Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1027.265.425ON44342419240.0
ZYRO0F09812g5.425ON4163044745e-54
Smik_4.6285.425ON4582884435e-49
Skud_4.6315.425ON4582904373e-48
NDAI0B056005.425ON4572784182e-45
NCAS0F033105.425ON4422934145e-45
YDR363W (ESC2)5.425ON4562894069e-44
SAKL0G02266g5.425ON4842943947e-42
KAFR0E038705.425ON3962983836e-41
TBLA0A037105.425ON4612863796e-40
TPHA0E018105.425ON4534073701e-38
Suva_2.5345.425ON4521563532e-36
TDEL0E020005.425ON4362783471e-35
KLTH0F16280g5.425ON4733123437e-35
Kwal_55.214685.425ON4653143041e-29
Ecym_55245.425ON4152752853e-27
KNAG0C049805.425ON3452682814e-27
CAGL0A02706g5.425ON3691382073e-17
AER251W5.425ON4071121792e-13
KLLA0E21275g5.425ON3922521693e-12
Kpol_1072.388.638ON89761714.0
Kwal_23.44912.29ON743119704.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1027.26
         (443 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1027.26 s1027 complement(53549..54880) [1332 bp, 443 aa] {O...   745   0.0  
ZYRO0F09812g Chr6 (797169..798419) [1251 bp, 416 aa] {ON} weakly...   187   5e-54
Smik_4.628 Chr4 (1125627..1127003) [1377 bp, 458 aa] {ON} YDR363...   175   5e-49
Skud_4.631 Chr4 (1128086..1129462) [1377 bp, 458 aa] {ON} YDR363...   172   3e-48
NDAI0B05600 Chr2 (1369512..1370885) [1374 bp, 457 aa] {ON} Anc_5...   165   2e-45
NCAS0F03310 Chr6 (670533..671861) [1329 bp, 442 aa] {ON} Anc_5.4...   164   5e-45
YDR363W Chr4 (1199183..1200553) [1371 bp, 456 aa] {ON}  ESC2Sumo...   160   9e-44
SAKL0G02266g Chr7 (190967..192421) [1455 bp, 484 aa] {ON} some s...   156   7e-42
KAFR0E03870 Chr5 (768042..769232) [1191 bp, 396 aa] {ON} Anc_5.4...   152   6e-41
TBLA0A03710 Chr1 (928023..929408) [1386 bp, 461 aa] {ON} Anc_5.4...   150   6e-40
TPHA0E01810 Chr5 complement(364173..365534) [1362 bp, 453 aa] {O...   147   1e-38
Suva_2.534 Chr2 (956062..957420) [1359 bp, 452 aa] {ON} YDR363W ...   140   2e-36
TDEL0E02000 Chr5 complement(379082..380392) [1311 bp, 436 aa] {O...   138   1e-35
KLTH0F16280g Chr6 complement(1321305..1322726) [1422 bp, 473 aa]...   136   7e-35
Kwal_55.21468 s55 complement(851687..853084) [1398 bp, 465 aa] {...   121   1e-29
Ecym_5524 Chr5 (1062240..1063487) [1248 bp, 415 aa] {ON} similar...   114   3e-27
KNAG0C04980 Chr3 complement(958989..960026) [1038 bp, 345 aa] {O...   112   4e-27
CAGL0A02706g Chr1 (290595..291704) [1110 bp, 369 aa] {ON} simila...    84   3e-17
AER251W Chr5 (1099999..1101222) [1224 bp, 407 aa] {ON} Syntenic ...    74   2e-13
KLLA0E21275g Chr5 complement(1900927..1902105) [1179 bp, 392 aa]...    70   3e-12
Kpol_1072.38 s1072 (84696..87389) [2694 bp, 897 aa] {ON} (84696....    32   4.0  
Kwal_23.4491 s23 (743016..745247) [2232 bp, 743 aa] {ON} YNL216W...    32   4.5  

>Kpol_1027.26 s1027 complement(53549..54880) [1332 bp, 443 aa] {ON}
           complement(53549..54880) [1332 nt, 444 aa]
          Length = 443

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/424 (91%), Positives = 386/424 (91%)

Query: 1   MTMVEIXXXXXXXXXXXXXXXXXXXXXXXINGGTKLGDPEESNNLINSEFSDEGDEEEKD 60
           MTMVEI                       INGGTKLGDPEESNNLINSEFSDEGDEEEKD
Sbjct: 1   MTMVEISDSDEDDFFFHNHSNSESEYESEINGGTKLGDPEESNNLINSEFSDEGDEEEKD 60

Query: 61  DRNSGCVNIDEAGAKEDDKLHLNNEVEVEDVSSIHEIDSYEEDTSSDKEFSVVEKNIEGS 120
           DRNSGCVNIDEAGAKEDDKLHLNNEVEVEDVSSIHEIDSYEEDTSSDKEFSVVEKNIEGS
Sbjct: 61  DRNSGCVNIDEAGAKEDDKLHLNNEVEVEDVSSIHEIDSYEEDTSSDKEFSVVEKNIEGS 120

Query: 121 KSKRNKRWLDRTVSREEPSKRQKYEEEEENDDFSKAIRMNSNTLTNVPSPTSDMAPNRIY 180
           KSKRNKRWLDRTVSREEPSKRQKYEEEEENDDFSKAIRMNSNTLTNVPSPTSDMAPNRIY
Sbjct: 121 KSKRNKRWLDRTVSREEPSKRQKYEEEEENDDFSKAIRMNSNTLTNVPSPTSDMAPNRIY 180

Query: 181 NITFTSKLDGSVDKKLQARVLGKQQFSEIMQPILDSYSKIYKVSRVKKRNYKTDLVTVYW 240
           NITFTSKLDGSVDKKLQARVLGKQQFSEIMQPILDSYSKIYKVSRVKKRNYKTDLVTVYW
Sbjct: 181 NITFTSKLDGSVDKKLQARVLGKQQFSEIMQPILDSYSKIYKVSRVKKRNYKTDLVTVYW 240

Query: 241 DRAKLLPFMTCNSLKIPLEFQSEISHIELTIISKENEQQFEADIKAQLEVDQKENTNKTE 300
           DRAKLLPFMTCNSLKIPLEFQSEISHIELTIISKENEQQFEADIKAQLEVDQKENTNKTE
Sbjct: 241 DRAKLLPFMTCNSLKIPLEFQSEISHIELTIISKENEQQFEADIKAQLEVDQKENTNKTE 300

Query: 301 VGSSKNFGIESQIDXXXXXXXXXXXXXXXSIPISVPSQGTAEDPMHIDGDEENAVDIIGK 360
           VGSSKNFGIESQID               SIPISVPSQGTAEDPMHIDGDEENAVDIIGK
Sbjct: 301 VGSSKNFGIESQIDENKKKYEEYENELNESIPISVPSQGTAEDPMHIDGDEENAVDIIGK 360

Query: 361 ATTDLQQNIVKLALVGNDNKKIFVNARETTRFFKLAEYYILHRKLPKSTKVKLIFDDEQI 420
           ATTDLQQNIVKLALVGNDNKKIFVNARETTRFFKLAEYYILHRKLPKSTKVKLIFDDEQI
Sbjct: 361 ATTDLQQNIVKLALVGNDNKKIFVNARETTRFFKLAEYYILHRKLPKSTKVKLIFDDEQI 420

Query: 421 DLDS 424
           DLDS
Sbjct: 421 DLDS 424

>ZYRO0F09812g Chr6 (797169..798419) [1251 bp, 416 aa] {ON} weakly
           similar to uniprot|Q06340 YDR363W Saccharomyces
           cerevisiae ESC2 Protein involved in mating- type locus
           silencing interacts with Sir2p
          Length = 416

 Score =  187 bits (474), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 115/304 (37%), Positives = 172/304 (56%), Gaps = 34/304 (11%)

Query: 120 SKSKRNKRWLDRTVSREEPSKRQKYEEEEENDDFSKAIRMNSNTLTNVPSPTSDMAPNRI 179
           +  +R KR      SR  P+    + E +END+F K I  + N        T+   P RI
Sbjct: 128 TPPRRTKR------SRTTPNIANNFLEPDENDEFFKQIAKDFNHTPLGTRETTPEQPRRI 181

Query: 180 YNITFTSKLDGSVDKKLQARVLGKQQFSEIMQPILDSYSKIYKVSRVKKRNYKTDLVTVY 239
           YN+ F SKLDGS+DK +Q +VLGK  F+ ++  +L+ + + YK+  V K+ Y  + VT+Y
Sbjct: 182 YNVRFLSKLDGSIDKAVQIKVLGKYDFASMLPSVLNGFIREYKIPNVMKKIYSQENVTLY 241

Query: 240 WDRAKLLPFMTCNSLKIPLEFQSEISHIELTIISKENEQQFEADIKAQLEVDQKENTNKT 299
           W  AKLL FMTCNSLKIP  F++EIS I++T+I KE E +FE  I ++L  D++   +  
Sbjct: 242 WKTAKLLNFMTCNSLKIPQAFENEISDIDITVIPKEKENEFEQMINSRLLEDEQNPPDTA 301

Query: 300 EVGSSKNFGIESQIDXXXXXXXXXXXXXXXSIPISVPSQGTAEDPMHIDGDEENAVDIIG 359
           E G+     ++++++               ++  S  +  T E            +D+  
Sbjct: 302 ETGN-----LDARVE--------EFEKELKNVDNSTTNHETTE-----------LIDLED 337

Query: 360 KATTDLQQNIVKLALVGNDNKKIFVNARETTRFFKLAEYYILHRKLPKSTKVKLIFDDEQ 419
           +  TDL    +K+ALVG DNKKIFVN R TT   K+AEYY + +KLPK   +KLIFD E+
Sbjct: 338 EGDTDL----MKIALVGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHEE 393

Query: 420 IDLD 423
           ++L+
Sbjct: 394 LNLN 397

>Smik_4.628 Chr4 (1125627..1127003) [1377 bp, 458 aa] {ON} YDR363W
           (REAL)
          Length = 458

 Score =  175 bits (443), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 104/288 (36%), Positives = 163/288 (56%), Gaps = 32/288 (11%)

Query: 148 EENDDFSKAIRMNSNTLTNVPSPTSDMAPNRIYNITFTSKLDGSVDKKLQARVLGKQQFS 207
           +ENDDF K +   +   T+V   ++     R+YNI F SKL+G+++K +Q +VLGK +FS
Sbjct: 170 DENDDFFKELAKEAKKTTSVSKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFS 229

Query: 208 EIMQPILDSYSKIYKVSRVKKRNYKTDLVTVYWDRAKLLPFMTCNSLKIPLEFQSEISHI 267
            I+   LD  +K YK+ +V K  YK + VT+YW  AKLL FMTCNSL IP +F++E+S I
Sbjct: 230 RILPAALDGLTKSYKIPKVMKDIYKVENVTLYWKNAKLLDFMTCNSLHIPQDFENEVSDI 289

Query: 268 ELTIISKENEQQFEADIKAQL-------------EVDQKENTNKTEVGSSKNFGIESQID 314
           ++TI+SKE E+ FEA ++++L             E+++K    + E   S+    E ++ 
Sbjct: 290 DVTIVSKEYEKNFEASLESKLKEEEAALLVKEHEEIERKLERKRNEQEESEYREFEFELR 349

Query: 315 XXXXXXXXXXXXXXXSIPISVPSQGTAEDPMHIDGDEENAVDIIGKATTDLQQNIVKLAL 374
                          +I      +   ED    D   EN  D          + ++K+AL
Sbjct: 350 NVKEKQERTENETVINI------KNLQED----DNLLENNSD---------SEKVMKIAL 390

Query: 375 VGNDNKKIFVNARETTRFFKLAEYYILHRKLPKSTKVKLIFDDEQIDL 422
            G DNKKI+VN R +T F K+AEYY + ++LP+  ++KL+FD +++D+
Sbjct: 391 RGQDNKKIYVNVRRSTPFSKVAEYYRIQKQLPQKARIKLLFDHDKLDM 438

>Skud_4.631 Chr4 (1128086..1129462) [1377 bp, 458 aa] {ON} YDR363W
           (REAL)
          Length = 458

 Score =  172 bits (437), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 101/290 (34%), Positives = 160/290 (55%), Gaps = 36/290 (12%)

Query: 148 EENDDFSKAIRMNSNTLTNVPSPTSDMAPNRIYNITFTSKLDGSVDKKLQARVLGKQQFS 207
           +ENDDF K +   +  +T +    +   P R+YNI F SKL+G+++K +Q +VLGK +FS
Sbjct: 170 DENDDFFKELAKEAKKITTISKEPTPEQPKRVYNIKFLSKLEGTINKAVQVKVLGKYEFS 229

Query: 208 EIMQPILDSYSKIYKVSRVKKRNYKTDLVTVYWDRAKLLPFMTCNSLKIPLEFQSEISHI 267
            I+   LD   K YK+ +V    YK   VT+YW+ AKLL FMTCNSL I  +F++EIS I
Sbjct: 230 RILPAALDGLVKSYKIPKVMISIYKVGNVTLYWNNAKLLNFMTCNSLNISQDFENEISDI 289

Query: 268 ELTIISKENEQQFEADIKAQLEVDQ---------------KENTNKTEVGSSKNFGIESQ 312
           ++TI+SKE E+ FEA ++++L+ D+               ++  N+ E    + F  E +
Sbjct: 290 DVTIVSKEYEKNFEATLESKLKEDEAALLVKQRQEIERKLEKKRNEQEESEYREFEFELR 349

Query: 313 IDXXXXXXXXXXXXXXXSIPISVPSQGTAEDPMHIDGDEENAVDIIGKATTDLQQNIVKL 372
                             I  + P QG             N++    K      + ++KL
Sbjct: 350 -----NVKETQELEENEIIINTKPLQGN------------NSL----KGNNGDTEKVIKL 388

Query: 373 ALVGNDNKKIFVNARETTRFFKLAEYYILHRKLPKSTKVKLIFDDEQIDL 422
           AL+G DNKKI VN R +T  FK+AEYY + ++LP+  +++L+FD +++++
Sbjct: 389 ALMGQDNKKIHVNVRNSTPLFKVAEYYRIQKRLPQKARIRLLFDHDELNM 438

>NDAI0B05600 Chr2 (1369512..1370885) [1374 bp, 457 aa] {ON}
           Anc_5.425 YDR363W
          Length = 457

 Score =  165 bits (418), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 100/278 (35%), Positives = 157/278 (56%), Gaps = 4/278 (1%)

Query: 146 EEEENDDFSKAIRMNSNTLTNVPS-PTSDMAPNRIYNITFTSKLDGSVDKKLQARVLGKQ 204
           E +END+F K I   +  + ++    T D  P RIYNI F SKLDG+++K +Q +VLGK 
Sbjct: 163 EPDENDEFFKEIAKEAKKIPSLTKESTPDKLPKRIYNIRFISKLDGTMNKCVQVKVLGKF 222

Query: 205 QFSEIMQPILDSYSKIYKVSRVKKRNYKTDLVTVYWDRAKLLPFMTCNSLKIPLEFQSEI 264
           QF +I+   L    K Y +  V ++ Y  D V++YW+ AKLL FMTCNSL IP  F++E+
Sbjct: 223 QFQKILPAALTGLIKAYSIPSVLQKYYSVDNVSLYWNHAKLLDFMTCNSLNIPQAFENEV 282

Query: 265 SHIELTIISKENEQQFEADIKAQLEVDQKENTNKTEVGSSKNFGIESQIDXXXXXXXXXX 324
           +++++ +ISK++E + E  I  +L  D++E + K E  + K   I+ ++           
Sbjct: 283 TNVDIELISKDDEIENEKAITEKLLKDEREVSLKLE-AAKKEKEIQEKLAKELAKEEKEN 341

Query: 325 XXXXXSIPISVPSQGTAEDPMHIDGDEENAVDIIGKATTDLQQNIVKLALVGNDNKKIFV 384
                             +    D    N  + +  A  +   +++K+ALVG DNKKI V
Sbjct: 342 EVFEEFEHELENVSELKTNGYDADASTVNEANEL--ALEEGNADVMKIALVGQDNKKIHV 399

Query: 385 NARETTRFFKLAEYYILHRKLPKSTKVKLIFDDEQIDL 422
           N R TT F K+AEYY + ++LP++ K+KL+FD E++ L
Sbjct: 400 NVRGTTPFSKVAEYYRIQKQLPQNAKIKLVFDHEELSL 437

>NCAS0F03310 Chr6 (670533..671861) [1329 bp, 442 aa] {ON} Anc_5.425
           YDR363W
          Length = 442

 Score =  164 bits (414), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 164/293 (55%), Gaps = 34/293 (11%)

Query: 148 EENDDFSKAIRMNSNTLTNVP----SPTSDMAPNRIYNITFTSKLDGSVDKKLQARVLGK 203
           +END+F K I   +  L ++       T D  P R+Y+I F S+LDG+++K +Q +VLGK
Sbjct: 148 DENDEFFKEIAKEAKKLPSITDRSKEATPDKQPKRVYSIRFLSQLDGTINKTVQVKVLGK 207

Query: 204 QQFSEIMQPILDSYSKIYKVSRVKKRNYKTDLVTVYWDRAKLLPFMTCNSLKIPLEFQSE 263
            QF +I+ P L+   K Y +  V ++ YK D VT+YW+  KLL FMTCNSL IP  F++E
Sbjct: 208 FQFVKILPPTLEGLIKSYSIPTVLQKFYKVDNVTLYWNNTKLLNFMTCNSLNIPQAFENE 267

Query: 264 ISHIELTIISKENEQQFEADIKAQLEVDQKENTNKTEVGS-------------SKNFGIE 310
           ++++++ I+SKE E + E +++ +L +++K    K ++               SKN    
Sbjct: 268 VTNVDIVIMSKEKEIENENELRKKLLLEEKAAQMKLDLEKEREKEGEKNKPKESKNTEYA 327

Query: 311 SQIDXXXXXXXXXXXXXXXSIPISVPSQGTAEDPMHIDGDEENAVDIIGKATTDLQQNIV 370
             I                 +       G  +  M+IDG +              + +I+
Sbjct: 328 KAIAEFEKELKDATELKDSQV-----HGGENDGNMNIDGSDNE------------KSSIM 370

Query: 371 KLALVGNDNKKIFVNARETTRFFKLAEYYILHRKLPKSTKVKLIFDDEQIDLD 423
           K+ALVG+DNKKI+VN R +T F KLAEYY L ++LP++ K++L+FD ++++L+
Sbjct: 371 KIALVGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLE 423

>YDR363W Chr4 (1199183..1200553) [1371 bp, 456 aa] {ON}
           ESC2Sumo-like domain protein; prevents accumulation of
           toxic intermediates during replication-associated
           recombinational repair; roles in silencing, lifespan,
           chromatid cohesion and the intra-S-phase DNA damage
           checkpoint; RENi family member
          Length = 456

 Score =  160 bits (406), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 96/289 (33%), Positives = 164/289 (56%), Gaps = 32/289 (11%)

Query: 148 EENDDFSKAIRMNSNTLTNVPSPTSDMAPNRIYNITFTSKLDGSVDKKLQARVLGKQQFS 207
           +ENDDF K +   +   T +   ++     R+YNI F SKL+G+++K +Q +VLGK +FS
Sbjct: 168 DENDDFFKELAKEAKKSTTISKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFS 227

Query: 208 EIMQPILDSYSKIYKVSRVKKRNYKTDLVTVYWDRAKLLPFMTCNSLKIPLEFQSEISHI 267
           +I+   LD   K YK+ +V K  YK + VT+YW+ AKLL FMTCNSL IP +F++E+S I
Sbjct: 228 KILPAALDGLMKSYKIPKVMKDIYKVENVTLYWNNAKLLTFMTCNSLHIPQDFENEVSDI 287

Query: 268 ELTII-------------SKENEQQFEADIKAQLEVDQKENTNKTEVGSSKNFGIESQID 314
           ++TI+             SK  E++    IK + E+++K    + E   S+    ES++ 
Sbjct: 288 DVTIVSKEYEKNFEATLESKLKEEEAALLIKERQEMERKLEKKRNEQEESEYREFESELK 347

Query: 315 XXXXXXXXXXXXXXXSIPISVPSQGTAEDPMHIDGDEENAVDIIGKATTDLQQNIVKLAL 374
                                 +Q   E+   ++         +   ++ +++ ++++AL
Sbjct: 348 NVEE------------------TQEIKENDTVMNTKLLQEGGSLSGNSSSMEE-VMRIAL 388

Query: 375 VGNDNKKIFVNARETTRFFKLAEYYILHRKLPKSTKVKLIFDDEQIDLD 423
           +G DNKKI+V+ R +T F K+AEYY + ++LP+ T+VKL+FD +++D++
Sbjct: 389 MGQDNKKIYVHVRRSTPFSKIAEYYRIQKQLPQKTRVKLLFDHDELDMN 437

>SAKL0G02266g Chr7 (190967..192421) [1455 bp, 484 aa] {ON} some
           similarities with uniprot|Q06340 YDR363W Saccharomyces
           cerevisiae ESC2 Protein involved in mating- type locus
           silencing interacts with Sir2p
          Length = 484

 Score =  156 bits (394), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 100/294 (34%), Positives = 152/294 (51%), Gaps = 39/294 (13%)

Query: 138 PSKRQKYE--------EEEENDDFSKAIRMNSNTLTNVPSPTSDMAPNRIYNITFTSKLD 189
           PSKR K          EE++ D F   I  N+N  + V   +S     R Y I+F SKL 
Sbjct: 203 PSKRTKRSAVISKPVVEEDDTDAFFTEITRNANRTSTVIRESSPELDKRTYKISFISKLK 262

Query: 190 GSVDKKLQARVLGKQQFSEIMQPILDSYSKIYKVSRVKKRNYKTDLVTVYWDRAKLLPFM 249
           GS+DKK++ +  GK  F++I+   LD+  K Y++ +  +  YK D VT+YW+ AK+L FM
Sbjct: 263 GSIDKKIEVKAWGKSPFTKILPSTLDAIVKAYRIPKAIQNVYKMDNVTLYWNGAKILNFM 322

Query: 250 TCNSLKIPLEFQSEISHIELTIISKENEQQFEADIKAQLEVDQKENTNKTEVGSSKNFGI 309
           TCNSL+IP  +  EI+ +++T++SKE E ++EA+ K  +E +          GSS +   
Sbjct: 323 TCNSLRIPQNYGDEITDVDITLVSKEYEMKYEAEFKEMVENELS--------GSSVDVKN 374

Query: 310 ESQIDXXXXXXXXXXXXXXXSIPISVPSQGTAEDPMHIDGDEENAVDIIGKATTDLQQNI 369
             + D                         T E  + ++  E     ++  +      + 
Sbjct: 375 VKKDDF-----------------------ATNEYELQLEKSESAEPSLLKSSENIRDGSF 411

Query: 370 VKLALVGNDNKKIFVNARETTRFFKLAEYYILHRKLPKSTKVKLIFDDEQIDLD 423
           +KLALVG DNKK+FV AR +T F K+A+YY   + LP  TK+KL FD   + L+
Sbjct: 412 IKLALVGQDNKKMFVKARSSTLFKKIADYYKDVKNLPSFTKLKLTFDHVNLSLE 465

>KAFR0E03870 Chr5 (768042..769232) [1191 bp, 396 aa] {ON} Anc_5.425
           YDR363W
          Length = 396

 Score =  152 bits (383), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 99/298 (33%), Positives = 158/298 (53%), Gaps = 50/298 (16%)

Query: 140 KRQK------YEEEEENDDFSKAIRMNSNTLTNVPSPTSDMAPNRIYNITFTSKLDGSVD 193
           KRQK       E+ +ENDDF K +   +   +   + ++   P RIYNI F SKLDGS++
Sbjct: 116 KRQKSFISETAEDSDENDDFFKELATVAQKKSVTGTESAAKRPKRIYNIRFISKLDGSIN 175

Query: 194 KKLQARVLGKQQFSEIMQPILDSYSKIYKVSRVKKRNYKTDLVTVYWDRAKLLPFMTCNS 253
           K ++ +VLGK  FS+I+   L      YK+  +    Y  + V +YW+ AKLL FMTC+S
Sbjct: 176 KSVKVKVLGKFPFSKILPAALKGLIDAYKIPSIMSEIYDVENVGLYWNNAKLLNFMTCDS 235

Query: 254 LKIPLEFQSEISHIELTIISKENEQQFE-----ADIKAQLEVDQKENTNKTEVGSS---K 305
           L IPL F++EIS++++ I+SKE  ++ E       ++ + +++++E     + G     K
Sbjct: 236 LSIPLAFENEISNVDILIVSKEFGEKLEKLDQMKTLQEEAKLERQEEIKDVDEGDDFVLK 295

Query: 306 NFGIESQIDXXXXXXXXXXXXXXXSIPISVPSQGTAEDPMHIDGDEENAVDIIGKATTDL 365
            F  E                    +    PS       + +D D E++           
Sbjct: 296 EFEAE--------------------LRDVAPSNAN----LSLDTDGEDS----------- 320

Query: 366 QQNIVKLALVGNDNKKIFVNARETTRFFKLAEYYILHRKLPKSTKVKLIFDDEQIDLD 423
            + ++KLAL+G DNKKI+VN R +T+  KL EYY   + L ++ KVKL+FD +++DL+
Sbjct: 321 -EPLMKLALMGQDNKKIYVNVRSSTQISKLVEYYKKQKNLARNVKVKLLFDHDELDLN 377

>TBLA0A03710 Chr1 (928023..929408) [1386 bp, 461 aa] {ON} Anc_5.425
           YDR363W
          Length = 461

 Score =  150 bits (379), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 95/286 (33%), Positives = 157/286 (54%), Gaps = 43/286 (15%)

Query: 153 FSKAIRMNSNTLTNVPSPTSDMA-----------PNRIYNITFTSKLDGSVDKKLQARVL 201
           F KA++ +S+    VP P+S M            P RIYN+ F SK++G++DKK+Q +VL
Sbjct: 185 FFKALKHSSS----VP-PSSTMKSDIKTTKDQGNPKRIYNVRFISKIEGTLDKKVQVKVL 239

Query: 202 GKQQFSEIMQPILDSYSKIYKVSRVKKRNYKTDLVTVYWDRAKLLPFMTCNSLKIPLEFQ 261
           GK  FS+I+ P L ++S+ YK+  V K+ Y+ + VT+YW+ +KLL FMTCNSL IP  ++
Sbjct: 240 GKFPFSKILPPALKAFSEEYKIPNVLKQYYRVNNVTLYWNDSKLLNFMTCNSLNIPQIYE 299

Query: 262 SEISHIELTIISKENEQQFEADIKAQLE--VDQKENTNKTEVGSSKNFGIESQIDXXXXX 319
           +EIS +E+ +I+K NE+ +E  I   L+  ++Q       E+   +   +E         
Sbjct: 300 NEISDVEIIVITKTNEKSYEDKINMSLKQNIEQNLAQKSNEIKELRKLKVE--------- 350

Query: 320 XXXXXXXXXXSIPISVPSQGTAEDPMHIDGDEENAVDIIGKATTD--LQQNIVKLALVGN 377
                         S       E    +    ++ VD    A  D    ++ +K+AL+  
Sbjct: 351 --------------SFEHNSIQEFEKELKELSQDGVDTKQTANIDDIPNESHIKIALLTQ 396

Query: 378 DNKKIFVNARETTRFFKLAEYYILHRKLPKSTKVKLIFDDEQIDLD 423
           DNKK++V  R +T F +L  Y+   ++L ++ ++KLIFD+E++DL+
Sbjct: 397 DNKKLYVKVRNSTPFSELVNYFREQKQLGETQQIKLIFDNEELDLN 442

>TPHA0E01810 Chr5 complement(364173..365534) [1362 bp, 453 aa] {ON}
           Anc_5.425 YDR363W
          Length = 453

 Score =  147 bits (370), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 130/407 (31%), Positives = 207/407 (50%), Gaps = 62/407 (15%)

Query: 50  FSDEGDEEEKDDRNSGCVNIDEAGAKEDDKLHLNNEVEVEDVSSIHEIDSYEEDTSSDKE 109
           F D   E E    +S   NI +    E  KLH  ++    D+ S         ++++  +
Sbjct: 59  FIDSESESETGHTSSSDQNIQKQYVLEVRKLHTGSKRRESDIKS---------NSANSTD 109

Query: 110 FSVVEKNIEGSKSKRNKRWLDRTV-SREEPSKRQKYEEEEE--------NDDFSKAIRMN 160
           FS       GS    N    DRT  S+   S+R+   +E E        +D+F KAIR  
Sbjct: 110 FSDT-----GSLEMVNYNNTDRTYRSKRRRSQRENIIDEREIRPSGIDADDEFFKAIREA 164

Query: 161 S---NTLTNVPSPTSDMAPNRIYNITFTSKLDGSVDKKLQARVLGKQQFSEIMQPILDSY 217
           S   +TL+N  +P      NR YNI + SKL+GS ++++QA+VLG Q F++++ PIL++ 
Sbjct: 165 SKRPSTLSNSGTPE---ILNRKYNIMYISKLNGSEERRIQAKVLGTQTFAKVLPPILNTL 221

Query: 218 SKIYKVSRVKKRNYKTDLVTVYWDRAKLLPFMTCNSLKIPLEFQSEISHIELTIISKENE 277
            K+ K+    +  YK + VT+YW+++KLL FM C+SLKIP  +Q+EIS +E+ +ISKE E
Sbjct: 222 LKVNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLKIPQTYQNEISELEIILISKEEE 281

Query: 278 QQFEADIKAQLEVDQK------ENTNKTEVGSSKNFGIESQIDXXXXXXXXXXXXXXXSI 331
           Q+FE   K QL  D++      EN N     S+K F I +                  ++
Sbjct: 282 QKFEEQFKMQLLEDEQLSQKNIENFN----DSNKPFDILNTSYNEYEKELENWNSKDFNV 337

Query: 332 PISVPSQGTAEDPMHIDGDEENAVDIIGKATTDL--------------QQNIVKLALVGN 377
                      D + +  DE ++ ++ G  + +L                N++K++L+ N
Sbjct: 338 ---------TNDVLDVSNDENSSNNVKGNDSMNLIEISDNESSIKEHGTSNVIKISLMSN 388

Query: 378 DNKKIFVNARETTRFFKLAEYYILHRKLPKSTKVKLIFDDEQIDLDS 424
           DNKKIFVN R +T+  KL +Y+   + L  + ++K+IFD + + LDS
Sbjct: 389 DNKKIFVNVRSSTKIQKLVDYFKKCKNLTSNQRIKVIFDHDVLSLDS 435

>Suva_2.534 Chr2 (956062..957420) [1359 bp, 452 aa] {ON} YDR363W
           (REAL)
          Length = 452

 Score =  140 bits (353), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 105/156 (67%), Gaps = 3/156 (1%)

Query: 136 EEPSKRQK---YEEEEENDDFSKAIRMNSNTLTNVPSPTSDMAPNRIYNITFTSKLDGSV 192
           E+  KRQK       +ENDDF K +   +   T++   ++   P R+YNI F SKL+G++
Sbjct: 149 EQKYKRQKNSLLNTYDENDDFFKELAKEAKKTTSISKESTPDQPKRVYNIKFFSKLEGTI 208

Query: 193 DKKLQARVLGKQQFSEIMQPILDSYSKIYKVSRVKKRNYKTDLVTVYWDRAKLLPFMTCN 252
           +K +Q +VLGK +FS I+   LD   K YK+ +V K  YK + VT+YW+ AKLL FMTCN
Sbjct: 209 NKAVQVKVLGKYEFSRILPAALDGLMKSYKIPKVMKDIYKEENVTLYWNNAKLLKFMTCN 268

Query: 253 SLKIPLEFQSEISHIELTIISKENEQQFEADIKAQL 288
           SL IP +F++EIS I++TI+SKE E+ FEA ++++L
Sbjct: 269 SLHIPQDFENEISDIDITIVSKEYEKNFEATLESKL 304

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 47/57 (82%)

Query: 367 QNIVKLALVGNDNKKIFVNARETTRFFKLAEYYILHRKLPKSTKVKLIFDDEQIDLD 423
           + ++K+AL+G DNKKI+VN R +T FFK+AEYY + ++LP+  ++KL+FD ++++L+
Sbjct: 377 EKVMKIALMGQDNKKIYVNVRNSTPFFKVAEYYRIQKQLPQKARIKLLFDHDELNLN 433

>TDEL0E02000 Chr5 complement(379082..380392) [1311 bp, 436 aa] {ON}
           Anc_5.425 YDR363W
          Length = 436

 Score =  138 bits (347), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 94/278 (33%), Positives = 158/278 (56%), Gaps = 17/278 (6%)

Query: 146 EEEENDDFSKAIRMNSNTLTNVPSPTSDMAPNRIYNITFTSKLDGSVDKKLQARVLGKQQ 205
           E EE+ + S+ +       T+ P+  +  A  +I+N+ F SKL+G+VD+ +Q +VLGK  
Sbjct: 158 ETEESYNVSEPVEETRQMSTSSPAKGTK-ARQKIFNLMFLSKLEGTVDRAIQLKVLGKYD 216

Query: 206 FSEIMQPILDSYSKIYKVSRVKKRNYKTDLVTVYWDRAKLLPFMTCNSLKIPLEFQSEIS 265
           F+ I++ +L+   + +K+       Y  D VT+YW+  KLL FMTC+SLKI     +E++
Sbjct: 217 FASILESVLERVVEEFKIPYPVMHQYTVDNVTLYWNGGKLLKFMTCDSLKISNIDNNEVT 276

Query: 266 HIELTIISKENEQQFEADIKAQLEVDQKENTNKTEVGSSKNFGIESQIDXXXXXXXXXXX 325
            IE+T++SK +E++FE + +A+L   +KE  +K ++ ++  F  +   D           
Sbjct: 277 EIEVTMVSKSDEERFEEEERARLLRVEKEAMSKAKLPTT--FEADPSDDNGEADCSIEII 334

Query: 326 XXXXSIPISVPSQGTAEDPMHIDGDEENAVDIIGKATTDLQQNIVKLALVGNDNKKIFVN 385
               S   S   +G+   P  +D ++E+ +++I            KLALVG DN +++VN
Sbjct: 335 EMDDSSRESEMKEGSKLAP--VDLEDEDELEVI------------KLALVGQDNARLYVN 380

Query: 386 ARETTRFFKLAEYYILHRKLPKSTKVKLIFDDEQIDLD 423
            R +T F K+AEYY LH+ LP   K+ L FD E++DL+
Sbjct: 381 VRRSTPFSKVAEYYKLHKPLPMEVKLNLYFDHEKLDLN 418

>KLTH0F16280g Chr6 complement(1321305..1322726) [1422 bp, 473 aa]
           {ON} some similarities with uniprot|Q06340 YDR363W
           Saccharomyces cerevisiae ESC2 Protein involved in
           mating- type locus silencing interacts with Sir2p
          Length = 473

 Score =  136 bits (343), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 100/312 (32%), Positives = 151/312 (48%), Gaps = 29/312 (9%)

Query: 113 VEKNIEGSKSKRNKRWLDRTVSREEPSKRQKYEEEEENDDFSKAIRMNSNTLTNVPSPTS 172
           +E+  +  +  ++ R   R  SR   +      E++E+D F + +   ++   +    +S
Sbjct: 171 LEELAQAPRLAKSPRGHPRGSSRAVRTNSLPQHEKDEDDKFFEELEREASRTASTVKESS 230

Query: 173 DMAPNRIYNITFTSKLDGSVDKKLQARVLGKQQFSEIMQPILDSYSKIYKVSRVKKRNYK 232
                RIYNI F S L+GS  +++  +V GKQ F +I+   L +  K YK+       Y+
Sbjct: 231 PAVAQRIYNIKFISDLEGSAGRRINVKVKGKQSFDQILPVALKTIIKEYKIPDALHPIYE 290

Query: 233 TDLVTVYWDRAKLLPFMTCNSLKIPLEFQSEISHIELTIISKENEQQFEADIKAQLEVDQ 292
           TD VT+Y D  K+L FM CNSL+IPLEF+ E+S + LTIISK  EQ FEA        +Q
Sbjct: 291 TDKVTLYRDGVKILNFMNCNSLQIPLEFKGEVSDVCLTIISKGQEQNFEA------LYEQ 344

Query: 293 KENTNKTEVGSSKNFGIESQIDXXXXXXXXXXXXXXXSIPISVPSQGTAEDPMHIDGDEE 352
            +++N   V +    G E+  D               +   SV +Q     P  +D +  
Sbjct: 345 SKHSNHELVPAFIEPGTETP-DFTVEEYEKELRNVDFNKNTSVQNQPP---PQSVDDN-- 398

Query: 353 NAVDIIGKATTDLQQNIVKLALVGNDNKKIFVNARETTRFFKLAEYYILHRKLPKSTKVK 412
                            +++AL+  DNKKI V AR  T F  LAE+Y     LP   +V 
Sbjct: 399 -----------------IRIALMSQDNKKIIVTARPETTFAALAEHYQKLTSLPPQQQVL 441

Query: 413 LIFDDEQIDLDS 424
           L FD+E++ LDS
Sbjct: 442 LFFDNEELHLDS 453

>Kwal_55.21468 s55 complement(851687..853084) [1398 bp, 465 aa] {ON}
           YDR363W (ESC2) - establishes silent chromatin [contig
           130] FULL
          Length = 465

 Score =  121 bits (304), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 88/314 (28%), Positives = 149/314 (47%), Gaps = 56/314 (17%)

Query: 120 SKSKRNKRWLDRTVSREEPSKRQKYEEEEENDDFSKAIRMNSNTLTNVPSPTSDMAPNRI 179
           ++S+ NKR +   +S           E+ E++ F + ++  +   T+     S     R+
Sbjct: 181 TRSRTNKRSITANISLAA--------EDNEDEKFFEELQREAGRTTSTLKEGSPATAKRV 232

Query: 180 YNITFTSKLDGSVDKKLQARVLGKQQFSEIMQPILDSYSKIYKVSRVKKRNYKTDLVTVY 239
           YNI F S L+GS++ K+  +V GK  FSEI+   L +  K YKVS+  K  Y+ + V++Y
Sbjct: 233 YNIKFLSNLEGSLNDKINVKVKGKHAFSEILPIALKTLIKEYKVSKDLKPFYQPENVSLY 292

Query: 240 WDRAKLLPFMTCNSLKIPLEFQSEISHIELTIISKENEQQF----EADIKAQLEVDQKEN 295
            +  K+L FM CNSL IPL ++ E+S + +T++S++ EQ++    E    A  ++ ++E 
Sbjct: 293 RNGLKILNFMNCNSLHIPLNYEGEVSDVSMTLVSRDREQEYVKTLEQSRHATPDLSREET 352

Query: 296 TNKTEVGSSKNF-----GIESQIDXXXXXXXXXXXXXXXSIPISVPSQGTAEDPMHIDGD 350
           + K    S + F     G ES                                     G+
Sbjct: 353 SPKIPGFSIEEFEKDLEGFES-------------------------------------GE 375

Query: 351 EENAVDIIGKATTDLQQNIVKLALVGNDNKKIFVNARETTRFFKLAEYYILHRKLPKSTK 410
             N ++      T+     +K+AL+  DNKKI+VN R+TT    L E+Y   + L    +
Sbjct: 376 SNNLLE--DTPQTENNHGTIKIALMAQDNKKIYVNVRQTTTIAMLGEHYRTTKNLSSIER 433

Query: 411 VKLIFDDEQIDLDS 424
            K +FD+E + L +
Sbjct: 434 FKFVFDNEDLQLST 447

>Ecym_5524 Chr5 (1062240..1063487) [1248 bp, 415 aa] {ON} similar to
           Ashbya gossypii AER251W
          Length = 415

 Score =  114 bits (285), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 79/275 (28%), Positives = 134/275 (48%), Gaps = 45/275 (16%)

Query: 160 NSNTLTNVPSPTSDMAPNRIYNITFTSKLDGSVDKKLQARVLGKQQFSEIMQPILDSYSK 219
           N+ +L N  S   ++  N IYN+ F SKL+GS +K++  R+ GK++FS  +   L ++ K
Sbjct: 152 NNGSLKNGSSNNKEIGTN-IYNVGFISKLEGSTNKRINVRITGKKKFSAFLPIALKTFVK 210

Query: 220 IYKVSRVKKRNYKTDLVTVYWDRAKLLPFMTCNSLKIPLEFQSEISHIELTIISKENEQQ 279
            YK++      Y+ D V +Y +  ++  FMTC+S  I   + S    IE+ I+  E   +
Sbjct: 211 EYKIAASLHDKYQIDNVKIYREGVEIFKFMTCDSFNIAEAYASSSIDIEVYIVPNELASE 270

Query: 280 FEADIKAQLEVDQKENTNKTEVGSSKNFGIESQIDXXXXXXXXXXXXXXXSIPISVPSQG 339
           FE   K ++E   K    +  + +S                           P+ + S G
Sbjct: 271 FEIQWKQKIETKMK----RVSISAS---------------------------PVDLDSDG 299

Query: 340 T--AEDPMHIDGDEENAVDIIGKATTDLQQN-----------IVKLALVGNDNKKIFVNA 386
                D   ++  E++  +      T++Q +           ++K+ L+G+DNKK++VN 
Sbjct: 300 IEFGNDDFRVNEYEKDLANARSLDETEIQYSNQISKPDDGNELIKVVLLGSDNKKVYVNV 359

Query: 387 RETTRFFKLAEYYILHRKLPKSTKVKLIFDDEQID 421
           + TT F KLAE+Y   +KLP +TK+ L FD + ID
Sbjct: 360 KPTTTFEKLAEHYRRIKKLPPTTKLILSFDHDDID 394

>KNAG0C04980 Chr3 complement(958989..960026) [1038 bp, 345 aa] {ON}
           Anc_5.425 YDR363W
          Length = 345

 Score =  112 bits (281), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 64/268 (23%), Positives = 125/268 (46%), Gaps = 48/268 (17%)

Query: 153 FSKAIRMNSNTLTNVPSPTSDMAPNRIYNITFTSKLDGSVDKKLQARVLGKQQFSEIMQP 212
           F + +R  + ++    + T+   P+ +Y + F S+L+G++ K +Q +V+G +    ++  
Sbjct: 105 FQELLRARTQSVEPAETATTSTVPSPVYRVRFQSQLEGTLGKSVQVKVIGTRPLGTVLPS 164

Query: 213 ILDSYSKIYKVSRVKKRNYKTDLVTVYWDRAKLLPFMTCNSLKIPLEFQSEISHIELTII 272
           +L +  +  +V +V +  Y    V +Y   A++LPFM CNSL +  EF++E+  +++ ++
Sbjct: 165 VLSALVRACRVPQVLQGGYTEGAVGMYRGGARVLPFMNCNSLGVVQEFENEVLEVDV-VL 223

Query: 273 SKENEQQFEADIKAQLEVDQKENTNKTEVGSSKNFGIESQIDXXXXXXXXXXXXXXXSIP 332
              N +   +D+        +E TN TE  +S                          +P
Sbjct: 224 RALNLETPASDVSG-----GQEATNGTEAAAS------------------------VPVP 254

Query: 333 ISVPSQGTAEDPMHIDGDEENAVDIIGKATTDLQQNIVKLALVGNDNKKIFVNARETTRF 392
           +  P+   +E P    G+   A              ++K+AL+  DN++++V     T  
Sbjct: 255 VPAPATAASESP----GNPAPA--------------LMKIALLSADNRRLYVKVHGGTPC 296

Query: 393 FKLAEYYILHRKLPKSTKVKLIFDDEQI 420
            +L EYY + R LP    ++L  DDEQ+
Sbjct: 297 SRLLEYYRMERGLPAGAPLQLRLDDEQV 324

>CAGL0A02706g Chr1 (290595..291704) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q06340 Saccharomyces cerevisiae YDR363w ESC2
          Length = 369

 Score = 84.3 bits (207), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 79/138 (57%), Gaps = 2/138 (1%)

Query: 147 EEENDDFSKAIRMNSNTLTNVPSPTSDMAPNRIYNITFTSKLDGSVDKKLQARVLGKQQF 206
           E+END F ++I   S +L  V   +  +  +++Y + F S +DG+  K +Q + LG   F
Sbjct: 121 EDENDLFFQSIAKRSQSLP-VQDGSGAVRQDKVYYVQFISHVDGTKGKSVQVKALGSHPF 179

Query: 207 SEIMQPILDSYSKIYKVSRVKKRNYKTDLVTVYWDRAKLLPFMTCNSLKIPLEFQSEISH 266
           S+++   L    + +++  V +  Y+ + V  YW+RAK+L FMTC++L++P  + S+   
Sbjct: 180 SKLVAAALSGLMRAHRLPSVMRPLYQPESVVSYWNRAKVLGFMTCDTLRVPQRYGSDYLE 239

Query: 267 IELTIISKENEQQFEADI 284
           I+L  + KE  Q  E ++
Sbjct: 240 IQLVPV-KEEAQYLEQEV 256

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 40/55 (72%)

Query: 367 QNIVKLALVGNDNKKIFVNARETTRFFKLAEYYILHRKLPKSTKVKLIFDDEQID 421
           + ++++AL G DNKK++VN + TT F ++ EYY   ++LP+ST++ L  DDE +D
Sbjct: 294 EEVLRVALQGQDNKKVYVNVKPTTTFARMIEYYRTQKQLPRSTQITLALDDEPLD 348

>AER251W Chr5 (1099999..1101222) [1224 bp, 407 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR363W (ESC2)
          Length = 407

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 65/112 (58%)

Query: 178 RIYNITFTSKLDGSVDKKLQARVLGKQQFSEIMQPILDSYSKIYKVSRVKKRNYKTDLVT 237
           R+YN+ F S+++GS ++++  +V G++QF+  +   L ++SK + + +  K  Y+ D V 
Sbjct: 164 RVYNVGFISRIEGSRNRRVNVKVTGQKQFATFLAIALAAFSKQHNIRKSLKPKYQADQVK 223

Query: 238 VYWDRAKLLPFMTCNSLKIPLEFQSEISHIELTIISKENEQQFEADIKAQLE 289
           +Y +  ++  FMTC+S  I   + +  + IE+ I+  +    FE + K + E
Sbjct: 224 IYREGVEVFKFMTCDSFNIEEPYNASATDIEVYIVPVDEATAFEQEWKRKFE 275

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 44/61 (72%)

Query: 363 TDLQQNIVKLALVGNDNKKIFVNARETTRFFKLAEYYILHRKLPKSTKVKLIFDDEQIDL 422
            D    ++K+ L+G+DNKK+F++ R TT   K+AE+Y + ++LP + ++ L+FD E+IDL
Sbjct: 328 ADESSQLLKIVLLGSDNKKVFIHVRPTTTLLKVAEHYRVAKELPPTVQLSLMFDHEEIDL 387

Query: 423 D 423
           D
Sbjct: 388 D 388

>KLLA0E21275g Chr5 complement(1900927..1902105) [1179 bp, 392 aa]
           {ON} some similarities with uniprot|Q06340 YDR363W
           Saccharomyces cerevisiae ESC2 Protein involved in
           mating- type locus silencing interacts with Sir2p
          Length = 392

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 60/252 (23%), Positives = 113/252 (44%), Gaps = 36/252 (14%)

Query: 178 RIYNITFTSKLDGSVDKKLQARVLGKQQFSEIMQPILDSYSKIYKVSRVKKRNYKTDLVT 237
           RIYNI F S L+GS DK++  +V G + F  I+   + ++ + YK+ R  +  Y    + 
Sbjct: 148 RIYNINFISTLEGSQDKRVNVKVTGNKTFESILPITIRTFIQSYKIPRRLRIFYTPAELV 207

Query: 238 VYWDRAKLLPFMTCNSLKIPLEFQSEISHIELTIISKENEQQFEADIKAQLEVDQKENTN 297
           ++    ++LPF  C+SL+IP       + ++L I+   +   ++ + K   E        
Sbjct: 208 LFRAGVEVLPFSNCDSLRIPKTVSEYETTVDLVIVHSADANNYKTEYKRIRE-------- 259

Query: 298 KTEVGSSKNFGIESQIDXXXXXXXXXXXXXXXSIPISVPSQGTAEDPMHIDGDEENAV-- 355
                  ++F  ES I+                 P+  P++   E     + + E+A   
Sbjct: 260 ----SRLQSFLDESNIEEQD--------------PLEQPARD--EKFKLFEKELESAPKL 299

Query: 356 -----DIIGKATTDLQ-QNIVKLALVGNDNKKIFVNARETTRFFKLAEYYILHRKLPKST 409
                D+I    +D++  N ++L L+   NK+  ++    T F ++A  Y     L +  
Sbjct: 300 AERTDDVIDLLDSDIESSNSIRLTLIDKANKRTSISVWPNTTFTEIANRYKTISSLSEDA 359

Query: 410 KVKLIFDDEQID 421
            V LIFD+E+++
Sbjct: 360 NVLLIFDNEELN 371

>Kpol_1072.38 s1072 (84696..87389) [2694 bp, 897 aa] {ON}
           (84696..87389) [2694 nt, 898 aa]
          Length = 897

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 25/61 (40%)

Query: 74  AKEDDKLHLNNEVEVEDVSSIHEIDSYEEDTSSDKEFSVVEKNIEGSKSKRNKRWLDRTV 133
              DD +H+ N     D   + EID+Y+     D   S++  N      KR   WLD   
Sbjct: 831 GTADDNVHIQNTYNFVDKLDLDEIDNYDMQIYPDSNHSIMHHNALKMVYKRLYDWLDNAF 890

Query: 134 S 134
           S
Sbjct: 891 S 891

>Kwal_23.4491 s23 (743016..745247) [2232 bp, 743 aa] {ON} YNL216W
           (RAP1) - repressor activator protein [contig 3] FULL
          Length = 743

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 53/119 (44%), Gaps = 10/119 (8%)

Query: 31  NGGTKLGDPEESNNLINSEFSDEGDEEEKDDRNSGCVNIDEAGAKEDDKLHLNNEVEVED 90
           NGG  + D E+ N   NS  + E + E   D N   VN   +GA E  +    +  + E 
Sbjct: 210 NGGNGINDVEKENTK-NSSTASESNGESNGDNNGSPVNGGNSGANEPSR----SPAKTEP 264

Query: 91  VSSIHEIDSYEEDTSSDKEFSVVEKNIEGSKSKRNKRWLDRTVSREEP-----SKRQKY 144
           V+    I S+ + + +D+E   + + +  + ++R    L   +SR  P     S R +Y
Sbjct: 265 VAPQRHISSHNKSSFTDEEDEFILEVVRKNPTRRTTHTLYDEISRFVPNHTGNSIRHRY 323

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.128    0.347 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,615,755
Number of extensions: 2230317
Number of successful extensions: 18738
Number of sequences better than 10.0: 1134
Number of HSP's gapped: 18497
Number of HSP's successfully gapped: 1400
Length of query: 443
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 330
Effective length of database: 40,524,141
Effective search space: 13372966530
Effective search space used: 13372966530
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 67 (30.4 bits)