCARLNRECIY 152

>ZYRO0B14718g Chr2 (1196539..1199646) [3108 bp, 1035 aa] {ON}
           similar to uniprot|Q03631 Saccharomyces cerevisiae
           YML076C WAR1 zinc finger transcription factor
          Length = 1035

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 29/48 (60%)

Query: 14  NQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
           ++G K +R+  AC++C S K KC     ++ ++ PC+RC +  + C F
Sbjct: 96  SEGGKLKRNSFACISCHSLKQKCVPSDFNDIYRKPCIRCLKNGKLCRF 143

>TBLA0B06240 Chr2 complement(1469510..1473817) [4308 bp, 1435 aa]
           {ON} Anc_4.344 YML076C
          Length = 1435

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 7   PLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
           P   E+  +G+ ++RS  ACV C S K KC     ++ ++ PC RC +  R C F
Sbjct: 325 PTKMETTEKGS-FKRSTFACVRCHSLKQKCLPSDFNDIYRKPCKRCLKTNRLCKF 378

>SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON}
          weakly similar to uniprot|P39720 Saccharomyces
          cerevisiae YAL051W OAF1 Oleate-activated transcription
          factor acts alone and as a heterodimer with Pip2p
          activates genes involved in beta-oxidation of fatty
          acids and peroxisome organization and biogenesis
          Length = 922

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 7/62 (11%)

Query: 5  KRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVT 64
          K+P+    G    + R S+  C+ CR RKIKCD        +P C++C  +   C++ + 
Sbjct: 5  KKPMEYSVGKVQKRNRLSF-VCLECRRRKIKCD------KQRPCCIQCAEQGLTCVYDIE 57

Query: 65 KR 66
          ++
Sbjct: 58 RQ 59

>NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa]
          {ON} 
          Length = 980

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 7/56 (12%)

Query: 17 TKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDVTAK 72
           K  RS RAC NCR+RKIKC           PC  C+     C F   KR++++ K
Sbjct: 9  VKKTRSSRACENCRARKIKC-------SGNQPCSNCEIYNCPCAFTPIKRKNLSDK 57

>CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa]
           {ON} similar to uniprot|Q12180 Saccharomyces cerevisiae
           YOL089c HAL9
          Length = 1053

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 6/68 (8%)

Query: 8   LSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF---PVT 64
           +S+  G    + RR+ +AC  CR RK KCD     +P+   C  C +   +CIF   P  
Sbjct: 160 ISQMPGQLHKEKRRAAKACEYCRKRKTKCDEV---SPYTNKCSNCSKAGVDCIFITEPTK 216

Query: 65  KRRDVTAK 72
           K+R  +++
Sbjct: 217 KKRKSSSE 224

>Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C
          (PIP2) - activator of peroxisome proliferation [contig
          46] FULL
          Length = 838

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 7/60 (11%)

Query: 9  SEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRD 68
          SE    + ++ R+S+  C NC+ RKIKCD        +P C RC + + EC++   + +D
Sbjct: 14 SEPPEFKKSRMRQSF-VCRNCKKRKIKCDKA------RPSCGRCSKLELECVYDFQENKD 66

>Ecym_1135 Chr1 complement(276229..278697) [2469 bp, 822 aa] {ON}
          similar to Ashbya gossypii AER153W
          Length = 822

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 34/55 (61%), Gaps = 1/55 (1%)

Query: 7  PLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
          P+S+E G+ G K +R+  AC +C + K +C     ++ ++ PC RC + ++ C+F
Sbjct: 25 PVSQEIGSNG-KPKRNTFACSSCHAVKQRCIPTDANDIYRKPCTRCLKFKKLCVF 78

>CAGL0H04367g Chr8 complement(410256..413093) [2838 bp, 945 aa]
          {ON} weakly similar to uniprot|Q03631 Saccharomyces
          cerevisiae YML076c
          Length = 945

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%)

Query: 9  SEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
          S+   N+    +R+  ACV C   K KC    + + ++ PCVRC R +  CIF
Sbjct: 45 SQLEVNENGNMKRNTFACVKCHDLKQKCRPSDVGDIYRNPCVRCLRSRDPCIF 97

>NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON} Anc_8.423
          Length = 949

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 12/64 (18%)

Query: 21  RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF-PVTKRR-----DVTAKIN 74
           +S   C NC+ R++KCD        KP C +C   Q  C++ P   RR     D T K  
Sbjct: 59  KSKNGCDNCKRRRVKCD------ESKPHCQKCVNMQLHCVYTPPQPRRSKGRNDTTRKTK 112

Query: 75  NMKG 78
           +M G
Sbjct: 113 SMSG 116

>Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W
           (REAL)
          Length = 913

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 36/80 (45%), Gaps = 10/80 (12%)

Query: 21  RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF-PVTKRRDVTA---KINNM 76
           +S   C NC+ R++KCD G      KP C +C   + EC++ P+  R+   A   K    
Sbjct: 46  KSKNGCDNCKRRRVKCDEG------KPACKKCTNMKLECLYTPIHLRKGRGATVVKYVTR 99

Query: 77  KGSELERXXXXXXLPDVDKK 96
           K            LPDV KK
Sbjct: 100 KADGSVEPESSIDLPDVVKK 119

>Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W
          (REAL)
          Length = 918

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 7/54 (12%)

Query: 21 RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF-PVTKRRDVTAKI 73
          +S   C NC+ R++KCD G      KP C +C   + EC++ P+  R+   A +
Sbjct: 46 KSKNGCDNCKRRRVKCDEG------KPACKKCTNMKLECLYTPIHLRKGRGATV 93

>TBLA0C01910 Chr3 complement(448085..448684,448765..451611) [3447
           bp, 1148 aa] {ON} Anc_5.577 YML034W
          Length = 1148

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 6/46 (13%)

Query: 17  TKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFP 62
           TK  +  RAC+ CR  KI CD        KP C  C ++ + CI+P
Sbjct: 299 TKLNKKPRACLTCRKSKIGCDRT------KPDCNNCTKKNKTCIYP 338

>Skud_12.296 Chr12 complement(540407..542851) [2445 bp, 814 aa]
          {ON} YLR228C (REAL)
          Length = 814

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 7/48 (14%)

Query: 21 RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF-PVTKRR 67
          +S   C NC+ R++KCD G      KP C +C   + +C++ P+  RR
Sbjct: 40 KSKTGCDNCKRRRVKCDEG------KPFCKKCTNMKLDCVYSPIQPRR 81

>Smik_12.289 Chr12 complement(540824..543262) [2439 bp, 812 aa]
          {ON} YLR228C (REAL)
          Length = 812

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 7/48 (14%)

Query: 21 RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF-PVTKRR 67
          +S   C NC+ R++KCD G      KP C +C   + +C++ P+  RR
Sbjct: 39 KSKTGCDNCKRRRVKCDEG------KPFCKKCTNMKLDCVYSPIQPRR 80

>NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa]
          {ON} 
          Length = 1108

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 25/46 (54%), Gaps = 7/46 (15%)

Query: 20 RRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTK 65
          ++  +AC+NCR RKIKC  G        PC  C   Q EC+F  TK
Sbjct: 11 KKVVKACLNCRRRKIKCT-GTF------PCSNCAAYQCECVFDETK 49

>Smik_12.157 Chr12 complement(317470..319404) [1935 bp, 644 aa]
          {ON} YLR098C (REAL)
          Length = 644

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 7/57 (12%)

Query: 5  KRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
          KRP++    N     R+   AC +CR R+ KCD+       + PC  C + Q +C+F
Sbjct: 23 KRPMANNEENNDNVPRKRKLACQSCRRRRRKCDM-------EKPCSNCIKFQTDCVF 72

>CAGL0C01199g Chr3 complement(121944..124712) [2769 bp, 922 aa]
          {ON} similar to uniprot|Q12151 Saccharomyces cerevisiae
          YDR213w UPC2
          Length = 922

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 6/59 (10%)

Query: 20 RRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDVTAKINNMKG 78
          ++S   C NC+ R++KCD G      KP C +C      C++       V  K  + KG
Sbjct: 42 KKSKTGCDNCKRRRVKCDEG------KPGCKKCSNLNLVCVYSTVVDNKVAKKTTSRKG 94

>YLR228C Chr12 complement(600019..602463) [2445 bp, 814 aa] {ON}
          ECM22Sterol regulatory element binding protein,
          regulates transcription of sterol biosynthetic genes;
          contains Zn[2]-Cys[6] binuclear cluster; homologous to
          Upc2p; relocates from intracellular membranes to
          perinuclear foci on sterol depletion
          Length = 814

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 7/48 (14%)

Query: 21 RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF-PVTKRR 67
          +S   C NC+ R++KCD G      KP C +C   + +C++ P+  RR
Sbjct: 39 KSKTGCDNCKRRRVKCDEG------KPFCKKCTNMKLDCVYSPIQPRR 80

>NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON} 
          Length = 508

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 22/39 (56%), Gaps = 6/39 (15%)

Query: 21 RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQREC 59
          RSY  C  CR+RK+KCD        +P C RCK+   EC
Sbjct: 15 RSYSGCWTCRARKVKCDT------QRPKCCRCKQLGIEC 47

>AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic
          homolog of Saccharomyces cerevisiae YML099C (ARG81)
          Length = 883

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 10/50 (20%)

Query: 14 NQGTKWRR----SYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQREC 59
            GT  RR    ++  C  CR RK+KCDLG      KP C RC++   +C
Sbjct: 28 GSGTAVRRPRAKTFTGCWTCRLRKVKCDLG------KPSCQRCEKSGLDC 71

>KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 768

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 6/53 (11%)

Query: 9   SEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
           S ++  +  K + S   C+ C+ R++KCD G      KP C +C R  R+C++
Sbjct: 138 STDADGKIVKRKYSRNGCLECKKRRMKCDEG------KPTCWQCARLNRKCVY 184

>KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa]
          {ON} 
          Length = 860

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 7/44 (15%)

Query: 18 KWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
          K R SY  C+ CRSRK+KCD        +P C RCK++ + C +
Sbjct: 8  KQRPSY-VCLECRSRKLKCD------KARPYCNRCKKDGKVCAY 44

>NCAS0A12580 Chr1 complement(2481447..2483561) [2115 bp, 704 aa]
          {ON} 
          Length = 704

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 8/65 (12%)

Query: 18 KWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF---PVTKRRDVTAKIN 74
          K +++ RAC  C  R+IKCD     NP    C  C++ + +C+F   P+ KR      I 
Sbjct: 36 KRKKASRACDQCHHRRIKCDF----NPETRNCSGCEKTEEKCLFNRIPM-KRGPAKGYIR 90

Query: 75 NMKGS 79
          + KGS
Sbjct: 91 SRKGS 95

>NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON} 
          Length = 865

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 15/61 (24%)

Query: 1  MSLSKRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECI 60
          MSL ++ L  +        RRS+  C+ C+++K++CD        +P C RC+R  R+C+
Sbjct: 15 MSLQQKSLRRQ--------RRSH-VCITCKNQKLRCD------RERPSCSRCRRIGRDCV 59

Query: 61 F 61
          +
Sbjct: 60 Y 60

>Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON}
          (12074..14566) [2493 nt, 831 aa]
          Length = 830

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 7/57 (12%)

Query: 4  SKRPLSEESGNQGTKWR-RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQREC 59
          SK   S+   N+ +  R +++  C  CRSRKIKCDL       KP C +C   + EC
Sbjct: 3  SKIERSQAKNNKNSYKRIKTFTGCWTCRSRKIKCDLT------KPSCRKCTNSRIEC 53

>TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3.109
           YOL089C
          Length = 1046

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 31/59 (52%), Gaps = 4/59 (6%)

Query: 4   SKRPLSEESG-NQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
           S +P S ++  +Q    RR  +AC NCR RKIKCD     +P K  C  C +  + C F
Sbjct: 140 SNKPTSNDNFISQHPYKRRVVKACYNCRRRKIKCDAI---DPSKNKCSNCLKLNKICSF 195

>KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly
          similar to uniprot|P39961 Saccharomyces cerevisiae
          YER184C Hypothetical ORF
          Length = 820

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 32/70 (45%), Gaps = 18/70 (25%)

Query: 21 RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKR-----------RDV 69
          R+ RAC+NCR RK+KC         + PC  C+     C + V++            RDV
Sbjct: 13 RAARACLNCRRRKVKCS-------GQSPCANCRNYNCACTYAVSEAQPQQEHCFNHPRDV 65

Query: 70 TAKINNMKGS 79
          T  I  M+ S
Sbjct: 66 TRMIGRMEKS 75

>TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1207

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 7/50 (14%)

Query: 24 RACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDVTAKI 73
          +AC NCR RKIKC         + PC  CK    ECIF V+      +K+
Sbjct: 15 KACDNCRRRKIKC-------SGERPCAGCKTYNCECIFSVSAPTPRASKV 57

>KAFR0E01250 Chr5 complement(249538..251748) [2211 bp, 736 aa] {ON}
           Anc_3.264 YDR034C
          Length = 736

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 32/70 (45%), Gaps = 11/70 (15%)

Query: 3   LSKRPLSEESGNQGTKWRRSY--RACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECI 60
           L  +  S     +G   +R Y    C  C+ R++KCD        KP C +C R  REC+
Sbjct: 130 LDTKVTSTVKDGKGNIVKRKYSRNGCTECKRRRMKCD------ETKPSCWQCARLNRECV 183

Query: 61  F---PVTKRR 67
           +   P  K+R
Sbjct: 184 YVLNPKNKKR 193

>Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W
           (REAL)
          Length = 1045

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 28/63 (44%), Gaps = 6/63 (9%)

Query: 4   SKRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPV 63
           S  P  E S  Q  K  R    C  CR  K KCD        KP C RC +   +C++ V
Sbjct: 44  STSPAPENSEMQNRKRNRISFVCQACRKSKTKCDR------EKPECGRCTKHGLKCVYDV 97

Query: 64  TKR 66
           +K+
Sbjct: 98  SKQ 100

>TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON}
          Anc_8.423 YLR228C
          Length = 973

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 6/43 (13%)

Query: 21 RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPV 63
          +S   C NC+ R++KCD        KP CV+C   + +C++ +
Sbjct: 47 KSKNGCDNCKRRRVKCD------EAKPACVKCSNMKLDCVYSI 83

>KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa]
          {ON} some similarities with uniprot|P32862
          Saccharomyces cerevisiae YKL038W RGT1
          Glucose-responsive transcription factor that regulates
          expression of several glucose transporter (HXT) genes
          in response to glucose binds to promoters and acts both
          as a transcriptional activator and repressor
          Length = 979

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 6/55 (10%)

Query: 9  SEESGNQGTKWRRS--YRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
          S E+G   +  RRS   RAC  CR +K +CD     +  +P C  C+R  + C F
Sbjct: 16 SPEAGGAASDRRRSKTSRACDQCREKKTRCDF----SDERPICSACQRMGKTCTF 66

>ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR034C (LYS14)
          Length = 800

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 6/50 (12%)

Query: 17  TKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKR 66
           TK + S   C  C+ R++KCD G      KP C +C R  REC + +  R
Sbjct: 188 TKRKYSRNGCTECKRRRMKCDEG------KPICWQCSRLNRECKYILNAR 231

>Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {ON}
           complement(31679..33880) [2202 nt, 734 aa]
          Length = 733

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 9/62 (14%)

Query: 10  EESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF---PVTKR 66
           ++S     K + S   C  C+ R++KCD        KP C +C R  REC++   P  K+
Sbjct: 103 KDSKGNVVKRKYSRNGCAECKRRRMKCD------ETKPTCWQCSRLNRECVYVLNPKNKK 156

Query: 67  RD 68
           R+
Sbjct: 157 RN 158

>Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019W
          (REAL)
          Length = 894

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 8/54 (14%)

Query: 7  PLSEESGNQGTKWR-RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQREC 59
          P +  + N+ +K R R  +AC  C+ RK+KCD          PC+ C + Q+EC
Sbjct: 12 PTNTAASNENSKTRLRVQKACELCKKRKVKCD-------GNKPCLNCSKHQKEC 58

>ZYRO0B03278g Chr2 (269277..272996) [3720 bp, 1239 aa] {ON} similar
           to uniprot|P34228 Saccharomyces cerevisiae YBL066C SEF1
           Suppressor of Essential Function putative transcription
           factor
          Length = 1239

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 3/65 (4%)

Query: 13  GNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDVTAK 72
           GNQ +   R   +C +CR  KIKC+    DN    PC+RC+R    C      R    ++
Sbjct: 84  GNQSSTGHRPVTSCTHCRQHKIKCNAS--DN-FPAPCLRCERMGLNCQIDPQFRPKKGSQ 140

Query: 73  INNMK 77
           + N++
Sbjct: 141 LQNLR 145

>AER153W Chr5 (925950..928196) [2247 bp, 748 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YML076C (WAR1)
          Length = 748

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 36/59 (61%), Gaps = 1/59 (1%)

Query: 7  PLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTK 65
          P+S+E G+ G K +R+  AC +C + K +C    + + ++ PC RC + ++ C F ++K
Sbjct: 23 PISQEIGSNG-KPKRNTFACTSCHAVKQRCIPTDMGDIYRKPCSRCVKLRKPCEFDLSK 80

>CAGL0K11902g Chr11 complement(1149210..1151705) [2496 bp, 831 aa]
           {ON} similar to uniprot|P40971 Saccharomyces cerevisiae
           YDR034c LYS14 transcriptional activator of lysine
           pathway genes
          Length = 831

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 11/73 (15%)

Query: 15  QGTKWRRSY--RACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF---PVTKRRDV 69
           +G   +R Y    C  C+ R++KCD        KP C +C R  R+C++   P  K+R  
Sbjct: 191 EGNTVKRKYSRNGCAECKRRRMKCD------ESKPKCWQCTRLNRDCVYILNPKNKKRKT 244

Query: 70  TAKINNMKGSELE 82
           +   + +K    E
Sbjct: 245 SKGSDRVKEERCE 257

>ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 736

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 36/75 (48%), Gaps = 17/75 (22%)

Query: 15  QGTKWRRSY--RACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVT----KRRD 68
           +G   +R Y    C  C+ R++KCD        KP C +C R  REC++ +     KR+ 
Sbjct: 107 EGKVVKRKYSRNGCTECKRRRMKCD------ETKPTCWQCARLNRECVYILNAKNKKRKP 160

Query: 69  VTAKI-----NNMKG 78
             A+I     NN KG
Sbjct: 161 REARIKSTDRNNKKG 175

>YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON}
          PDR1Zinc cluster protein that is a master regulator
          involved in recruiting other zinc cluster proteins to
          pleiotropic drug response elements (PDREs) to fine tune
          the regulation of multidrug resistance genes
          Length = 1068

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 29/59 (49%), Gaps = 10/59 (16%)

Query: 24 RACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDVTAKINNMKGSELE 82
          +AC NCR RKIKC+        K PC  C+    EC F     R   A+I N+  + LE
Sbjct: 44 KACDNCRKRKIKCN-------GKFPCASCEIYSCECTFST---RQGGARIKNLHKTSLE 92

>NCAS0A06710 Chr1 (1324253..1326562) [2310 bp, 769 aa] {ON}
          Anc_5.322 YDR303C
          Length = 769

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 5/52 (9%)

Query: 11 ESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFP 62
          +  N  T+  +   AC+ CR RKI CD G   +P    C++ KR Q  CI+P
Sbjct: 2  DPNNIPTRKPKKNPACIQCRKRKIGCDRG---HPKCGNCIKLKRAQ--CIYP 48

>TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa]
          {ON} Anc_7.17 YOR363C
          Length = 892

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 6/47 (12%)

Query: 15 QGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
          +G K  R  + C+ CR RK+KCD         P C+RC +    C +
Sbjct: 4  RGVKKPRPSKVCLTCRRRKVKCD------QQHPSCMRCIKSSTLCTY 44

>NDAI0D03180 Chr4 (759984..762953) [2970 bp, 989 aa] {ON} Anc_4.344
           YML076C
          Length = 989

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 7   PLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKR 66
           P   E+   G K +R+  ACV C S K KC     ++ ++ PC RC R  + C F ++KR
Sbjct: 68  PSKMETTENG-KIKRNTFACVRCHSLKQKCVPSDTNDIYRRPCERCLRTGKLCKFDLSKR 126

>Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013C
          (PDR1) - zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type [contig 207]
          FULL
          Length = 924

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 29/54 (53%), Gaps = 9/54 (16%)

Query: 12 SGNQGTKWRRS--YRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPV 63
          SGN+  K +RS   RAC NCR RKIKC           PC+ C+  + EC + +
Sbjct: 3  SGNRVVKKKRSKVSRACNNCRRRKIKCT-------GAQPCLNCQTYRCECTYSI 49

>Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON}
           YDR034C (REAL)
          Length = 784

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 12/71 (16%)

Query: 15  QGTKWRRSY--RACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF---PVTKRRDV 69
           +G   +R Y    C  C+ R++KCD        KP C +C R  REC++   P  K+R  
Sbjct: 140 KGNTVKRKYSRNGCSECKRRRMKCD------ETKPTCWQCARLNRECVYVLNPKNKKRR- 192

Query: 70  TAKINNMKGSE 80
           T+  N +K S+
Sbjct: 193 TSNANKIKESK 203

>Skud_14.399 Chr14 (715444..717267) [1824 bp, 607 aa] {ON} YNR063W
          (REAL)
          Length = 607

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 10/69 (14%)

Query: 13 GNQGTKWRRSYR-ACVNCRSRKIKCDLGPLDNPHKPPCVRCKR--EQRECIFPVTKRRDV 69
          G  G   +++   AC  CR+RK+KCD          PC RC +    ++CI+ V KR+D 
Sbjct: 2  GRSGRAGKKTVSLACTVCRTRKLKCD-------GNKPCERCIKLDTPKQCIYNVDKRKDK 54

Query: 70 TAKINNMKG 78
              N  +G
Sbjct: 55 RTIQNGSRG 63

>KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON}
          Anc_8.879 YML099C
          Length = 882

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 6/39 (15%)

Query: 21 RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQREC 59
          +++  C  CR+RK+KCDL       +P C RC+R   +C
Sbjct: 17 KTFTGCWTCRARKVKCDL------TRPSCTRCERSGLKC 49

>NDAI0I02190 Chr9 (501867..504074) [2208 bp, 735 aa] {ON} Anc_6.61
          YOR172W
          Length = 735

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 38/73 (52%), Gaps = 12/73 (16%)

Query: 14 NQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCK-REQRECI-----FPVTKRR 67
          N+  K R+  ++C+ CR RK+KCD        KP C +CK R+  +C+     FPV   +
Sbjct: 11 NEPKKRRKQIKSCMFCRKRKLKCDKA------KPMCGQCKERKLPDCLYTDFNFPVNSMK 64

Query: 68 DVTAKINNMKGSE 80
          D+     N++  E
Sbjct: 65 DLFDNTPNLELME 77

>KNAG0D05240 Chr4 (953893..956502) [2610 bp, 869 aa] {ON} Anc_7.512
           YLR451W
          Length = 869

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 42/92 (45%), Gaps = 22/92 (23%)

Query: 9   SEESG---NQGTK-WRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVT 64
           S E G   ++GTK +RR   ACV CR +K +CD          PC +CK++   C+    
Sbjct: 27  SSEDGMCSDEGTKVYRRKKFACVECRQQKSRCDAS---EKAPGPCTKCKQKGVTCVLKKD 83

Query: 65  KRR---------------DVTAKINNMKGSEL 81
            RR               ++TA ++N+   E+
Sbjct: 84  FRRTYKRARNEAIEKRFKELTASLSNLSSEEI 115

>TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.61
          YOR172W
          Length = 799

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 9/65 (13%)

Query: 3  LSKRPLSEESGNQGTKWRRS--YRACVNCRSRKIKCDLGPLDNPHKPPCVRC-KREQREC 59
          +   P      NQG K +R+   ++C  CR RK+KCD       +KP C  C  R+++EC
Sbjct: 2  IGASPSPSNGTNQGVKKKRNKLIKSCTFCRMRKLKCD------KNKPMCSTCVVRQRKEC 55

Query: 60 IFPVT 64
           +  T
Sbjct: 56 SYTYT 60

>KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON}
          conserved hypothetical protein
          Length = 955

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 29/63 (46%), Gaps = 6/63 (9%)

Query: 18 KWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDVTAKINNMK 77
          K +R   +CV C  RKIKCD        KP C  C +   EC++ +  R     K N   
Sbjct: 38 KRQRQILSCVACHKRKIKCDRA------KPVCESCGKNGWECLYFLNARVSRGGKHNIST 91

Query: 78 GSE 80
          G+E
Sbjct: 92 GTE 94

>Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON}
          (38439..41270) [2832 nt, 944 aa]
          Length = 943

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 6/45 (13%)

Query: 17 TKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
           K  R  R CV C+ RK++CD        +P C RCKR    C +
Sbjct: 6  VKKPRPSRVCVQCKKRKLRCD------RQRPTCTRCKRSSTICTY 44

>TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.109
           YOL089C
          Length = 996

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 30/63 (47%), Gaps = 7/63 (11%)

Query: 20  RRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF----PVTKRRDVTAKINN 75
           +R  RAC +CR RKIKCD  P+ NP    C  C +    C F     V KR+     I+ 
Sbjct: 112 KRVARACDHCRRRKIKCD--PV-NPQTNKCSNCTKYDANCTFRVRDDVEKRKRANEAIDG 168

Query: 76  MKG 78
             G
Sbjct: 169 SGG 171

>KLLA0F00572g Chr6 complement(42710..44503) [1794 bp, 597 aa] {ON}
           conserved hypothetical protein
          Length = 597

 Score = 41.2 bits (95), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 59/144 (40%), Gaps = 16/144 (11%)

Query: 20  RRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFP---VTKRRDVTAKINNM 76
           +RS   C+ CR RK KCD        KP C  CKR   ECI+P    TK   V  KI+ +
Sbjct: 5   KRSSTGCLICRRRKKKCD------EVKPTCTACKRNFLECIWPNSSNTKDGKVGKKISQV 58

Query: 77  KGSELERXXXXXXLPDVDKKSLNGGGSAGSDLKQNNIRKKPTDSNWQSDISTMQTALEFL 136
           +  + +       L    K       +  SDL+     K+ +D  +  D   +Q   +F 
Sbjct: 59  ESEDTKFNITHLKLKHRIKY------TRTSDLRMEVYVKRRSDELYLYDGKKLQKITKF- 111

Query: 137 ANAVGVISKSDTRSLLNLNQNNTL 160
              +  + K  T   +  ++ N L
Sbjct: 112 PRELPPLPKDSTSRYIKYHEKNLL 135

>NCAS0B02860 Chr2 complement(488982..491591) [2610 bp, 869 aa]
          {ON} Anc_8.423
          Length = 869

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 8/55 (14%)

Query: 21 RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVT--KRRDVTAKI 73
          +S + C +C+ R++KCD        KP C RC      C++PV   K+R V+  +
Sbjct: 50 KSKQGCTHCKRRRVKCD------ELKPACRRCLNWNVPCVYPVVQPKKRKVSTVV 98

>TPHA0C02180 Chr3 complement(493972..496632) [2661 bp, 886 aa] {ON}
           Anc_8.423 YLR228C
          Length = 886

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 12/66 (18%)

Query: 20  RRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF-PVTKRRDVT-----AKI 73
           ++S   C +C+ R++KCD        KP C  C+  + +C + P+  R+  T     +KI
Sbjct: 48  KKSKSGCDHCKRRRVKCDEA------KPFCANCQHMKLDCFYSPIKPRKKKTVSKKISKI 101

Query: 74  NNMKGS 79
           NN++ S
Sbjct: 102 NNVQDS 107

>Suva_8.225 Chr8 (404288..406693) [2406 bp, 801 aa] {ON} YOR172W
          (REAL)
          Length = 801

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 7/54 (12%)

Query: 9  SEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRC-KREQRECIF 61
          SE++  +G K R+  ++C  CR RK++CD        KP C+ C  R + +C +
Sbjct: 14 SEDTAKKGRKRRKPIKSCAFCRKRKLRCD------QQKPMCLTCVSRGRPDCFY 61

>CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some
          similarities with uniprot|Q12180 Saccharomyces
          cerevisiae YOL089c HAL9 or uniprot|P38114 Saccharomyces
          cerevisiae YBR150c TBS1
          Length = 1049

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 20 RRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
          RRS +AC +CR RKI+CD     NP    C  C + + EC F
Sbjct: 35 RRSTKACDHCRKRKIRCDEV---NPVTNKCSNCVKFKVECTF 73

>KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]
          {ON} some similarities with uniprot|Q12180
          Saccharomyces cerevisiae YOL089C HAL9 Putative
          transcription factor containing a zinc finger;
          overexpression increases salt tolerance through
          increased expression of the ENA1(Na+/Li+ extrusion
          pump) gene while gene disruption decreases both salt
          tolerance and ENA1 expression
          Length = 902

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 9/60 (15%)

Query: 20 RRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQREC--IFPVTKRRDVTAKINNMK 77
          +R  +AC  CR++KIKCD          PC  CK+  +EC   + V KR+    +++N K
Sbjct: 8  KRVSKACDACRAKKIKCD-------GCDPCSNCKKVSQECGYTYVVKKRQKPPTRVSNRK 60

>TDEL0F05470 Chr6 (1017743..1020175) [2433 bp, 810 aa] {ON}
          Anc_8.423 YLR228C
          Length = 810

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 9/53 (16%)

Query: 21 RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF-PVT--KRRDVT 70
          +S   C NC+ R++KCD G      KP C +C   + +C++ PV   K++D T
Sbjct: 45 KSKNGCDNCKRRRVKCDEG------KPACQKCLNMKLDCVYTPVQPKKKKDST 91

>NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]
          {ON} Anc_7.17
          Length = 1022

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 26/60 (43%), Gaps = 6/60 (10%)

Query: 7  PLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKR 66
          P +  S  Q  K  R    C  CR  K KCD        KP C RC ++   C++ V K+
Sbjct: 27 PAAGGSNRQIKKRNRISFVCQECRKAKTKCD------KEKPACTRCVKQNLACVYDVAKQ 80

>ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 850

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 8/46 (17%)

Query: 16 GTKWRR--SYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQREC 59
          GTK +R  ++  C  CRSRK+KCDL       +P C RC++    C
Sbjct: 28 GTKSKRGKTFTGCWTCRSRKVKCDL------RRPHCQRCEKSGLVC 67

>Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON}
          (29727..32705) [2979 nt, 993 aa]
          Length = 992

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 7/53 (13%)

Query: 15 QGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRR 67
          Q  K RR  RAC  CR +K+KCD        + PC+ C      C +    +R
Sbjct: 25 QQPKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYNCTYNQPSKR 70

>NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa]
          {ON} 
          Length = 909

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 7/46 (15%)

Query: 18 KWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPV 63
          K R S+  C+ CRS+K+KCD        +P C RC++  + C++ +
Sbjct: 8  KARPSF-VCLVCRSKKVKCDKA------RPSCGRCRKTNKLCVYEI 46

>KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene
          extends into a gap in the genome sequence
          Length = 729

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 7/59 (11%)

Query: 4  SKRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCK-REQRECIF 61
           KR  ++ +     K R+  R C  CR RK++CD G      +P C  CK R   ECI+
Sbjct: 3  GKRSATDPATQDTRKKRKHIRTCTFCRQRKVRCDQG------RPLCSSCKARGFSECIY 55

>Suva_13.76 Chr13 complement(113974..116811) [2838 bp, 946 aa] {ON}
           YML076C (REAL)
          Length = 946

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 7   PLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKR 66
           P   E+   G K +R+  ACV C S K KC     ++ ++ PC RC + ++ C F + KR
Sbjct: 57  PTKLETTENG-KIKRNSFACVCCHSLKQKCVPSDANDIYRKPCQRCLKHKKVCKFDLAKR 115

>TBLA0C03390 Chr3 complement(814708..818028) [3321 bp, 1106 aa]
          {ON} Anc_5.322 YHR056C
          Length = 1106

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 14/62 (22%)

Query: 15 QGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKR--EQRECIFPVTKRRDVTAK 72
          +G + RR   ACV CR RKI CD        +P C  C +   + ECI+P     DV  +
Sbjct: 6  RGRRMRRP-PACVQCRRRKIGCDRA------RPVCGNCAKNTSRGECIYP-----DVPGQ 53

Query: 73 IN 74
          I+
Sbjct: 54 ID 55

>NCAS0F02700 Chr6 complement(547682..550189) [2508 bp, 835 aa]
          {ON} Anc_5.322 YDR303C
          Length = 835

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 29/58 (50%), Gaps = 8/58 (13%)

Query: 15 QGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQR-ECIFPVTKRRDVTA 71
          +G K R+   ACV CR RKI CD        KP C  C++  + +C FP    R V A
Sbjct: 4  RGRKMRKP-PACVQCRKRKIGCDRV------KPICGNCRKTNKGDCFFPDIPGRYVPA 54

>YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol
          regulatory element binding protein, induces
          transcription of sterol biosynthetic genes and of
          DAN/TIR gene products; Ecm22p homolog; relocates from
          intracellular membranes to perinuclear foci on sterol
          depletion
          Length = 913

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 7/54 (12%)

Query: 21 RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF-PVTKRRDVTAKI 73
          +S   C NC+ R++KCD G      KP C +C   + EC + P+  R+   A +
Sbjct: 46 KSKNGCDNCKRRRVKCDEG------KPACRKCTNMKLECQYTPIHLRKGRGATV 93

>Skud_15.334 Chr15 (602966..605338) [2373 bp, 790 aa] {ON} YOR172W
          (REAL)
          Length = 790

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 7/53 (13%)

Query: 10 EESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCK-REQRECIF 61
          E++G    K R+  ++C  CR RK++CD        KP C  CK R + +C++
Sbjct: 15 EDAGKNVRKRRKPIKSCAFCRKRKLRCD------QQKPVCSTCKARRRTDCLY 61

>CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa]
          {ON} similar to uniprot|Q12151 Saccharomyces cerevisiae
          YDR213w UPC2
          Length = 844

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 9/53 (16%)

Query: 21 RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF-PVT--KRRDVT 70
          +S   C +C+ R++KCD G      KP C +C + + EC++ PV   KRR  T
Sbjct: 49 KSKNGCDHCKRRRVKCDEG------KPMCDKCVKMKLECVYTPVQPPKRRTRT 95

>Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W
          (GIN1) - 1:1 [contig 5] FULL
          Length = 812

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 7/50 (14%)

Query: 18 KWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRR 67
          K RR  RAC  CR +K+KCD        + PC+ C     EC +    +R
Sbjct: 7  KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPSKR 49

>ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON}
          similar to uniprot|P12383 Saccharomyces cerevisiae
          YGL013C PDR1 Zinc cluster protein that is a master
          regulator involved in recruiting other zinc cluster
          proteins to pleiotropic drug response elements (PDREs)
          to fine tune the regulation of multidrug resistance
          genes
          Length = 1036

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 25/51 (49%), Gaps = 7/51 (13%)

Query: 11 ESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
          ESG       +  RAC NCR RKIKC         K PC  C+  Q EC++
Sbjct: 2  ESGRVRRPRNKVNRACYNCRRRKIKC-------TGKYPCSSCEAYQCECLY 45

>Smik_18.8 Chr18 (12069..14396) [2328 bp, 775 aa] {ON} YOR172W
           (REAL)
          Length = 775

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 47/97 (48%), Gaps = 19/97 (19%)

Query: 20  RRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQ-RECIFPVTKRRDVT--AKINNM 76
           R+S R+C  CR RK++CD        +P C  C R++  EC + +   +DV    K+  +
Sbjct: 6   RKSIRSCELCRKRKLRCD------GKRPRCSTCVRKKSSECTYAIGFEQDVEFREKLKAL 59

Query: 77  KGSELERXXXXXXLPDVD--KKSLNGGGSAGSDLKQN 111
           K ++L        L DV   +K L  GG    +L ++
Sbjct: 60  KEAKL--------LEDVKLLEKRLESGGGVVCELSRD 88

>KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly
          similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 782

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 7/50 (14%)

Query: 18 KWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRR 67
          K RR  RAC  CR +K+KCD        + PC+ C     EC +    +R
Sbjct: 7  KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPSKR 49

>ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YAL051W
          (OAF1) and YOR363C (PIP2); Tandem gene triplication in
          this genome
          Length = 970

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 8/67 (11%)

Query: 3  LSKRPLSEESGNQG--TKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECI 60
          +S   LSEES ++   +K  R    C  CR  K KCD        KP C RC +   +C+
Sbjct: 7  MSSGQLSEESPDRKYVSKRNRISFVCQACRKSKTKCD------REKPRCSRCAKNNVKCV 60

Query: 61 FPVTKRR 67
          + + K+R
Sbjct: 61 YDIEKQR 67

>Kwal_56.22605 s56 (200072..202669) [2598 bp, 865 aa] {ON} YOL089C
          (HAL9) - 1:1 [contig 184] FULL
          Length = 865

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 33/64 (51%), Gaps = 6/64 (9%)

Query: 1  MSLSKRPLSEESGNQ--GTKWR-RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQR 57
          M     P++ ES  +  G K+R R  +AC +CR RKIKC  GP+ NP    C  C +   
Sbjct: 1  METKAVPMASESPTELSGGKFRKRVPKACDHCRKRKIKC--GPV-NPITGTCENCNKFNT 57

Query: 58 ECIF 61
           C F
Sbjct: 58 SCTF 61

>YDR034C Chr4 complement(509737..512109) [2373 bp, 790 aa] {ON}
           LYS14Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway; requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 790

 Score = 40.8 bits (94), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 10/63 (15%)

Query: 8   LSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF---PVT 64
           ++++ GN   K + S   C  C+ R++KCD        KP C +C R  R+C++   P  
Sbjct: 142 VTDKKGNT-VKRKYSRNGCSECKRRRMKCD------ETKPTCWQCARLNRQCVYVLNPKN 194

Query: 65  KRR 67
           K+R
Sbjct: 195 KKR 197

>NDAI0C04170 Chr3 complement(953071..955548) [2478 bp, 825 aa]
          {ON} Anc_5.322 YDR303C
          Length = 825

 Score = 40.8 bits (94), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 28/58 (48%), Gaps = 8/58 (13%)

Query: 15 QGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQR-ECIFPVTKRRDVTA 71
          +G K R+   ACV CR RKI CD        KP C  C +  + +C FP    R V A
Sbjct: 4  RGRKMRKP-PACVQCRKRKIGCDRV------KPICGNCSKTNKGDCFFPDVPGRYVPA 54

>KAFR0E01300 Chr5 (259207..261690) [2484 bp, 827 aa] {ON}
          Anc_5.322 YHR056C
          Length = 827

 Score = 40.8 bits (94), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 29/58 (50%), Gaps = 8/58 (13%)

Query: 15 QGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQR-ECIFPVTKRRDVTA 71
          +G K R+   ACV CR RKI CD        KP C  C++  R +C +P    R V +
Sbjct: 4  RGRKMRKP-PACVQCRKRKIGCDRV------KPMCGNCRKSNRGDCFYPDVPGRYVPS 54

>TPHA0M01040 Chr13 complement(202491..204803) [2313 bp, 770 aa] {ON}
           Anc_3.264 YDR034C
          Length = 770

 Score = 40.8 bits (94), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 11/59 (18%)

Query: 15  QGTKWRRSY--RACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF---PVTKRRD 68
            G   +R Y    C  C+ R++KCD        KP C +C R  R C++   P  K+R+
Sbjct: 127 HGNPIKRKYSRNGCTECKRRRMKCD------ETKPTCWQCSRLNRHCVYVFNPKNKKRN 179

>NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.654
          YKL015W
          Length = 1041

 Score = 40.8 bits (94), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 7/51 (13%)

Query: 21 RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDVTA 71
          R   AC+ CR R +KC       P+  PC+RC + + +C +    R+ V +
Sbjct: 35 RKSNACIQCRRRHVKC-------PNGNPCLRCVKSKLQCEYSEPSRKIVVS 78

>YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}
           OAF1Oleate-activated transcription factor, acts alone
           and as a heterodimer with Pip2p; activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1047

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 27/63 (42%), Gaps = 6/63 (9%)

Query: 4   SKRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPV 63
           S  P  E S     K  R    C  CR  K KCD        KP C RC +   +C++ V
Sbjct: 44  STSPAPENSETHNRKRNRILFVCQACRKSKTKCDR------EKPECGRCVKHGLKCVYDV 97

Query: 64  TKR 66
           +K+
Sbjct: 98  SKQ 100

>SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 823

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 7/45 (15%)

Query: 17 TKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
          +K RR  RAC  CR +K+KCD        + PC+ C     EC +
Sbjct: 6  SKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTY 43

>KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.17
           YOR363C
          Length = 951

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 6/57 (10%)

Query: 11  ESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRR 67
           ++G    K  R    C  CR  K KCD        KP C RC+++  EC++ +  +R
Sbjct: 50  KAGKVVKKRNRISFVCQACRKAKTKCD------KEKPMCSRCRKQDLECVYDIELQR 100

>KAFR0B06340 Chr2 (1311310..1313904) [2595 bp, 864 aa] {ON}
          Anc_8.423 YLR228C
          Length = 864

 Score = 40.4 bits (93), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 15/61 (24%), Positives = 32/61 (52%), Gaps = 6/61 (9%)

Query: 1  MSLSKRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECI 60
          + +  + +S+ S  +     +S   C+NC+ R++KCD        KP C++C   + +C+
Sbjct: 30 LEIDGKKVSKTSTGKRKFHNKSKTGCLNCKRRRVKCD------ETKPFCIKCTNMKLDCV 83

Query: 61 F 61
          +
Sbjct: 84 Y 84

>Ecym_5131 Chr5 (278980..281292) [2313 bp, 770 aa] {ON} similar to
           Ashbya gossypii ABL099W
          Length = 770

 Score = 40.4 bits (93), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 7/58 (12%)

Query: 4   SKRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
           S R  ++ S   G K + S   C  C+ R++KCD G      KP C +C R  R C++
Sbjct: 129 SSRSRADASVKSG-KRKYSRNGCTECKRRRMKCDEG------KPVCWQCSRLNRSCVY 179

>Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W
           (REAL)
          Length = 1046

 Score = 40.4 bits (93), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 27/63 (42%), Gaps = 6/63 (9%)

Query: 4   SKRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPV 63
           S  P  E S     K  R    C  CR  K KCD        KP C RC +   +C++ V
Sbjct: 44  STSPAPENSETHNRKRNRISFVCQACRKSKTKCD------REKPECSRCIKHGLKCVYDV 97

Query: 64  TKR 66
           +K+
Sbjct: 98  SKQ 100

>KNAG0H01260 Chr8 (220201..222426) [2226 bp, 741 aa] {ON} Anc_3.264
           YDR034C
          Length = 741

 Score = 40.4 bits (93), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 6/45 (13%)

Query: 17  TKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
            K + S   CV C+ R++KCD        KP C +C R  R+C++
Sbjct: 130 VKRKYSRNGCVECKRRRMKCD------ETKPKCWQCDRLNRDCVY 168

>Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar to
          Ashbya gossypii AAL175W
          Length = 908

 Score = 40.4 bits (93), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 6/39 (15%)

Query: 21 RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQREC 59
          +++  C  CR RK+KCDLG      KP C RC++    C
Sbjct: 41 KTFTGCWTCRIRKVKCDLG------KPNCQRCEKSGLSC 73

>KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON}
          Anc_2.231 YIL130W
          Length = 902

 Score = 40.4 bits (93), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 7/45 (15%)

Query: 17 TKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
           K RR  RAC  CR +K+KCD        + PC+ C     EC +
Sbjct: 28 AKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTY 65

>KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa]
          {ON} Anc_4.113 YGL013C
          Length = 997

 Score = 40.4 bits (93), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 7/42 (16%)

Query: 20 RRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
          R+  RAC NCR RKIKC           PC  C+  Q +C+F
Sbjct: 17 RKVNRACDNCRKRKIKCS-------ETTPCTNCQIYQCKCVF 51

>Ecym_4144 Chr4 complement(306206..308728) [2523 bp, 840 aa] {ON}
           similar to Ashbya gossypii AGL091W
          Length = 840

 Score = 40.4 bits (93), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 18/71 (25%)

Query: 20  RRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF-PVTKRRD---------- 68
           ++S   C NC+ R++KCD       +KP C +C + +  CI+ P   RR           
Sbjct: 51  KKSKNGCDNCKRRRVKCD------ENKPCCQKCFKMKLHCIYTPAKPRRKKNKDVETVIK 104

Query: 69  -VTAKINNMKG 78
            +T  INN  G
Sbjct: 105 YITTTINNENG 115

>YOR172W Chr15 (654210..656570) [2361 bp, 786 aa] {ON}
          YRM1Zn2-Cys6 zinc-finger transcription factor that
          activates genes involved in multidrug resistance;
          paralog of Yrr1p, acting on an overlapping set of
          target genes
          Length = 786

 Score = 40.4 bits (93), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 7/54 (12%)

Query: 9  SEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRE-CIF 61
          SEE+  +  K R+  ++C  CR RK++CD        KP C  CK   R  C++
Sbjct: 14 SEETVKKAQKRRKPIKSCAFCRKRKLRCD------QQKPMCSTCKTRGRSGCLY 61

>Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON}
           YDR034C (REAL)
          Length = 778

 Score = 40.4 bits (93), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 10/63 (15%)

Query: 8   LSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF---PVT 64
           ++++ GN   K + S   C  C+ R++KCD        KP C +C R  R CI+   P  
Sbjct: 130 VTDKKGNT-VKRKYSRNGCSECKRRRMKCD------ETKPTCWQCARLNRHCIYVLNPKN 182

Query: 65  KRR 67
           K+R
Sbjct: 183 KKR 185

>AGL091W Chr7 (535317..537917) [2601 bp, 866 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR228C (ECM22) and
           YDR213W (UPC2)
          Length = 866

 Score = 40.4 bits (93), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 6/47 (12%)

Query: 21  RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRR 67
           +S   C NC+ R++KCD G      KP C +C + +  C++   K R
Sbjct: 84  KSKNGCDNCKRRRVKCDEG------KPGCQKCLKMRLSCVYTPAKPR 124

>KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa]
          {ON} weakly similar to uniprot|Q6B2M3 Saccharomyces
          cerevisiae YOR172W YRM1 Zn2-Cys6 zinc-finger
          transcription factor that activates genes involved in
          multidrug resistance paralog of Yrr1p acting on an
          overlapping set of target genes
          Length = 771

 Score = 40.4 bits (93), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 32/64 (50%), Gaps = 9/64 (14%)

Query: 1  MSLSKRPLSEESGNQGTKWRRS--YRACVNCRSRKIKCDLGPLDNPHKPPCVRC-KREQR 57
          M L+  P S  S    T+ RR    ++C  CR RK+KCD        KP C  C +R+  
Sbjct: 41 MPLNTPPDSGASSKPSTRRRRRKVIKSCTFCRQRKMKCD------QQKPMCGSCVERKLS 94

Query: 58 ECIF 61
          ECI+
Sbjct: 95 ECIY 98

>TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON}
          Anc_8.879 YML099C
          Length = 852

 Score = 40.4 bits (93), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 6/54 (11%)

Query: 6  RPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQREC 59
          + +S  S +   K  +++  C  CR RKIKCDL       KP C +C+     C
Sbjct: 3  KRISTSSRDADNKRAKTFEGCWTCRLRKIKCDL------KKPKCDKCRSSAISC 50

>Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 aa]
           {ON} YMR019W (REAL)
          Length = 911

 Score = 40.4 bits (93), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 34/77 (44%), Gaps = 13/77 (16%)

Query: 12  SGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPV------TK 65
           S   G    R  +AC  C+ RK+KCD          PC+ C + ++EC +         K
Sbjct: 32  SKENGRGRLRVQKACEICKRRKVKCD-------GNRPCLNCSKHKKECRYDFKATNRRKK 84

Query: 66  RRDVTAKINNMKGSELE 82
           RR  T+ I N+    +E
Sbjct: 85  RRQATSLIQNVDKEYIE 101

>Skud_4.287 Chr4 complement(501344..503698) [2355 bp, 784 aa] {ON}
           YDR034C (REAL)
          Length = 784

 Score = 40.0 bits (92), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 10/63 (15%)

Query: 8   LSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF---PVT 64
           ++++ GN   K + S   C  C+ R++KCD        KP C +C R  R+C++   P  
Sbjct: 136 VTDKKGNT-VKRKYSRNGCSECKRRRMKCD------ETKPTCWQCARLNRQCVYVLNPKN 188

Query: 65  KRR 67
           K+R
Sbjct: 189 KKR 191

>TBLA0I01890 Chr9 complement(423851..426328) [2478 bp, 825 aa] {ON}
           Anc_3.264 YDR034C
          Length = 825

 Score = 40.0 bits (92), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 11/59 (18%)

Query: 15  QGTKWRRSY--RACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF---PVTKRRD 68
           +G   +R Y    C  C+ R++KCD        KP C +C R  R CI+   P  K+R+
Sbjct: 150 KGKVIKRKYSRNGCTECKKRRMKCD------ETKPICWQCSRLNRSCIYILNPKNKKRN 202

>Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W
           (REAL)
          Length = 1040

 Score = 40.0 bits (92), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 27/63 (42%), Gaps = 6/63 (9%)

Query: 4   SKRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPV 63
           S  P  E S     K  R    C  CR  K KCD        KP C RC +   +C++ V
Sbjct: 44  STSPAPENSETHNRKRNRISFVCQACRKSKTKCDR------EKPECGRCIKHGLKCVYDV 97

Query: 64  TKR 66
           +K+
Sbjct: 98  SKQ 100

>TDEL0E00300 Chr5 (64461..66374) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score = 40.0 bits (92), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 52/128 (40%), Gaps = 21/128 (16%)

Query: 21  RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDVTAKINNMKGSE 80
           RS   C++CR R+ KCD        +P C  C R   ECI+P    R    ++N      
Sbjct: 18  RSNTGCLSCRRRRKKCD------ERRPSCKACARNFLECIWP---HRSGKQRLN----IS 64

Query: 81  LERXXXXXXLPDVDKKSLNGGGSAGSDLKQNNIRKKPTDSNWQSDISTMQTALEFLANAV 140
           L +       P   ++ L G       LK  N  K  T S+W  D+  +         A 
Sbjct: 65  LSKNKKQKQDPLFQQRKL-GYRFNLFLLKDANFLKLKTPSSWVFDVLIVDP-------AT 116

Query: 141 GVISKSDT 148
           G+IS+ D+
Sbjct: 117 GIISRKDS 124

>Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}
          YKL222C (REAL)
          Length = 688

 Score = 40.0 bits (92), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 27/47 (57%), Gaps = 6/47 (12%)

Query: 15 QGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
          +  +  ++ +AC+NCR +K KCD        +P C +C+  + EC++
Sbjct: 5  KAVRRNKAIKACLNCRRKKQKCDQA------RPQCYQCRIRKTECVY 45

>NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa]
          {ON} 
          Length = 1113

 Score = 40.0 bits (92), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 7/42 (16%)

Query: 20 RRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
          ++  +AC NCR RKIKC           PC  C   Q ECIF
Sbjct: 31 KKVSKACANCRRRKIKC-------TGTYPCSNCAAYQCECIF 65

>NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2.547
          Length = 1141

 Score = 40.0 bits (92), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 4/44 (9%)

Query: 18  KWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
           K  ++ RAC  CR +KIKCD     +  K  C  C+R   +C F
Sbjct: 67  KRTKASRACDQCRKKKIKCDF----SEEKTLCSNCQRNGEKCTF 106

>CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa]
          {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
          YAL051w OAF1 peroxisome proliferating transcription
          factor or uniprot|P52960 Saccharomyces cerevisiae
          YOR363c PIP2
          Length = 994

 Score = 40.0 bits (92), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 31/67 (46%), Gaps = 7/67 (10%)

Query: 1  MSLSKRPLSEESGNQGTKWR-RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQREC 59
          MS+     S E     T+ R R    C  CR  K +CD        KP C RCK+ + EC
Sbjct: 1  MSVVGSGSSPEGNAARTRKRNRISFVCQACRRSKTRCD------KEKPICTRCKKLKLEC 54

Query: 60 IFPVTKR 66
          ++ + K+
Sbjct: 55 VYDMAKQ 61

>Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa]
          {ON} YGL013C (REAL)
          Length = 1069

 Score = 40.0 bits (92), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 29/59 (49%), Gaps = 10/59 (16%)

Query: 24 RACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDVTAKINNMKGSELE 82
          +AC NCR RKIKC+        K PC  C+    EC F     R    +I N++ + LE
Sbjct: 41 KACDNCRKRKIKCN-------GKFPCASCEIYSCECTFTT---RQGGNRIKNLQKANLE 89

>KLLA0F18084g Chr6 complement(1652031..1654613) [2583 bp, 860 aa]
          {ON} conserved hypothetical protein
          Length = 860

 Score = 39.7 bits (91), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 8/61 (13%)

Query: 25 ACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDV--TAKINNMKGSELE 82
          +C NCR  + KCD G      KP C RC + + +C++ +  +  +  +  I N   SE +
Sbjct: 4  SCQNCRKTRRKCDRG------KPTCARCIKYKIDCVYELPPKHKIKQSVDIGNDMISETQ 57

Query: 83 R 83
          R
Sbjct: 58 R 58

>ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly
           similar to uniprot|P50104 Saccharomyces cerevisiae
           YMR019W STB4 Protein that binds Sin3p in a two- hybrid
           assay
          Length = 912

 Score = 40.0 bits (92), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 36/87 (41%), Gaps = 11/87 (12%)

Query: 21  RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF-PVTKRRDVTAKINNMKGS 79
           R  +AC  C+ RK+KCD          PC  C +  +EC +   T RR     I N  G+
Sbjct: 12  RVRKACEICKRRKVKCD-------GSQPCANCVKHGQECKYISGTVRRRYRRDIGNSSGA 64

Query: 80  EL---ERXXXXXXLPDVDKKSLNGGGS 103
            +    R             S+NGGGS
Sbjct: 65  SILIPSRLTPSSSTALNFNGSVNGGGS 91

>NCAS0A10550 Chr1 (2100725..2102950) [2226 bp, 741 aa] {ON}
           Anc_3.264
          Length = 741

 Score = 39.7 bits (91), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 6/47 (12%)

Query: 17  TKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPV 63
            K + S   C  C+ R++KCD        KP C +C R  REC++ V
Sbjct: 123 VKRKYSRNGCAECKRRRMKCD------ETKPICWQCARLSRECVYIV 163

>ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]
          {ON} similar to uniprot|P43634 Saccharomyces cerevisiae
          YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6]
          fungal- type binuclear cluster domain; DNA-binding
          transcriptional activator or CHA1 and to YOR337W
          uniprot|P47988 Saccharomyces cerevisiae YOR337W TEA1
          Mutants are defective in Ty1 Enhancer-mediated
          Activation Ty1 enhancer activator
          Length = 523

 Score = 39.7 bits (91), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 25 ACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDVTA 71
          AC NCR ++ KCDL       + PC RC R + ECI  V   R   A
Sbjct: 7  ACQNCRQKRKKCDL-------ELPCSRCTRLKVECIPTVQDMRKEKA 46

>TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1086

 Score = 39.7 bits (91), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 31/61 (50%), Gaps = 13/61 (21%)

Query: 1  MSLSKRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECI 60
          M+LS +P+ ++  ++ +      RAC NCR RKIKC           PC  C   Q ECI
Sbjct: 1  MALSHQPMVKKPRSKVS------RACENCRRRKIKCT-------GNQPCNNCVTYQCECI 47

Query: 61 F 61
          F
Sbjct: 48 F 48

>Kpol_1023.41 s1023 (88566..91013) [2448 bp, 815 aa] {ON}
          (88566..91013) [2448 nt, 816 aa]
          Length = 815

 Score = 39.7 bits (91), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 7/39 (17%)

Query: 25 ACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQR-ECIFP 62
          ACV CR RKI CD G      KP C  C +  + +C +P
Sbjct: 14 ACVQCRRRKIGCDRG------KPICGNCAKSHKTDCFYP 46

>TDEL0D00730 Chr4 complement(129036..131456) [2421 bp, 806 aa] {ON}
           Anc_4.344 YML076C
          Length = 806

 Score = 39.7 bits (91), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%)

Query: 14  NQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVT 64
           N G + +R+  ACV+C S K KC      + ++ PC RC R  + C F ++
Sbjct: 64  NDGGQIKRNSFACVSCHSLKQKCVPSDPHDIYRKPCERCLRNFKLCKFDLS 114

>KNAG0A02290 Chr1 (211626..214028) [2403 bp, 800 aa] {ON} 
          Length = 800

 Score = 39.7 bits (91), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 8/70 (11%)

Query: 5  KRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCK-REQRECIFPV 63
          K P S+ + ++ T+ R+  ++C  CR RK+KCD        +P C  C+ R    C++ +
Sbjct: 2  KGPQSDSAVHKQTR-RKPVKSCAFCRQRKLKCD------HQRPLCSSCRARGLSSCVYAL 54

Query: 64 TKRRDVTAKI 73
           K  D    +
Sbjct: 55 NKFEDCAGPV 64

>NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON}
          Anc_8.423
          Length = 775

 Score = 39.7 bits (91), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 6/47 (12%)

Query: 21 RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRR 67
          +S   C NC+ R++KCD        KP C +C     EC++ + K R
Sbjct: 53 KSKNGCDNCKRRRVKCD------ELKPTCQKCINMNLECVYSMPKPR 93

>Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa]
          {ON} YGL013C (REAL)
          Length = 1080

 Score = 39.7 bits (91), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 10/59 (16%)

Query: 24 RACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDVTAKINNMKGSELE 82
          +AC NCR RKIKC+        K PC  C+    EC F     R    +I N++   LE
Sbjct: 41 KACDNCRKRKIKCN-------GKFPCASCEIYSCECTF---TSRQGGHRIKNLQKGSLE 89

>TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON}
          Anc_2.654 YKL015W
          Length = 1037

 Score = 39.7 bits (91), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 21/47 (44%), Gaps = 7/47 (14%)

Query: 15 QGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
          Q  K R+  RAC+ CR R IKC       P   PC +C      C F
Sbjct: 48 QLGKKRKITRACIRCRERHIKC-------PGNDPCQKCLEANHICKF 87

>NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON}
           Anc_2.547
          Length = 1210

 Score = 39.7 bits (91), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 4/44 (9%)

Query: 18  KWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
           K  ++ RAC  CR +KIKCD     N     C  C+R   +C F
Sbjct: 83  KRTKASRACDQCRKKKIKCDFTEAKN----ICSNCQRNAEKCTF 122

>TDEL0G04890 Chr7 (903504..903581,903640..905316) [1755 bp, 584
          aa] {ON} 
          Length = 584

 Score = 39.3 bits (90), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 6/53 (11%)

Query: 20 RRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDVTAK 72
          R S+  C  C+ RKIKCD G      KP C  C R ++ C +   K  + + +
Sbjct: 11 RYSHNGCKECKRRKIKCDEG------KPVCWHCDRLEKSCQYLQVKEAEYSVR 57

>KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]
          {ON} Anc_2.547 YKL038W
          Length = 1286

 Score = 39.7 bits (91), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 4/47 (8%)

Query: 15 QGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
           G K  ++ RAC  CR +KIKCD   + N     C  C+R    C F
Sbjct: 44 HGKKRTKASRACDQCRRKKIKCDYNDMRN----ICTNCQRIGERCSF 86

>NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON}
          Anc_7.512 YLR451W
          Length = 809

 Score = 39.7 bits (91), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 25/49 (51%), Gaps = 6/49 (12%)

Query: 20 RRSYRACVNCRSRKIKCDLGPLDNPHKP-PCVRCKREQRECIFPVTKRR 67
          RR Y ACV CR +K KCD     N   P PC +C R+   CI     RR
Sbjct: 14 RRKY-ACVECRQQKSKCDA----NDKAPNPCSKCARKGVPCILKKDFRR 57

>SAKL0G17622g Chr7 complement(1525163..1527193) [2031 bp, 676 aa]
          {ON} conserved hypothetical protein
          Length = 676

 Score = 39.3 bits (90), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 26/49 (53%), Gaps = 5/49 (10%)

Query: 20 RRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRD 68
          RR  + C+NC+  K++C           PCVRC++    C +P  ++++
Sbjct: 7  RRRTKPCMNCKRNKVRCQY-----IETLPCVRCQKHNLRCFYPENEQQN 50

>Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON}
           (71447..74704) [3258 nt, 1086 aa]
          Length = 1085

 Score = 39.7 bits (91), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 21/42 (50%), Gaps = 2/42 (4%)

Query: 20  RRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
           RR  RAC  CR RKIKCD   + N     C  C +   EC F
Sbjct: 117 RRVARACDRCRKRKIKCD--EIKNLKVNKCSNCVKYGAECTF 156

>KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON}
          similar to uniprot|P53749 Saccharomyces cerevisiae
          YNR063W Hypothetical ORF
          Length = 591

 Score = 39.3 bits (90), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 7/44 (15%)

Query: 25 ACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRD 68
          AC+ C+ RK KCD        + PC RC +   +CI+   +R+D
Sbjct: 2  ACLECKKRKQKCD-------GQKPCRRCTKLNVKCIYGTDRRKD 38

>KLTH0D01804g Chr4 complement(173650..175608) [1959 bp, 652 aa] {ON}
           similar to uniprot|P47988 Saccharomyces cerevisiae
           YOR337W TEA1 Mutants are defective in Ty1 Enhancer-
           mediated Activation Ty1 enhancer activator and to
           YLR098C uniprot|P43634 Saccharomyces cerevisiae YLR098C
           CHA4 Zinc- finger protein with Zn[2]-Cys[6] fungal-type
           binuclear cluster domain; DNA-binding transcriptional
           activator or CHA1
          Length = 652

 Score = 39.3 bits (90), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 34/82 (41%), Gaps = 7/82 (8%)

Query: 25  ACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDVTAKINNMKGSELERX 84
           AC NCR R+ KCD+G        PC  C + + +C   +   R        +K  E    
Sbjct: 33  ACSNCRRRRKKCDMG-------YPCASCVKMKLDCNVNMDDMRKKRYAAGYVKSLEAHVA 85

Query: 85  XXXXXLPDVDKKSLNGGGSAGS 106
                L ++D   ++G  S G+
Sbjct: 86  YLETRLKNLDAAKISGTSSLGT 107

>KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa]
          {ON} weakly similar to uniprot|P07272 Saccharomyces
          cerevisiae YLR014C PPR1 Zinc finger transcription
          factor containing a Zn(2)-Cys(6) binuclear cluster
          domain positively regulates transcription of genes
          involved in uracil biosynthesis activity may be
          modulated by interaction with Tup1p
          Length = 775

 Score = 39.3 bits (90), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 31/66 (46%), Gaps = 12/66 (18%)

Query: 3  LSKRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF- 61
          ++ +   E SGN      RS  AC  CR RKIKCD         P C +C + Q  CI  
Sbjct: 1  MANKVTKESSGN----IYRSVAACKRCRIRKIKCD------NKFPSCTKCIQAQEPCITI 50

Query: 62 -PVTKR 66
           P T+R
Sbjct: 51 DPSTRR 56

>NDAI0A05750 Chr1 complement(1302180..1304459) [2280 bp, 759 aa]
           {ON} Anc_3.264
          Length = 759

 Score = 39.3 bits (90), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 8/52 (15%)

Query: 12  SGNQGTKWRRSY--RACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
           S  +G   +R Y    C  C+ R++KCD        KP C +C R  REC++
Sbjct: 115 SDKKGHIAKRKYSRNGCTECKRRRMKCD------ETKPICWQCARLNRECVY 160

>TPHA0E01290 Chr5 (258004..260562) [2559 bp, 852 aa] {ON}
          Anc_5.322 YHR056C
          Length = 852

 Score = 39.3 bits (90), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 25/49 (51%), Gaps = 8/49 (16%)

Query: 15 QGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQR-ECIFP 62
          +G K R+   ACV CR RKI CD        KP C  C +  + +C FP
Sbjct: 4  RGRKMRKP-PACVQCRRRKIGCD------RVKPVCGNCNKSGKYDCFFP 45

>NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa]
          {ON} 
          Length = 1107

 Score = 39.3 bits (90), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 29/60 (48%), Gaps = 11/60 (18%)

Query: 12 SGNQGTKWRRSY----RACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRR 67
          S +Q TK ++      +AC NCR RKIKC         K PC  C+  Q  CI+   K R
Sbjct: 26 SPSQDTKIKKPAAKVSKACDNCRKRKIKCT-------GKMPCPTCEAYQCPCIYSAPKPR 78

>ZYRO0C18282g Chr3 (1431515..1433665) [2151 bp, 716 aa] {ON}
           conserved hypothetical protein
          Length = 716

 Score = 39.3 bits (90), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 54/127 (42%), Gaps = 20/127 (15%)

Query: 1   MSLSKRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKP-PCVRCKREQREC 59
           M++ KR   + SG      ++  R+CV CR  K KCD        +P PC  C R+  EC
Sbjct: 1   MAVYKRGDRKCSGGPQDCDKKVLRSCVRCRKNKTKCD----SMETRPDPCTSCVRKGVEC 56

Query: 60  ----IFPVTKRRDVTAKINNMKGSELERXXXXXXLPDVDKKSLNGGGSAGSDLKQNNIRK 115
               + P  + +++ +   N++ +  +R      + D   K  N GG          +RK
Sbjct: 57  ELDYVTPPQRSKEMKSLYENIRFAS-DRVNSLCMVYDDFSKKFNVGG----------LRK 105

Query: 116 KPTDSNW 122
              D +W
Sbjct: 106 PGKDVDW 112

>Kpol_1008.13 s1008 (21147..23855) [2709 bp, 902 aa] {ON}
          (21147..23855) [2709 nt, 903 aa]
          Length = 902

 Score = 39.3 bits (90), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 24/49 (48%), Gaps = 5/49 (10%)

Query: 20 RRSYRACVNCRSRKIKCDLGPLDNPHKP-PCVRCKREQRECIFPVTKRR 67
          RR   ACV CR +K KCD         P PC +C ++  +CI     RR
Sbjct: 52 RRKKFACVECRQQKSKCDAV----ERAPDPCTKCSKKGLQCILKKDYRR 96

>KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON}
          Anc_2.547 YKL038W
          Length = 1088

 Score = 39.3 bits (90), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 4/41 (9%)

Query: 21 RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
          ++ RAC  CR +K+KCD G      +  C  C+R   +C F
Sbjct: 58 KASRACDQCRKKKVKCDNG----DDRSVCTNCQRNGEKCTF 94

>ZYRO0G12584g Chr7 complement(996642..998702) [2061 bp, 686 aa]
          {ON} conserved hypothetical protein
          Length = 686

 Score = 39.3 bits (90), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 6/43 (13%)

Query: 20 RRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFP 62
          +RS   C+ CR+RK KCD        KP C  C+R   +CI+P
Sbjct: 28 KRSKSGCLTCRNRKKKCD------ETKPLCKGCRRNFLQCIWP 64

>KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {ON}
           similar to uniprot|P39529 Saccharomyces cerevisiae
           YJL206C and some similarities with YIL130W
           uniprot|P40467 Saccharomyces cerevisiae YIL130W ASG1
           Proposed transcriptional activator member of the Gal4p
           family of zinc cluster proteins
          Length = 650

 Score = 39.3 bits (90), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 50/114 (43%), Gaps = 16/114 (14%)

Query: 9   SEESGNQGTKWRRSYR-ACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF-----P 62
           +E S NQ    R   + AC +C+ RK++CD        + PC  C   + +C +     P
Sbjct: 18  TEPSTNQLEPVRHKVKHACSSCKERKVRCD-------GQSPCASCINARVKCEYVMNMKP 70

Query: 63  VTKRRDVTAKINNMKGSELE---RXXXXXXLPDVDKKSLNGGGSAGSDLKQNNI 113
           + K+R V+   +N+  +EL+             VD K +        DL Q+N+
Sbjct: 71  LKKKRKVSFIRSNLSKNELKGGSSVISSQNAQGVDYKKVFHSLFPDVDLSQSNL 124

>KLLA0A04169g Chr1 complement(376273..378600) [2328 bp, 775 aa]
          {ON} similar to uniprot|Q05958 Saccharomyces cerevisiae
          YLR228C ECM22 Sterol regulatory element binding protein
          regulates transcription of the sterol biosynthetic
          genes ERG2 and ERG3 member of the fungus-specific
          Zn[2]-Cys[6] binuclear cluster family of transcription
          factors homologous to Upc2p
          Length = 775

 Score = 39.3 bits (90), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 7/48 (14%)

Query: 20 RRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF-PVTKR 66
          ++S   C +C+ R++KCD        +P C+ CK+   +C++ PV  R
Sbjct: 51 KKSKNGCDHCKRRRVKCD------ETRPHCLNCKKMSLDCVYTPVQPR 92

>Smik_12.549 Chr12 (964956..967616) [2661 bp, 886 aa] {ON} YLR451W
          (REAL)
          Length = 886

 Score = 39.3 bits (90), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 5/60 (8%)

Query: 9  SEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKP-PCVRCKREQRECIFPVTKRR 67
          SE     G   R+   ACV CR +K KCD     +   P PC +C ++   CI     RR
Sbjct: 20 SETRNRAGINARKRKFACVECRQQKSKCDA----HERAPEPCTKCAKKNVPCILKRDFRR 75

>Kpol_1005.2 s1005 complement(1473..3992) [2520 bp, 839 aa] {ON}
          complement(1473..3992) [2520 nt, 840 aa]
          Length = 839

 Score = 39.3 bits (90), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 25/50 (50%), Gaps = 7/50 (14%)

Query: 25 ACVNCRSRKIKCDLGPLDNPHKPPCVRC-KREQRECIFPVTKRRDVTAKI 73
          ACV CR RKI CD        KP C  C K  + +C FP    + VT+ I
Sbjct: 13 ACVQCRRRKIGCD------RIKPICGNCMKSGKGDCFFPDIPGQYVTSNI 56

>KLTH0D00594g Chr4 (57414..59309) [1896 bp, 631 aa] {ON} conserved
          hypothetical protein
          Length = 631

 Score = 38.9 bits (89), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 12/68 (17%)

Query: 18 KWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFP------VTKRRDVTA 71
          K +RS   C+ CR+R+ KCD       +KP C  C+R   +C +P      V ++R   A
Sbjct: 6  KRKRSVHGCLTCRTRRKKCD------ENKPVCGGCERNFVQCTWPQHTGGRVRRKRGEAA 59

Query: 72 KINNMKGS 79
          ++ + + S
Sbjct: 60 ELTSDRSS 67

>Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {ON}
           YOL089C (REAL)
          Length = 1029

 Score = 39.3 bits (90), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 8/68 (11%)

Query: 20  RRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFP-----VTKRRDVTAKIN 74
           +R  +AC +CR RKI+CD     +P    C  C + Q  C F      + K+R +  K N
Sbjct: 127 KRVSKACDHCRKRKIRCDEV---DPQTNKCSNCVKFQSACTFKHRDEILRKKRKLETKQN 183

Query: 75  NMKGSELE 82
           + K  + +
Sbjct: 184 SDKSPQAQ 191

>SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]
          {ON} similar to uniprot|P25502 Saccharomyces cerevisiae
          YKL015W PUT3 Positive regulator of PUT (proline
          utilization) genes zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 831

 Score = 39.3 bits (90), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 23/52 (44%), Gaps = 7/52 (13%)

Query: 8  LSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQREC 59
          L +E G    + +RS  ACV CR R +KC       P   PC +C      C
Sbjct: 30 LHDEGGQLRKRQKRSSMACVRCRRRHVKC-------PGGNPCSKCIAANIAC 74

>NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON} 
          Length = 656

 Score = 38.9 bits (89), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 6/47 (12%)

Query: 15 QGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
          +  + +R    C  CR++K++C      N  +P C RC+R  R C++
Sbjct: 4  KSIRGQRPTHVCAACRTQKLRC------NRERPSCSRCQRIGRTCVY 44

>Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON}
           (11943..14819) [2877 nt, 959 aa]
          Length = 958

 Score = 39.3 bits (90), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 25/56 (44%), Gaps = 4/56 (7%)

Query: 6   RPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
           R  S  S       +++ RAC  CR RKIKCD    DN  K  C  C R    C F
Sbjct: 55  RSSSTGSAKGSIGGKKATRACDQCRKRKIKCD---YDN-DKNVCSSCNRNGDRCQF 106

>Skud_13.43 Chr13 complement(73880..76522) [2643 bp, 880 aa] {ON}
          YML099C (REAL)
          Length = 880

 Score = 38.9 bits (89), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 6/52 (11%)

Query: 8  LSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQREC 59
          ++ +SG +     +++  C  CR RK+KCDL        P C RC++    C
Sbjct: 3  IASKSGVRKLGRAKTFTGCWTCRGRKVKCDL------RHPHCQRCEKSNLPC 48

>Kpol_529.15 s529 complement(38664..41510) [2847 bp, 948 aa] {ON}
           complement(38664..41510) [2847 nt, 949 aa]
          Length = 948

 Score = 39.3 bits (90), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 7/49 (14%)

Query: 20  RRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF-PVTKRR 67
           ++S   C NC+ R++KCD        KP C +C   +  C++ PV  R+
Sbjct: 105 KKSKNGCDNCKRRRVKCD------ESKPICQKCINMKLNCVYTPVQPRK 147

>Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106W
          (REAL)
          Length = 867

 Score = 38.9 bits (89), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 26/49 (53%), Gaps = 6/49 (12%)

Query: 13 GNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
           ++  +  R    C+ C+SRK+KCD        +P C RC++  ++C +
Sbjct: 3  SDKSARRPRPSFVCIPCKSRKLKCD------RLRPVCTRCRKTSKQCTY 45

>KAFR0B02820 Chr2 complement(576317..578311) [1995 bp, 664 aa]
          {ON} Anc_8.283 YLR098C
          Length = 664

 Score = 38.9 bits (89), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 11/57 (19%)

Query: 5  KRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
          KRP+S+E   + T  RR   AC+ CR R+ KCD+       + PC  C +    C+F
Sbjct: 2  KRPVSDE--RKPTPSRR--LACITCRQRRRKCDM-------QEPCSICIKFGTRCVF 47

>Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON}
          similar to Ashbya gossypii ACL195C
          Length = 114

 Score = 36.2 bits (82), Expect = 0.063,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 5/57 (8%)

Query: 5  KRPLSEESGNQGTKWR--RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQREC 59
          KRP     G     W+  +  R+CV CR  K+KCD   +  P   PC  C ++   C
Sbjct: 13 KRPGGHSEGYIHDTWKMKKPLRSCVRCRKNKVKCD-SAIRRPK--PCSSCLKKGVSC 66

>NDAI0C04840 Chr3 (1117201..1120047) [2847 bp, 948 aa] {ON}
          Anc_8.423
          Length = 948

 Score = 38.9 bits (89), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 7/48 (14%)

Query: 21 RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF-PVTKRR 67
          +S   C NC+ R++KCD        KP C +C   Q  C++ P+  R+
Sbjct: 58 KSKNGCDNCKKRRVKCD------EVKPSCKKCTNMQLTCVYSPLQPRK 99

>CAGL0E05434g Chr5 (532814..535264) [2451 bp, 816 aa] {ON} similar
           to uniprot|P47988 Saccharomyces cerevisiae YOR337w TEA1
           TY1 enhancer activator
          Length = 816

 Score = 38.9 bits (89), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 26/56 (46%), Gaps = 7/56 (12%)

Query: 4   SKRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQREC 59
           S  P  E S N  ++  +   AC NCR R+ KCDL       + PC  C +   EC
Sbjct: 54  SGNPSRESSANVTSRPTKKRLACSNCRRRRKKCDL-------QYPCFTCDKLGLEC 102

>YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putative
           transcription factor; contains a Zn(II)2Cys6 zinc finger
           domain characteristic of DNA-binding proteins;
           computational analysis suggests a role in regulation of
           expression of genes encoding transporters; binds Sin3p
           in a two-hybrid assay;
          Length = 949

 Score = 38.9 bits (89), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 13/77 (16%)

Query: 12  SGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVT------K 65
           S   G    R  +AC  C+ RK+KCD          PC+ C + Q+EC +         +
Sbjct: 73  SKENGKGRLRVQKACELCKKRKVKCD-------GNNPCLNCSKHQKECRYDFKATNRKRR 125

Query: 66  RRDVTAKINNMKGSELE 82
           RR V + + ++  +  E
Sbjct: 126 RRQVASAVRDVSKTYAE 142

>Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON}
          YKL038W (REAL)
          Length = 1169

 Score = 38.9 bits (89), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 4/50 (8%)

Query: 12 SGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF 61
          SG+   K  ++ RAC  CR +KIKCD        +  C  C+R    C F
Sbjct: 33 SGHAMKKRTKASRACDQCRKKKIKCDY----KDERGVCTNCQRNGDRCSF 78

>KLLA0C16489g Chr3 (1444456..1446642) [2187 bp, 728 aa] {ON}
          conserved hypothetical protein
          Length = 728

 Score = 38.9 bits (89), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 6/53 (11%)

Query: 21 RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDVTAKI 73
          RS   C  CR +++KCD         P C RCKR    CI+P      +T K+
Sbjct: 38 RSKSGCFTCRLKRMKCD------EQHPICGRCKRNLLTCIWPKEGNGKLTKKM 84

>KLTH0C06776g Chr3 complement(586976..590140) [3165 bp, 1054 aa]
           {ON} similar to uniprot|P34228 Saccharomyces cerevisiae
           YBL066C SEF1 Suppressor of Essential Function putative
           transcription factor
          Length = 1054

 Score = 38.9 bits (89), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 33/74 (44%), Gaps = 11/74 (14%)

Query: 9   SEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRD 68
           S+     G+   R   +C +CR  KIKC+    DN    PC RC+R    C        +
Sbjct: 83  SDSKAAAGSTGHRPVTSCTHCRQHKIKCNAS--DN-FPAPCSRCERMGLRC--------E 131

Query: 69  VTAKINNMKGSELE 82
           +  +    KGS+L+
Sbjct: 132 IDPRFRPKKGSQLQ 145

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 52/108 (48%), Gaps = 9/108 (8%)

Query: 182 SDSNTPKSRNSIFSLIHDDTASKVIS----PLMGTIESIRPKPTRNLSDIEYIGPNKLLT 237
           S  N P S+ S   L  D+T SK  S    P++ T  +I P P+   +  E++     ++
Sbjct: 295 SPPNAPSSQGSP-CLTPDNTGSKENSSSKTPIVATTNTIAPLPSPQANIDEFVLGEVTIS 353

Query: 238 EDEARTLINVFFLTMHPYFPYI----PLQLHNPDELVRYPILLCAILT 281
             +A  L  VF     PYFP +      +L++  +L+ + ++L A L+
Sbjct: 354 IAKANELHAVFVDKFLPYFPIMYTNSATELYSQSQLLFWTVMLTACLS 401

>NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa]
          {ON} Anc_2.565
          Length = 803

 Score = 38.9 bits (89), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 31/70 (44%), Gaps = 13/70 (18%)

Query: 10 EESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDV 69
          +E  N+  +  R  RAC  C+ RK+KCD          PC  C +  ++C +        
Sbjct: 9  KEVTNKNRQRLRVQRACAICKKRKVKCD-------GMKPCSNCIKRSKDCTYT------T 55

Query: 70 TAKINNMKGS 79
            KI NMK S
Sbjct: 56 AYKIPNMKYS 65

>SAKL0F15444g Chr6 (1243590..1246484) [2895 bp, 964 aa] {ON}
          similar to uniprot|P08638 Saccharomyces cerevisiae
          YLR451W LEU3 Zinc-finger transcription factor that
          regulates genes involved in branched chain amino acid
          biosynthesis and ammonia assimilation positively
          regulated by alpha-isopropylmalate an intermediate in
          leucine biosynthesis
          Length = 964

 Score = 38.9 bits (89), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 8  LSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPP--CVRCKREQRECIFPVTK 65
          ++E   N   K RR   ACV CR +K KCD        + P  C RC ++   C+     
Sbjct: 19 MTESEMNNRAKGRRKKLACVECRQQKSKCDAY-----ERSPESCTRCAKKNVPCVLQRGF 73

Query: 66 RR 67
          RR
Sbjct: 74 RR 75

>YLR451W Chr12 (1036093..1038753) [2661 bp, 886 aa] {ON}
          LEU3Zinc-knuckle transcription factor, repressor and
          activator; regulates genes involved in branched chain
          amino acid biosynthesis and ammonia assimilation; acts
          as a repressor in leucine-replete conditions and as an
          activator in the presence of alpha-isopropylmalate, an
          intermediate in leucine biosynthesis that accumulates
          during leucine starvation
          Length = 886

 Score = 38.9 bits (89), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 5/60 (8%)

Query: 9  SEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKP-PCVRCKREQRECIFPVTKRR 67
          SE     G   R+   ACV CR +K KCD     +   P PC +C ++   CI     RR
Sbjct: 20 SETRNRTGMNARKRKFACVECRQQKSKCDA----HERAPEPCTKCAKKNVPCILKRDFRR 75

>SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]
          {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
          YAL051W OAF1 Oleate-activated transcription factor acts
          alone and as a heterodimer with Pip2p activates genes
          involved in beta-oxidation of fatty acids and
          peroxisome organization and biogenesis
          Length = 983

 Score = 38.9 bits (89), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 6/57 (10%)

Query: 10 EESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKR 66
          EE  +  +K  R    C  CR  K KCD        KP C RC +   EC++ + ++
Sbjct: 12 EEQNSHSSKRNRISFVCKACRKSKTKCD------REKPSCTRCIKNGIECVYDIEQQ 62

>Kpol_1031.47 s1031 (125242..127926) [2685 bp, 894 aa] {ON}
          (125242..127926) [2685 nt, 895 aa]
          Length = 894

 Score = 38.9 bits (89), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 6/42 (14%)

Query: 21 RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFP 62
          +S   C NC+ R++KCD        KP C +C   + +C +P
Sbjct: 46 KSKNGCENCKRRRVKCD------EAKPACKKCSNMKLDCNYP 81

>Skud_8.113 Chr8 complement(188347..190992) [2646 bp, 881 aa] {ON}
           YHR056C (REAL)
          Length = 881

 Score = 38.9 bits (89), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 45/112 (40%), Gaps = 29/112 (25%)

Query: 25  ACVNCRSRKIKCDLGPLDNPHKPPCVRC-KREQRECIFPVTKRRDVTAKINNMKGSELER 83
           AC  CR RKI CD        KP C  C K  + +C +P     D   K+          
Sbjct: 14  ACTQCRKRKIGCDRA------KPICGNCVKYNKPDCFYP-----DGPGKM---------- 52

Query: 84  XXXXXXLPDVDKKSLNGGGSAGSDLKQ-NNIRKKPTDSNWQSDISTMQTALE 134
                 +P     S +GGG + +   Q N + +K  +   Q+    MQT++E
Sbjct: 53  ----VAIPSASGISSHGGGQSANHFNQGNGVNQK--NVMIQTQYPIMQTSIE 98

>KLTH0F07854g Chr6 complement(677647..680013) [2367 bp, 788 aa]
          {ON} some similarities with uniprot|Q12151
          Saccharomyces cerevisiae YDR213W UPC2 involved in
          sterol uptake zinc finger transcription factor of the
          Zn(2)- Cys(6) binuclear cluster domain type
          Length = 788

 Score = 38.9 bits (89), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 7/45 (15%)

Query: 20 RRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF-PV 63
          ++S   C NC+ R++KCD        KP C +C   + EC++ PV
Sbjct: 44 KKSKNGCDNCKRRRVKCD------EDKPSCQKCINMKLECVYTPV 82

>ZYRO0A09350g Chr1 (749695..752076) [2382 bp, 793 aa] {ON} similar
          to gnl|GLV|KLLA0A04169g Kluyveromyces lactis
          KLLA0A04169g and some similarites with YDR213W
          uniprot|Q12151 Saccharomyces cerevisiae YDR213W UPC2
          involved in sterol uptake zinc finger transcription
          factor of the Zn(2)-Cys(6) binuclear cluster domain
          type
          Length = 793

 Score = 38.9 bits (89), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 9/53 (16%)

Query: 21 RSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVT---KRRDVT 70
          +S   C NC+ R++KCD G      KP C +C   + +C++      KRR+ T
Sbjct: 42 KSKNGCDNCKRRRVKCDEG------KPLCRKCVNMKLDCVYTPAQPKKRREST 88

>NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa]
          {ON} Anc_4.113
          Length = 1118

 Score = 38.9 bits (89), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 7/44 (15%)

Query: 24 RACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRR 67
          +AC NCR RKIKC         K PC  C+  Q  CI+   + R
Sbjct: 61 KACDNCRRRKIKCT-------GKTPCATCEAYQCLCIYSTQRGR 97

>TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {ON}
           Anc_2.231 YIL130W
          Length = 890

 Score = 38.9 bits (89), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 9/50 (18%)

Query: 18  KWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIF--PVTK 65
           K RR  RAC  CR +K+KCD        + PC+ C     +C +  PV K
Sbjct: 64  KRRRVTRACDECRKKKVKCD-------GQNPCIHCTVYSYKCSYDQPVKK 106

>Skud_12.346 Chr12 complement(616734..618818) [2085 bp, 694 aa]
          {ON} YLR266C (REAL)
          Length = 694

 Score = 38.9 bits (89), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 9/58 (15%)

Query: 7  PLSEESGNQGTKWRRS--YRACVNCRSRKIKCDLGPLDNPHKPPCVRCK-REQRECIF 61
          P + ES   GTK +R    ++C  CR RK+KC      N  +P C +C  R+  +CI+
Sbjct: 3  PTTRESVTGGTKGKRRKIIKSCAFCRKRKLKC------NQVRPMCQQCVLRKLPQCIY 54

>KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}
          
          Length = 881

 Score = 38.9 bits (89), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 6/47 (12%)

Query: 13 GNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQREC 59
            +  K +R+   C+ C+S+K++C      N  +P C RC+R  + C
Sbjct: 22 AGKSQKSKRTVSVCIPCKSQKLRC------NKARPICSRCQRLGKHC 62

>YML099C Chr13 complement(74398..77040) [2643 bp, 880 aa] {ON}
          ARG81Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type, involved in
          the regulation of arginine-responsive genes; acts with
          Arg80p and Arg82p
          Length = 880

 Score = 38.9 bits (89), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 6/52 (11%)

Query: 8  LSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQREC 59
          +S ++G +     +++  C  CR RK+KCDL        P C RC++    C
Sbjct: 3  ISSKNGPKKMGRAKTFTGCWTCRGRKVKCDL------RHPHCQRCEKSNLPC 48

>Kwal_55.21884 s55 (1020057..1022705) [2649 bp, 882 aa] {ON}
          YLR451W (LEU3) - zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type [contig
          124] FULL
          Length = 882

 Score = 38.9 bits (89), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 3/50 (6%)

Query: 18 KWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRR 67
          + RR   ACV CR +K KCD          PC RC ++   C+     RR
Sbjct: 23 RGRRKKLACVECRQQKSKCD---AHEKAPEPCTRCAKKNVACVLQKDFRR 69

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 97,781,990
Number of extensions: 4244579
Number of successful extensions: 13954
Number of sequences better than 10.0: 621
Number of HSP's gapped: 13910
Number of HSP's successfully gapped: 637
Length of query: 925
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 806
Effective length of database: 39,836,145
Effective search space: 32107932870
Effective search space used: 32107932870
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)