Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1023.975.528ON59159125600.0
TPHA0K005205.528ON5606424471e-47
ZYRO0D12584g5.528ON5793903245e-31
NDAI0C010605.528ON6373503016e-28
SAKL0G04950g5.528ON5673902962e-27
NCAS0H025605.528ON5873322882e-26
Smik_13.1445.528ON6393562821e-25
TDEL0A039205.528ON4661542763e-25
KLTH0G03784g5.528ON5693282703e-24
Suva_13.1555.528ON6453652671e-23
YML007W (YAP1)5.528ON6503652624e-23
KAFR0C054005.528ON4813052571e-22
KLLA0A01760g5.528ON5833462402e-20
KNAG0B036805.528ON4823092382e-20
Skud_13.1475.528ON6651222332e-19
TBLA0G009305.528ON6081282286e-19
Kwal_47.186315.528ON584922233e-18
CAGL0H04631g5.528ON588642002e-15
TPHA0D023405.528ON506411955e-15
NCAS0F011005.528ON4751021794e-13
Kpol_1004.225.528ON475851769e-13
CAGL0F03069g5.528ON486961511e-09
Ecym_40645.528ON426751473e-09
NDAI0H016105.528ON519471271e-06
TBLA0D016405.528ON599411261e-06
YDR423C (CAD1)5.528ON4091201152e-05
KNAG0C032105.528ON3841191152e-05
ADR195C5.528ON288741072e-04
Smik_4.6985.528ON393911072e-04
KAFR0E032905.528ON2651001026e-04
Suva_2.600singletonOFF38230770.95
NOTE: 1 genes in the same pillar as Kpol_1023.97 were not hit in these BLAST results
LIST: Skud_4.697

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1023.97
         (591 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON} (2250...   990   0.0  
TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5....   176   1e-47
ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]...   129   5e-31
NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.5...   120   6e-28
SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {...   118   2e-27
NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {O...   115   2e-26
Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007...   113   1e-25
TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {O...   110   3e-25
KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {...   108   3e-24
Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007...   107   1e-23
YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic...   105   4e-23
KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa] ...   103   1e-22
KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON} unipro...    97   2e-20
KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.5...    96   2e-20
Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007...    94   2e-19
TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.5...    92   6e-19
Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007...    91   3e-18
CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {...    82   2e-15
TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {O...    80   5e-15
NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {O...    74   4e-13
Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {O...    72   9e-13
CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {...    63   1e-09
Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar t...    61   3e-09
NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {O...    54   1e-06
TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.5...    53   1e-06
YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}...    49   2e-05
KNAG0C03210 Chr3 (631277..632431) [1155 bp, 384 aa] {ON} Anc_5.5...    49   2e-05
ADR195C Chr4 complement(1041896..1042762) [867 bp, 288 aa] {ON} ...    46   2e-04
Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1...    46   2e-04
KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.52...    44   6e-04
Suva_2.600 Chr2 complement(1070824..1071000,1071004..1071024,107...    34   0.95 

>Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON}
           (225050..226825) [1776 nt, 592 aa]
          Length = 591

 Score =  990 bits (2560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/591 (84%), Positives = 501/591 (84%)

Query: 1   MTSVTVKRPLDESLTALSPNDNNSSILNASTDVDASTVANANKKKVGRKLLGDHEVKNKR 60
           MTSVTVKRPLDESLTALSPNDNNSSILNASTDVDASTVANANKKKVGRKLLGDHEVKNKR
Sbjct: 1   MTSVTVKRPLDESLTALSPNDNNSSILNASTDVDASTVANANKKKVGRKLLGDHEVKNKR 60

Query: 61  TAQNRAAQXXXXXXXXXXXXXXXXXVHELEKVKQQNDVESEFLRNQLTLMIDELKKYRPE 120
           TAQNRAAQ                 VHELEKVKQQNDVESEFLRNQLTLMIDELKKYRPE
Sbjct: 61  TAQNRAAQRAFRERKERKMKELEDKVHELEKVKQQNDVESEFLRNQLTLMIDELKKYRPE 120

Query: 121 KSSDIKVLEYLAKHEENGSTEKIKKNIQRKEDFSFEYPPPPPHSQTQGSSADTNVTYNKQ 180
           KSSDIKVLEYLAKHEENGSTEKIKKNIQRKEDFSFEYPPPPPHSQTQGSSADTNVTYNKQ
Sbjct: 121 KSSDIKVLEYLAKHEENGSTEKIKKNIQRKEDFSFEYPPPPPHSQTQGSSADTNVTYNKQ 180

Query: 181 NTDQRXXXXXXXXXXXXXXXXXXXKKQSILNNRIXXXXXXXXXXXGWMDNVFYKDDAQNL 240
           NTDQR                   KKQSILNNRI           GWMDNVFYKDDAQNL
Sbjct: 181 NTDQRLPSPGSSSGSSPNMLMLNNKKQSILNNRITTPSSSTSSSSGWMDNVFYKDDAQNL 240

Query: 241 PHFDTSSTSTNTAFRDSPVNNSINSIKLEDNLKNNNNSALTVGYXXXXXXXXXXXXXXXX 300
           PHFDTSSTSTNTAFRDSPVNNSINSIKLEDNLKNNNNSALTVGY                
Sbjct: 241 PHFDTSSTSTNTAFRDSPVNNSINSIKLEDNLKNNNNSALTVGYDSDLFSNDFNFDDHFD 300

Query: 301 QQVSSFCVKMNQACGTKQNPVPKTMAESNKSQKTPPSEGNPSTTPNESSNDSSLSIAKFD 360
           QQVSSFCVKMNQACGTKQNPVPKTMAESNKSQKTPPSEGNPSTTPNESSNDSSLSIAKFD
Sbjct: 301 QQVSSFCVKMNQACGTKQNPVPKTMAESNKSQKTPPSEGNPSTTPNESSNDSSLSIAKFD 360

Query: 361 DPNFLFDSPSNDFTNTLDIPSVDSSNANSNFGQLGFHGLSNDITFNSNDSNWNDFISLKT 420
           DPNFLFDSPSNDFTNTLDIPSVDSSNANSNFGQLGFHGLSNDITFNSNDSNWNDFISLKT
Sbjct: 361 DPNFLFDSPSNDFTNTLDIPSVDSSNANSNFGQLGFHGLSNDITFNSNDSNWNDFISLKT 420

Query: 421 DSMTSVPTTSSVATNDHPINISKPSEENSPRKEVLPFIDTSIAFPETKADFDAFDNQMFF 480
           DSMTSVPTTSSVATNDHPINISKPSEENSPRKEVLPFIDTSIAFPETKADFDAFDNQMFF
Sbjct: 421 DSMTSVPTTSSVATNDHPINISKPSEENSPRKEVLPFIDTSIAFPETKADFDAFDNQMFF 480

Query: 481 RDDGFNESLNISDDIVGAESXXXXXXXXXXXLISKNLVCEEVKEHDMVIPTSDGKLLKCS 540
           RDDGFNESLNISDDIVGAES           LISKNLVCEEVKEHDMVIPTSDGKLLKCS
Sbjct: 481 RDDGFNESLNISDDIVGAESDDEQDNNNDNDLISKNLVCEEVKEHDMVIPTSDGKLLKCS 540

Query: 541 EVWDRITAHPRYSDIDIDGLCQELMHNAXXXXXXXXXXXXXXXXALSNHMS 591
           EVWDRITAHPRYSDIDIDGLCQELMHNA                ALSNHMS
Sbjct: 541 EVWDRITAHPRYSDIDIDGLCQELMHNAKCSDKGVVVDSKDVQKALSNHMS 591

>TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5.528
           YDR423C
          Length = 560

 Score =  176 bits (447), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 184/642 (28%), Positives = 270/642 (42%), Gaps = 160/642 (24%)

Query: 22  NNSSILNASTDVDASTVANANKKKVGRKLLGDHEVKNKRTAQNRAAQXXXXXXXXXXXXX 81
           N+  +L+A+     S+ + A++KKVGRKLL D +VK+KRT QNR AQ             
Sbjct: 6   NSKRVLDANIGDSESSSSAASRKKVGRKLLNDSDVKSKRTFQNRNAQRAFRERKERKLKE 65

Query: 82  XXXXVHELEKVKQQNDVESEFLRNQLTLMIDELKKYRPEKSSDIKVLEYLAKHEE----- 136
               V  LE+V +  ++E+ FLR++L  M DELKKYRP +SSD++VLEYLAK E+     
Sbjct: 66  LEDKVLALEQVNEAKELETNFLRSRLKSMADELKKYRPAQSSDLEVLEYLAKKEQLAKYN 125

Query: 137 ------------------------------NGSTEK--------IKKNIQRKEDFSFEYP 158
                                         N S E+        I  NI++K+DF+FEYP
Sbjct: 126 HNANPIKEEEEVKEEEEDEEGEEGGDNIHANQSFEQESAKQKQEILSNIEKKKDFTFEYP 185

Query: 159 -----PPPPHSQTQGSSADTNVTYNKQNTDQRXXXXXXXXXXXXXXXXXXXKKQSILNNR 213
                P P  S +  SS  T+  YN Q                         +Q  +NN+
Sbjct: 186 KQNKMPSPESSTSITSSVVTSGKYNVQ------------------------LQQGSVNNQ 221

Query: 214 IXXXXXXXXXXXGWMDNVFYKDDAQNLPHFDTSSTSTNTAFRDSPVNNSINSIKLEDNLK 273
           +            W+  VFY+D+A+ LP F+    +  T    SP N+ IN     D + 
Sbjct: 222 VTTPDSSVSSST-WIHPVFYEDNAKQLPQFE-QPKAVPTNMDVSPANSDINQ-STSDIVP 278

Query: 274 NNNNS--ALTVGYXXXXXXXXXXXXXXXXQQVSSFCVKMNQACGTKQNPVPKTMAESNKS 331
            +  S  A+  GY                 QVSSFC K+N                    
Sbjct: 279 GSAKSFDAIPFGYDSSLFSNDFNFDDKFSDQVSSFCDKVN-------------------- 318

Query: 332 QKTPPSEGNPSTTPNESSNDSSLSIAKFDDPNFLFDSPSNDFTNTLDIPSVDSSNANSNF 391
                   NP+ +P  +S  S +S       N+  +S      NT+ +P     +  + F
Sbjct: 319 --------NPNYSPENNSLPSLVS------ENYNAES----HNNTIALP-----DTTTEF 355

Query: 392 GQLGFHGLSNDIT---------FNSNDSNWNDFISLKTDSMTSVPTTSSVATNDHPINIS 442
           G+ GF   ++D T         F+ +D +   FI    D   +VPT+ +   ND      
Sbjct: 356 GKKGFEFANSDATDTFSWNSGAFHEDDPSSKLFIDT-LDKQYAVPTSDASIANDF----- 409

Query: 443 KPSEENSPRKEVLPFIDTSIAFPETKADF-DAFDNQMFFRDDGFNESLNISDDIVGAESX 501
             S+ N+       FI++S+AFPE+ A   ++ +  ++FRD   + ++++          
Sbjct: 410 --SKANN-------FIESSLAFPESTASVANSMNGNLYFRDSNIDNTIDML---DLLADD 457

Query: 502 XXXXXXXXXXLISKNLVCEEV------------KEHDMVIPTSDGKLLKCSEVWDRITAH 549
                     LI  NLV EE             K  + VI   DG  LKCS+VW R+T H
Sbjct: 458 DDDEDEVDESLIKNNLVTEECMDDAQAKSQLCDKYKNTVIRAEDGSYLKCSQVWSRLTEH 517

Query: 550 PRYSDIDIDGLCQELMHNAXXXXXXXXXXXXXXXXALSNHMS 591
           P+YS++DIDGLC ELM  A                ALS ++S
Sbjct: 518 PKYSELDIDGLCTELMLQAKCSEKGVVVESRDVQKALSKYLS 559

>ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]
           {ON} weakly similar to uniprot|P19880 YML007W
           Saccharomyces cerevisiae YAP1 bZip transcription factor
           required for oxidative stress tolerance
          Length = 579

 Score =  129 bits (324), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 118/390 (30%), Positives = 154/390 (39%), Gaps = 101/390 (25%)

Query: 226 GWMDNVFYKDDAQNLPHFDTSSTSTNTAFRDSPVNNSINSIKLEDNLKNNNNSALTVGYX 285
           GWMDNVFY DDA+ LP F  S+            NN+ NS   EDN      + +   Y 
Sbjct: 265 GWMDNVFYNDDARQLPQFYQSN------------NNNENSRLFEDN------TTMPGDYD 306

Query: 286 XXXXXXXXXXXXXXXQQVSSFCVKMNQACGTKQNPVPKTMAESNKSQKTPPSEGNPSTTP 345
                          +QVS FC K+ Q CGTK  P+P+    S  S   P S    S T 
Sbjct: 307 SVTFSNQFNFNDKFDEQVSEFCTKLGQVCGTKDCPIPQKQKSSYSSPAVPKSPIVFSNTW 366

Query: 346 NESSNDSSLSIAKFDDPNFLFDSPSNDFTNTLDIPSVDSSNANSNFGQLGFHGLSNDITF 405
           +  S D    +   ++               L  PS+  +NA SN               
Sbjct: 367 DTPSEDPQQQLPTLEE--------------NLSDPSIRQTNAYSN--------------- 397

Query: 406 NSNDSNWNDFISLKTDSMTSVPTTSSVATNDHPINISKPSEENSPRKEVLPFIDTSIAFP 465
                                  T     +D  I +S  S E   +   LPFIDTS+AFP
Sbjct: 398 -----------------------TDGGDGDDEGIVVSMNSPE---KNSELPFIDTSLAFP 431

Query: 466 ETK------------ADFDAFDNQMFFRDDGFNESLNIS---DDIVGAESXXXXXXXXXX 510
           E +            A+F   D Q   RD       N S   D+ + +            
Sbjct: 432 EEQDLFREQQPDNMFAEFIEHDPQ---RDTTNGNEGNTSPDQDEFLASGMVQEEPAVTTG 488

Query: 511 XL-------ISKNLVCEEVKE---HDMVIPTSDGKLLKCSEVWDRITAHPRYSDIDIDGL 560
            +       +    + +E KE    D+V+P+SDGKLLKCSEVWDRIT+HP+YSD+DIDGL
Sbjct: 489 EVKDNTNDNVKDGKIQDEGKEAPNSDVVVPSSDGKLLKCSEVWDRITSHPKYSDMDIDGL 548

Query: 561 CQELMHNAXXXXXXXXXXXXXXXXALSNHM 590
           CQELM  A                AL+N +
Sbjct: 549 CQELMAKAKCSERGVVVQAEDVQYALNNRV 578

 Score =  100 bits (250), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 98/172 (56%), Gaps = 25/172 (14%)

Query: 1   MTSVTVKRPLDESLTALSPNDNNSSILNASTDVDASTVANANKKKVG---RKLLGDHEVK 57
           M++ + KRPL+ ++          S+  A  + D S  ++  +KK G   RK L D E K
Sbjct: 1   MSTTSAKRPLEPTV----------SLDFAEDEADDSPTSDEPRKKGGKPGRKPL-DSEAK 49

Query: 58  NKRTAQNRAAQXXXXXXXXXXXXXXXXXVHELEKVKQQNDVESEFLRNQLTLMIDELKKY 117
           +KRTAQNRAAQ                 VH LE++ QQ+ VE+EFLR+QL  ++ ELK+Y
Sbjct: 50  SKRTAQNRAAQRAFRERKEKKMKELEDKVHALEELNQQSLVETEFLRSQLVTLVTELKRY 109

Query: 118 RPEKSSDIKVLEYLAKHEENGS-----------TEKIKKNIQRKEDFSFEYP 158
           RPE  +D +VL+YLAK E + S           +++I+++++RK  F+F +P
Sbjct: 110 RPENPNDSQVLQYLAKTENSKSDDSSQNKKDSESKEIEESVRRKMSFTFAFP 161

>NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.528
           YDR423C
          Length = 637

 Score =  120 bits (301), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 110/350 (31%), Positives = 155/350 (44%), Gaps = 91/350 (26%)

Query: 301 QQVSSFCVKMNQACGTKQNPVPKTMAESNKSQKTPPSEGNPST-TPNESSNDSSLSIAKF 359
           +QVS FC KM+ ACGT+ NP+PK  ++SN S  TP S  N +  +P    NDS+L+ +  
Sbjct: 320 EQVSDFCGKMSMACGTRSNPIPK--SKSNVS--TPQSIMNSNNKSPISPLNDSTLAKSNV 375

Query: 360 DDPNFLFDSPSN-------DFTNTLDIPSV----------------DSSNANSNFGQLGF 396
              + +FD  SN       + TNT  IPS                 D+SN N NFGQLGF
Sbjct: 376 ITTSNIFDHQSNTPQAINSNLTNTWGIPSASPNSNDSSPNNIVPTQDNSNVNMNFGQLGF 435

Query: 397 HGLSNDITFNSNDSNWNDFISLKTDSMTSVPTTSSVATNDHPINISKPSEENSPRKEVLP 456
             + +   F + D      +SL                   PI   K S  N  +K  LP
Sbjct: 436 --MMDSPQFQNID------LSL-------------------PIENDKFSASNF-KKPSLP 467

Query: 457 FIDTSIAFP----------------ETKADFDAFDNQMFFRDDGFNESLNISDDIVGAES 500
           FI+ ++AFP                 T    D  D    F  + ++ +++ ++ +   + 
Sbjct: 468 FINPTLAFPNDDLFNKNNSNNDNNNNTTTTHDESDLLSQFLANDYSNTISTNNLMNSDDD 527

Query: 501 XXXXXXXXXXXLISKNLVCEE-------------VKEH------DMVIPTSDGKLLKCSE 541
                      L++ NL+ EE              KE       D ++P+ DG LL+CSE
Sbjct: 528 EDEDDDDYEKKLVANNLINEEPSSTNKNNNLTSTSKEQENNDFDDFIVPSRDGGLLRCSE 587

Query: 542 VWDRITAHPRYSDIDIDGLCQELMHNAXXXXXXXXXXXXXXXXALSNHMS 591
           +WDRITAHP+YS++DIDGLC ELM  A                AL+ HMS
Sbjct: 588 IWDRITAHPKYSELDIDGLCSELMTKAKCSERGVVVNAEDVQMALTKHMS 637

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 56/93 (60%), Gaps = 3/93 (3%)

Query: 39  ANANKKKVGRKLLGDHEVKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVHELEKVKQQNDV 98
           +N N KK   K L D E +NKRTAQNRAAQ                 V  L K+++QN++
Sbjct: 62  SNGNSKK---KQLLDPEARNKRTAQNRAAQRAFRERKERKMKELEEKVANLTKIQKQNEI 118

Query: 99  ESEFLRNQLTLMIDELKKYRPEKSSDIKVLEYL 131
           ESEFLR+QL  +++ELKKY+P   +  KVL Y+
Sbjct: 119 ESEFLRSQLITLVNELKKYKPNNENASKVLNYI 151

>SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 567

 Score =  118 bits (296), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 115/390 (29%), Positives = 161/390 (41%), Gaps = 82/390 (21%)

Query: 230 NVFYKDDAQNLPHFDTSSTSTNTAFRDSPVNNSINSIKLEDNLKNNNNSALTVGYXXXXX 289
           ++FY+DDA  LP F +SS                        L+  NNS  T+       
Sbjct: 232 DMFYQDDA--LPKFTSSS------------------------LERGNNSG-TIADAGFSI 264

Query: 290 XXXXXXXXXXXQQVSSFCVKMNQACGTKQNPVPKTMAESNKSQKTPPSEGNPSTTPNESS 349
                      +QVS FC +MNQACGT+ +PVP+T++ +  S  T P     +T  + ++
Sbjct: 265 TNDFDFESHFDEQVSEFCTRMNQACGTRDSPVPQTLS-NQSSSTTTPITMTTTTRHDTAT 323

Query: 350 NDSSLSIAKFDDPNFLFDSPSN--DFTNTLDIPSVDSSNANSNFGQLGFHGLSNDITFNS 407
             +       ++PN    SP    + TNT + PS         FG LGF G  +      
Sbjct: 324 APAPAPALAPEEPNAASSSPQAGLNLTNTWETPS---------FGNLGFGGDGDSHGNGD 374

Query: 408 NDSNWNDFISLKTDSMTSVPTTSSVATNDHPINISKPSEENSPRKEVLPFIDTSIAFPET 467
              + N   S K    + +  +   A  + P N +          ++LPFIDTSIAFP  
Sbjct: 375 GHGHGNGDDSNKWLFTSDLGPSPGAAAANTPSNSA----------DILPFIDTSIAFPTE 424

Query: 468 KADFDAFDNQMFFRDDGFNESLNISDD----------IVGAESXXXXXXXXXXXLISKNL 517
           +       N++ FRD   N S  + D+          +   ES              K  
Sbjct: 425 Q-------NELVFRDTAANNSSTVFDEFLEEDPVVHQLTTEESVYDVFSNDYGAKKGKPF 477

Query: 518 VCEEVKEH----------------DMVIPTSDGKLLKCSEVWDRITAHPRYSDIDIDGLC 561
             EE K +                D V+P+ DGKLLKC E+WDRIT+HP+YSD+DIDGLC
Sbjct: 478 SPEENKGNYTTLPLSQESSNPLVSDDVVPSRDGKLLKCGEIWDRITSHPKYSDLDIDGLC 537

Query: 562 QELMHNAXXXXXXXXXXXXXXXXALSNHMS 591
            EL   A                AL+ HMS
Sbjct: 538 MELRTKAKCSEKGVVVNADDVQKALAKHMS 567

 Score =  110 bits (274), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 77/139 (55%), Gaps = 26/139 (18%)

Query: 45  KVGRKLLGDHEVKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVHELEKVKQQNDVESEFLR 104
           K GRK LG  E KNKRTAQNRAAQ                 V  LE V++QN+VE+EFLR
Sbjct: 48  KPGRKPLGT-EAKNKRTAQNRAAQRAFRERKERKMKELEDKVTHLETVREQNEVETEFLR 106

Query: 105 NQLTLMIDELKKYRPEKSSDIKVLEYLAKHEE-------------------------NGS 139
           +QL  +I ELKKYRPE+S D +VLEYLAK EE                         + S
Sbjct: 107 SQLMTLISELKKYRPEQSMDTQVLEYLAKREEEKKDNSQDRSGGSANTSEEGADVSHSSS 166

Query: 140 TEKIKKNIQRKEDFSFEYP 158
              I+ NIQ+K DF+FE+P
Sbjct: 167 ESHIRDNIQKKMDFTFEFP 185

>NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {ON}
           Anc_5.528 YDR423C
          Length = 587

 Score =  115 bits (288), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 102/332 (30%), Positives = 148/332 (44%), Gaps = 77/332 (23%)

Query: 301 QQVSSFCVKMNQACGTKQNPVPKTMAESNKSQKTPPSEGNPSTTPNESSNDSSLSIAKFD 360
           +QVS FC KMN ACGT+ +PVPK+ + ++  Q    S  +P +   + +N S+L      
Sbjct: 292 EQVSDFCGKMNMACGTRYDPVPKSKSNTSTPQNNNSSLLSPPSNSKQIANQSNL------ 345

Query: 361 DPNFLFDSPSN-DFTNTLDIPS-VDS-SNANSNFGQLGFHGLSNDITFNSNDSNWNDFIS 417
              F  ++P N + TNT D  S +DS    N  FGQLG               N   F+S
Sbjct: 346 ---FNLNTPPNLNITNTFDFNSPLDSPQQQNQAFGQLGM-------------PNSPQFLS 389

Query: 418 LKTDSMTSVPTTSSVATNDHPINISKPSEENSPRKEVLPFIDTSIAFPETKADFDAFDNQ 477
                   +PT +S+                S +   LPFI++S+AFP      D F+N 
Sbjct: 390 -----AFELPTENSIQKQPQQQQPMA-----SKKSPTLPFINSSLAFPTD----DIFNNT 435

Query: 478 MFFRDDG-------FNESLNISDDIVGAE------SXXXXXXXXXXXLISKNLVCEEVK- 523
           +   ++        FNES ++  D +  E      S           LI+KNL+ +E+  
Sbjct: 436 ISNNNNNSNTNGPLFNESSSLLSDFIRNEDGNVSDSDNDADSDFDNDLINKNLINQEISN 495

Query: 524 ------------------------EHDMVIPTSDGKLLKCSEVWDRITAHPRYSDIDIDG 559
                                   + + ++P+ DG LL+CSE+WDRI+AHP+YSD+DIDG
Sbjct: 496 PVLAPAPTSVPASTAATAAPEDEDDDEFIVPSRDGGLLRCSEIWDRISAHPKYSDLDIDG 555

Query: 560 LCQELMHNAXXXXXXXXXXXXXXXXALSNHMS 591
           LC ELM  A                AL+ HMS
Sbjct: 556 LCSELMTKAKCSERGVVVNAEDVQLALTKHMS 587

>Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007W
           (REAL)
          Length = 639

 Score =  113 bits (282), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 108/356 (30%), Positives = 152/356 (42%), Gaps = 78/356 (21%)

Query: 301 QQVSSFCVKMNQACGTKQNPVPKTMAESNKSQKTPPSEGNPSTTPNESSNDSSLSIAKFD 360
           +QVS FC KMNQ CGT+Q P+PK      K   T   E   S++   S+N  SL+     
Sbjct: 295 EQVSEFCSKMNQVCGTRQCPIPK------KPVSTLDKEVFASSSI-LSANSPSLTNTWES 347

Query: 361 DPNFLFDSPSNDFTNTLDIPSVDSSNANSNFGQLGF------HGLSND---ITFNSNDSN 411
             N   ++P+N   N     S+D+S   S+FGQLGF      H ++ND    T N N SN
Sbjct: 348 HSNITVNTPANVIGNDT---SIDTSF--SSFGQLGFGVAANHHDVNNDNTSSTGNKNGSN 402

Query: 412 WND--------FISLKTDSMTSVPTTSSVATNDHPINISKPSEENSPR--KEVLPFIDTS 461
            N         FIS     M  V         +   N++  +  N  +  K+ +PFI+ +
Sbjct: 403 KNSTNNDDVLPFISESPFDMDQVTNFFCPGPTNTINNVAASANSNFLQNSKDDIPFINAN 462

Query: 462 IAFPETKA------------DFDAFDNQMFFRDD---------------------GFNES 488
           +AFP+  +              + FD  MFFRD                      G  ++
Sbjct: 463 LAFPDENSTNIQLQPISESQSQNKFDYDMFFRDSSKEGNNLFEEFLEEDDDDDDDGNKKA 522

Query: 489 LNISDD--------IVGAESXXXXXXXXXXXLISKNLVCEEVKEHDM------VIPTSDG 534
            N SDD        ++  E                + V E +  ++       V+P+ +G
Sbjct: 523 YNTSDDESSLIKNQLINEEPQSTLKNESESAQRKDSYVQEAIDNNNGNGNDNDVVPSKEG 582

Query: 535 KLLKCSEVWDRITAHPRYSDIDIDGLCQELMHNAXXXXXXXXXXXXXXXXALSNHM 590
            LL+CSE+WDRIT HP+YSDID+DGLC ELM  A                AL+ HM
Sbjct: 583 SLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKHM 638

 Score = 97.8 bits (242), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 73/131 (55%), Gaps = 17/131 (12%)

Query: 45  KVGRKLLGDHEVKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVHELEKVKQQNDVESEFLR 104
           K  +K   D E K KRTAQNRAAQ                 V  LE ++QQN+VE+ FLR
Sbjct: 55  KTSKKQDLDPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQSLESIQQQNEVEATFLR 114

Query: 105 NQLTLMIDELKKYRPEKSSDIKVLEYLAKHEENGSTEKIK-----------------KNI 147
           +QL  +++ELKKYRPE  +D KVLEYLAK + N  +  IK                 +N+
Sbjct: 115 DQLVTLVNELKKYRPETRNDSKVLEYLAKRDPNLHSSSIKANHNNSRPIITPNDEIQENV 174

Query: 148 QRKEDFSFEYP 158
           ++K +F+F+YP
Sbjct: 175 KQKMNFTFQYP 185

>TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {ON}
           Anc_5.528 YDR423C
          Length = 466

 Score =  110 bits (276), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 89/154 (57%), Gaps = 22/154 (14%)

Query: 6   VKRPLDESLTALSPNDNNSSILNASTDVDASTVANANKKKVGRKLLGDHEVKNKRTAQNR 65
           VKRPL++S + ++P    S                    K GRK L D E KNKRTAQNR
Sbjct: 29  VKRPLEQSSSPMAPAAKGS--------------------KPGRKPL-DEETKNKRTAQNR 67

Query: 66  AAQXXXXXXXXXXXXXXXXXVHELEKVKQQNDVESEFLRNQLTLMIDELKKYRPEKSSDI 125
           AAQ                 V  LE+  +   VESEFLR+QL  +++ELKKYRP K++D+
Sbjct: 68  AAQRAFRERKEKKMKELEDKVQSLEQANRDTVVESEFLRSQLLTLVNELKKYRPAKANDL 127

Query: 126 KVLEYLAKHEENGSTEK-IKKNIQRKEDFSFEYP 158
           +VL+YLAKHE    T+K I++++Q+K DF+F +P
Sbjct: 128 QVLDYLAKHERTEPTDKEIEQSVQKKMDFTFAFP 161

 Score = 87.8 bits (216), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 56/148 (37%), Positives = 70/148 (47%), Gaps = 14/148 (9%)

Query: 450 PRKEVLPFIDTSIAFPETKADFDAFDNQMFFRDDGFNESL--NISDDIVGAESXXXXXXX 507
           P +  LPFID ++AFP         D  +FFR      SL   + D++   ++       
Sbjct: 324 PSQPELPFIDPTMAFPTDD------DEGLFFRTHRDENSLFAELLDEVEPTDNNFVNENL 377

Query: 508 XXXXLISKNLVCEEVK-----EHDMVIPTSDGKLLKCSEVWDRITAHPRYSDIDIDGLCQ 562
                 +   V EE +     E D V+P+ DGKLLKCSEVWDRIT HP+YS IDIDGLC 
Sbjct: 378 INEEPSTTTAVAEETRPKPKTETD-VVPSRDGKLLKCSEVWDRITTHPKYSAIDIDGLCG 436

Query: 563 ELMHNAXXXXXXXXXXXXXXXXALSNHM 590
           ELM  A                 L  HM
Sbjct: 437 ELMTKAKCSEKGVVVQAEDVQRVLDKHM 464

 Score = 60.1 bits (144), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 42/97 (43%), Gaps = 34/97 (35%)

Query: 226 GWMDNVFYKDDAQNLPHFDTSSTSTNTAFRDSPVNNSINSIKLEDNLKNNNNSALTVGYX 285
           GWMDNVFY DDAQ LP F     ST     D   +N  N    +D               
Sbjct: 216 GWMDNVFYSDDAQKLPQFAIKGDSTA----DPLFSNEFN---FDDQF------------- 255

Query: 286 XXXXXXXXXXXXXXXQQVSSFCVKMNQACGTKQNPVP 322
                          +QVS FC KMN+ACGT++ P+P
Sbjct: 256 --------------DEQVSQFCTKMNKACGTRECPIP 278

>KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 569

 Score =  108 bits (270), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 101/328 (30%), Positives = 123/328 (37%), Gaps = 72/328 (21%)

Query: 301 QQVSSFCVKMNQACGTKQNPVPKTMAESNKSQKTPPSEGNPSTTPNESSNDSSLSIAKFD 360
           +QVS FC +MN+ CGT++ P+P+ +  S  +  TP           E S  +   I   D
Sbjct: 277 EQVSVFCTQMNEVCGTRECPLPQALPPSTAASVTPRPISPIQEEQPELSKPAQAKIPAAD 336

Query: 361 DPNFLFDSPSNDFTNTLDIPSVDSSNANSNFGQLGFHGLSNDITFNSNDSNWNDFISLKT 420
              FL  +      N  D P          FG  GF   + D T   N   + DF S   
Sbjct: 337 --AFLKQAQQQQPPNAWDSP---------QFGHSGFGMGTEDPT---NRWLFPDFSSGNM 382

Query: 421 DSMTSVPTTSSVATNDHPINISKPSEENSPRKEVLPFIDTSIAFPETKADF------DAF 474
            S    P                     S + + +PFIDTS+AFP  + D       D  
Sbjct: 383 SSTVRAP---------------------SAKIDSVPFIDTSMAFPTDQPDALLPQNSDDV 421

Query: 475 DNQMFFRD-------------DGFNESLNIS----------------DDIVGAESXXXXX 505
            NQ F  D             D F   L  S                 D   AES     
Sbjct: 422 LNQFFEEDPIVSQLTTEESNYDPFKPDLQPSADSETSKHSVSSCSNDSDPSRAESNASTA 481

Query: 506 XXXXXXLISKNLVCEEV--KEHDMVIPTSDGKLLKCSEVWDRITAHPRYSDIDIDGLCQE 563
                  I K  V   V   E   V+P  DG LLKCSE+WDRITAHP+YSDIDIDGLC E
Sbjct: 482 LTEPNYTIDKTSVPSAVLAAEDADVVPARDGLLLKCSEIWDRITAHPKYSDIDIDGLCME 541

Query: 564 LMHNAXXXXXXXXXXXXXXXXALSNHMS 591
           L   A                AL+ HMS
Sbjct: 542 LRTKAKCSEKGVVVNSDDVQSALAKHMS 569

 Score = 99.4 bits (246), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 51/105 (48%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 45  KVGRKLLGDHEVKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVHELEKVKQQNDVESEFLR 104
           K GRK L D E KNKRTAQNRAAQ                 V  LEKV++Q+++ESEFLR
Sbjct: 24  KPGRKPL-DTEAKNKRTAQNRAAQRAFRERKERKMRELEEQVERLEKVREQSEMESEFLR 82

Query: 105 NQLTLMIDELKKYRPEKSSDIKVLEYLAKHEENGSTEKIKKNIQR 149
           +QL ++I E++KYRP++SSD +VL+YLA+ EE      ++K   R
Sbjct: 83  SQLQMLIAEIQKYRPQQSSDSQVLKYLAEAEERCKAAPVEKRTGR 127

>Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007W
           (REAL)
          Length = 645

 Score =  107 bits (267), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 114/365 (31%), Positives = 157/365 (43%), Gaps = 95/365 (26%)

Query: 301 QQVSSFCVKMNQACGTKQNPVPKTMAESNKSQKTPPSEGNPSTTPNESSNDSSLSIAKFD 360
           +QVS FC KMNQACGTKQ P+PK        +                   +S S+   +
Sbjct: 300 EQVSEFCSKMNQACGTKQCPIPKKSVHQLDKEVF-----------------ASSSVLSAN 342

Query: 361 DPNF--LFDSPSNDFTNTLDIPSVDSSNA--NSNFGQLGF-----HGLSNDITFNSND-- 409
            P     +DS SN  TNT   P+  ++N   +S+FGQ GF     H  +ND   +++D  
Sbjct: 343 SPVLTNTWDSHSNVTTNT---PANITTNGSSSSSFGQPGFDLNTNHYATNDKYTDNSDNN 399

Query: 410 --SNWND---FISLKTDSMTSVPTTSSVATNDHPINISKPSEENSPR---KEVLPFIDTS 461
             +N+ND   FIS     M  V    S  TN+     +  S   S +   K+ +PFI+TS
Sbjct: 400 KTNNYNDILPFISESPFDMNQVTNFFSPGTNNTTNANTTNSHNPSLQQSTKDDIPFINTS 459

Query: 462 IAFPE------------TKADFDAFDNQMFFRDDG------FNE---------------- 487
           +AFP+                 + FD  MFFRD        F E                
Sbjct: 460 LAFPDDNPTNIQLQPLSQSQHQNKFDYDMFFRDSSKEGNNLFEEFLEEDDDDDDDDGNDG 519

Query: 488 ------SLNISDD--------IVGAESXXXXX------XXXXXXLISKNLV-CEEVKEHD 526
                 ++N SDD        ++  E                  L +KN    E+V ++D
Sbjct: 520 NDNDGEAVNASDDESNLIKNKLINEEPQQQSQCHLSTPKNGSEVLQNKNSSNSEDVNDND 579

Query: 527 -MVIPTSDGKLLKCSEVWDRITAHPRYSDIDIDGLCQELMHNAXXXXXXXXXXXXXXXXA 585
             V+P+ +G LL+CSE+WDRIT HP+YSDID+DGLC ELM  A                A
Sbjct: 580 NEVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLA 639

Query: 586 LSNHM 590
           L+ HM
Sbjct: 640 LNKHM 644

 Score = 97.4 bits (241), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/130 (40%), Positives = 73/130 (56%), Gaps = 16/130 (12%)

Query: 45  KVGRKLLGDHEVKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVHELEKVKQQNDVESEFLR 104
           K  +K   D E K KRTAQNRAAQ                 VH LE ++Q+N+VE+ FLR
Sbjct: 55  KTSKKQDLDPETKLKRTAQNRAAQRAFRERKERKMKELEKKVHSLESIQQENEVEATFLR 114

Query: 105 NQLTLMIDELKKYRPEKSSDIKVLEYLAKHEEN----------------GSTEKIKKNIQ 148
           +QL  ++ ELKKYRPE  +D KVLEYLA+ + N                   + I+KN++
Sbjct: 115 DQLVTLVSELKKYRPETRNDSKVLEYLARRDPNLHPPNSNTNNNSEPIVTPNDDIQKNVK 174

Query: 149 RKEDFSFEYP 158
           +K +F+F+YP
Sbjct: 175 QKMNFTFQYP 184

>YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic
           leucine zipper (bZIP) transcription factor required for
           oxidative stress tolerance; activated by H2O2 through
           the multistep formation of disulfide bonds and transit
           from the cytoplasm to the nucleus; mediates resistance
           to cadmium
          Length = 650

 Score =  105 bits (262), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 101/365 (27%), Positives = 145/365 (39%), Gaps = 87/365 (23%)

Query: 301 QQVSSFCVKMNQACGTKQNPVPKTMAESNKSQKTPPSEGNPSTTPNESSNDSSLSIAKFD 360
           +QVS FC KMNQ CGT+Q P+PK    +   +    S    S +P  ++   S S     
Sbjct: 297 EQVSEFCSKMNQVCGTRQCPIPKKPISALDKEVFASSSILSSNSPALTNTWESHS----- 351

Query: 361 DPNFLFDSPSNDFTNTLDIPSVDSSNANSNFGQLGFHGLSNDITFNSNDSNWND------ 414
             N   ++P+N     +   +    N+ S FG+LGF   +N    N N +   D      
Sbjct: 352 --NITDNTPAN----VIATDATKYENSFSGFGRLGFDMSANHYVVNDNSTGSTDSTGSTG 405

Query: 415 ---------------FIS---LKTDSMTSVPTTSSVATNDHPINISKPSEENSPRKEVLP 456
                          FIS      + +T+  +  S    ++  + + PS   S  KE +P
Sbjct: 406 NKNKKNNNNSDDVLPFISESPFDMNQVTNFFSPGSTGIGNNAASNTNPSLLQS-SKEDIP 464

Query: 457 FIDTSIAFPETKA------------DFDAFDNQMFFRDDG------FNESL--------- 489
           FI+ ++AFP+  +              + FD  MFFRD        F E L         
Sbjct: 465 FINANLAFPDDNSTNIQLQPFSESQSQNKFDYDMFFRDSSKEGNNLFGEFLEDDDDDKKA 524

Query: 490 -NISDD-----------------------IVGAESXXXXXXXXXXXLISKNLVCEEVKEH 525
            N+SDD                       + G ES              K     +    
Sbjct: 525 ANMSDDESSLIKNQLINEEPELPKQYLQSVPGNESEISQKNGSSLQNADKINNGNDNDND 584

Query: 526 DMVIPTSDGKLLKCSEVWDRITAHPRYSDIDIDGLCQELMHNAXXXXXXXXXXXXXXXXA 585
           + V+P+ +G LL+CSE+WDRIT HP+YSDID+DGLC ELM  A                A
Sbjct: 585 NDVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLA 644

Query: 586 LSNHM 590
           L+ HM
Sbjct: 645 LNKHM 649

 Score = 95.5 bits (236), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 70/123 (56%), Gaps = 17/123 (13%)

Query: 53  DHEVKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVHELEKVKQQNDVESEFLRNQLTLMID 112
           D E K KRTAQNRAAQ                 V  LE ++QQN+VE+ FLR+QL  +++
Sbjct: 63  DPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQSLESIQQQNEVEATFLRDQLITLVN 122

Query: 113 ELKKYRPEKSSDIKVLEYLAKHEENGSTEK-----------------IKKNIQRKEDFSF 155
           ELKKYRPE  +D KVLEYLA+ + N    K                 I++N+++K +F+F
Sbjct: 123 ELKKYRPETRNDSKVLEYLARRDPNLHFSKNNVNHSNSEPIDTPNDDIQENVKQKMNFTF 182

Query: 156 EYP 158
           +YP
Sbjct: 183 QYP 185

>KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa]
           {ON} Anc_5.528 YDR423C
          Length = 481

 Score =  103 bits (257), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 84/305 (27%), Positives = 121/305 (39%), Gaps = 110/305 (36%)

Query: 301 QQVSSFCVKMNQACGTKQNPVPKTMAESNKSQKTPPSEGNPSTTPNESSNDSSLSIAKFD 360
           ++V+ FC+KMNQ CGT+ NP+PK       +   P +E  P                   
Sbjct: 273 EKVTDFCIKMNQVCGTRSNPIPKK-----STSNLPSTESTPL------------------ 309

Query: 361 DPNFLFDSPSNDFTNTLDIPSVDSSNANSNFGQLGFHGLSNDITFNSNDSNWNDFISLKT 420
                       FTNT D PS         FGQL    +    + NS+++N         
Sbjct: 310 ------------FTNTFDSPS---------FGQLNIQNIE---STNSDNTN--------- 336

Query: 421 DSMTSVPTTSSVATNDHPINISKPSEENSPRKEVLPFIDTSIAFPETKADFDAFDN---- 476
                              N + P +       +  F++ S+AFP + +  ++  +    
Sbjct: 337 -------------------NDTTPDDNG-----IFSFLNPSLAFPSSTSPENSLSDGSIN 372

Query: 477 ----------QMFFRDDGFNESLNISDDIVGAESXXXXXXXXXXXLISKNLVCEEVKEHD 526
                        FRD        I DD +  E+              ++L+ EE+ + +
Sbjct: 373 NNIDNNNNSSLNNFRDTS------IFDDFLKHEAEPSV----------EDLINEEIDDIN 416

Query: 527 MVIPTSDGKLLKCSEVWDRITAHPRYSDIDIDGLCQELMHNAXXXXXXXXXXXXXXXXAL 586
            V+P+ D  LL+CSEVWDRITAHP+YSDIDIDGLC ELM  A                AL
Sbjct: 417 DVVPSKDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSAL 476

Query: 587 SNHMS 591
           S H+S
Sbjct: 477 SKHLS 481

 Score = 97.1 bits (240), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 71/117 (60%), Gaps = 5/117 (4%)

Query: 42  NKKKVGRKLLGDHEVKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVHELEKVKQQNDVESE 101
           N  K  R  L D E K KRTAQNRAAQ                 V  L  +++QN++ESE
Sbjct: 33  NASKSSRTEL-DQEAKLKRTAQNRAAQRAFRERKERKMKELEAKVDHLSNIQKQNEIESE 91

Query: 102 FLRNQLTLMIDELKKYRPEKSSDIKVLEYLAKHEENGSTEKIKKNIQRKEDFSFEYP 158
           FLR+QL  ++ ELKKYRPE ++D +VL YLAKH ENG+     +N+ +K +FSF +P
Sbjct: 92  FLRSQLITLVKELKKYRPETANDSQVLNYLAKH-ENGN---FNENLSKKSNFSFAFP 144

>KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON}
           uniprot|P56095 Kluyveromyces lactis KLLA0A01760g YAP1
           AP- 1-like transcription factor
          Length = 583

 Score = 97.1 bits (240), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 96/346 (27%), Positives = 144/346 (41%), Gaps = 78/346 (22%)

Query: 301 QQVSSFCVKMNQACGTKQNPVPKTMAESNKSQKTPPSEGNPSTTPNESSNDSSLSIAKFD 360
           + VSSFC K++ ACGTK NP+PK    S     TP S        N + N ++ +  K +
Sbjct: 259 ESVSSFCSKLSMACGTKSNPIPKASPVS-----TPSSSDLLKPKSNSNVNITNHNNNKIN 313

Query: 361 DPNFLFDSPSNDFTNTLDIPSVDSSNANSN------------FGQLGFHGLSNDITFNSN 408
             +    +P +D  +   + + DS NA SN              Q   +GL ND    S+
Sbjct: 314 SKDLSSSAPLHDSASASALNNHDSVNAVSNQFSVDKQYNDSSHSQATPNGLDND----SS 369

Query: 409 DSNW------------NDFISLKTDSMTSVPTTSSVATNDHPINISKPSEE-------NS 449
            S W            +    L  DS + +        +    N + P++        N+
Sbjct: 370 VSAWQQPSFGQLGFRTDQLFDLDLDSASPITKQKDNNYSTTTNNTNSPAKADGMYWNFNT 429

Query: 450 PRKEV---------LPFIDTSIAFPETKADFDAFDNQMF--FRDDGFNESLNISDDIVGA 498
           P   +         +PFIDT +AFP+       +D+ +    +++  NE +    D + A
Sbjct: 430 PLSNMVSRNMQNPEIPFIDTGLAFPD-------YDDPLLDILKEEQENEQVEGDSDPIQA 482

Query: 499 --------------ESXXXXXXXXXXXLISKNLVCEEVKEHDMVIPTSDGKLLKCSEVWD 544
                          +           L ++  + +++      IP++DGKLLKCSEVWD
Sbjct: 483 LINEEPSMPLCHDPAANAGASVSETDKLSNQEEIVQDI------IPSNDGKLLKCSEVWD 536

Query: 545 RITAHPRYSDIDIDGLCQELMHNAXXXXXXXXXXXXXXXXALSNHM 590
           RITAHPRYSD+DIDGLC EL   A                AL +HM
Sbjct: 537 RITAHPRYSDLDIDGLCLELRTKAKCSEKGVVVNAEDVQKALISHM 582

 Score = 82.0 bits (201), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 79/138 (57%), Gaps = 5/138 (3%)

Query: 1   MTSVTVKRPLDESLTALSPNDNNSSILNASTDVDASTVANANKKKVGRKLLGDHEVKNKR 60
           M++ T KRP D    A SP+D   S  +   +  +S  +   ++K GRK L + E K+KR
Sbjct: 1   MSTSTAKRPFDNK-RAGSPDDGTDSD-SGGNNSGSSPASKRRERKPGRKPL-ETEAKDKR 57

Query: 61  TAQNRAAQXXXXXXXXXXXXXXXXXVHELEKVKQQNDVESEFLRNQLTLMIDELKKYRPE 120
           TAQNRAAQ                 V +LE + +Q+++E++FLRNQ+T ++ ELK+Y PE
Sbjct: 58  TAQNRAAQRAFRERRERKMKELEDKVSQLESLNKQSELETKFLRNQVTNLLSELKRYNPE 117

Query: 121 --KSSDIKVLEYLAKHEE 136
             K  D  +L+YLAK  +
Sbjct: 118 LPKKRDSILLDYLAKQRK 135

>KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.528
           YDR423C
          Length = 482

 Score = 96.3 bits (238), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 92/309 (29%), Positives = 119/309 (38%), Gaps = 85/309 (27%)

Query: 301 QQVSSFCVKMNQACGTKQNPVPKTMAESNKSQKTPPSEGNPSTTPNESSNDSSLSIAKFD 360
           +QVS FCV+MN+ACG+K NPVPK                        S   S  S +   
Sbjct: 241 EQVSDFCVRMNEACGSKTNPVPK------------------------SKKGSVFSNSVLS 276

Query: 361 DPNFLFDSPSNDFTNTLDIPSVDSSNANSNFGQLGFHGLSNDITFNSNDSNWNDFISLKT 420
            P+ L     N  +NT      D+ +A S          S+     +ND        LK 
Sbjct: 277 PPSLL-----NSLSNTWGTDRTDAGSATSETTSPRLTESSSSTVTTNND--------LKL 323

Query: 421 DSMTSVPTTSSVATNDHPINISKPSEENSPRKEVLPFIDTSIAFPETKADFDAFDNQMFF 480
           D+   +P           IN S            L F     A P+T       D+ +FF
Sbjct: 324 DADFEIPF----------INTS------------LAFPTDDGAVPQT------VDDNIFF 355

Query: 481 RDDGFNESLNISDDIVGAESXXXXXXXXXXXLISKNLVCEEVK---EHDMVIPTS----- 532
           RD    +   + D +   E             I  NL+  EV    E D  +P S     
Sbjct: 356 RDTQHEQRSALDDFLEEEELTDNQQQQQHEEKI--NLLINEVPFSIEADKEVPFSIEPNE 413

Query: 533 ----------DGKLLKCSEVWDRITAHPRYSDIDIDGLCQELMHNAXXXXXXXXXXXXXX 582
                     DGKLLKCSE+WDRITAHP+YSD+DIDGLC ELM  A              
Sbjct: 414 DGDPQVVPSKDGKLLKCSEIWDRITAHPKYSDLDIDGLCGELMTKAKCSERGVVVNADDV 473

Query: 583 XXALSNHMS 591
             AL+ H++
Sbjct: 474 KDALNRHIA 482

 Score = 94.7 bits (234), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 50/107 (46%), Positives = 66/107 (61%), Gaps = 1/107 (0%)

Query: 53  DHEVKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVHELEKVKQQNDVESEFLRNQLTLMID 112
           D E + KRT QNRAAQ                 V +L ++++QN+VESEFLR QL  ++ 
Sbjct: 46  DKEARMKRTEQNRAAQRAFRERKERKMKELEAKVDKLTRIQKQNEVESEFLRGQLVTLVH 105

Query: 113 ELKKYRPEKSSDIKVLEYLAKHEENGSTEKIKKNIQR-KEDFSFEYP 158
           ELKKYRPE S+D KVLEYLAKH+     ++ +    R + DFSFE+P
Sbjct: 106 ELKKYRPETSNDSKVLEYLAKHDNVPPNQQGQAPAARDRGDFSFEFP 152

>Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007W
           (REAL)
          Length = 665

 Score = 94.4 bits (233), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/122 (40%), Positives = 70/122 (57%), Gaps = 17/122 (13%)

Query: 53  DHEVKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVHELEKVKQQNDVESEFLRNQLTLMID 112
           D E K KRTAQNRAAQ                 V  LE ++QQN+VE+ FLR+QL  +++
Sbjct: 63  DPETKQKRTAQNRAAQRAFRERKERKMMELEKKVQGLENIQQQNEVEATFLRDQLVTLVN 122

Query: 113 ELKKYRPEKSSDIKVLEYLAKHEEN-----------------GSTEKIKKNIQRKEDFSF 155
           ELKKYRPE  +D KVLEYLA  + N                   +E+I++N+++K +F+F
Sbjct: 123 ELKKYRPETRNDSKVLEYLASRDPNLPTSNNSTNSSSNRPIITPSEEIQENVRQKMNFTF 182

Query: 156 EY 157
           +Y
Sbjct: 183 QY 184

 Score = 80.1 bits (196), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 32/63 (50%), Positives = 40/63 (63%)

Query: 528 VIPTSDGKLLKCSEVWDRITAHPRYSDIDIDGLCQELMHNAXXXXXXXXXXXXXXXXALS 587
           V+P+ +G LL+CSE+WDRIT HP+YSDID+DGLC ELM  A                AL+
Sbjct: 602 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALN 661

Query: 588 NHM 590
            HM
Sbjct: 662 KHM 664

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 47/96 (48%), Gaps = 16/96 (16%)

Query: 301 QQVSSFCVKMNQACGTKQNPVPKTMAESNKSQKTPPSEGNPSTTPNESSNDSSLSIAKFD 360
           +QVS FC KMNQ CGT+Q P+PK      K   T   E   S++   S+N  +L+     
Sbjct: 292 EQVSEFCSKMNQVCGTRQCPIPK------KPVSTLDQEVFASSSI-LSANSPALTNTWES 344

Query: 361 DPNFLFDSPSNDFTNTLDIPSVDSSNANSNFGQLGF 396
             N   ++P+N  TN   +         S FGQLGF
Sbjct: 345 HSNITANTPANITTNDTSL---------SGFGQLGF 371

>TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.528
           YDR423C
          Length = 608

 Score = 92.4 bits (228), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 55/128 (42%), Positives = 78/128 (60%), Gaps = 10/128 (7%)

Query: 15  TALSPNDNNSSILNASTDV-DASTVANANKK------KVGRKLLGDHEVKNKRTAQNRAA 67
           TA+ P   NSS +    D  DA+  A+A K+      KVGRKL  D E K+KRTAQNRAA
Sbjct: 4   TAVMPT--NSSTIKRHLDASDANETASATKETKKKSNKVGRKL-SDQEAKSKRTAQNRAA 60

Query: 68  QXXXXXXXXXXXXXXXXXVHELEKVKQQNDVESEFLRNQLTLMIDELKKYRPEKSSDIKV 127
           Q                 V  LE+V +++++ES+FLR+QL +++ EL++YRPE+ +D KV
Sbjct: 61  QRAFRERRERKMQELEDKVKSLEEVHKKSEIESQFLRDQLKVLLGELQRYRPERQNDAKV 120

Query: 128 LEYLAKHE 135
            EYL+ H+
Sbjct: 121 KEYLSTHK 128

 Score = 72.8 bits (177), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 29/55 (52%), Positives = 36/55 (65%)

Query: 537 LKCSEVWDRITAHPRYSDIDIDGLCQELMHNAXXXXXXXXXXXXXXXXALSNHMS 591
           ++CSEVWDRIT+HP+YSD+DIDGLC ELMH A                AL+ H+S
Sbjct: 554 MQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQKALTKHLS 608

>Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007W
           (YAP1) - jun-like transcription factor [contig 192] FULL
          Length = 584

 Score = 90.5 bits (223), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 61/92 (66%), Gaps = 1/92 (1%)

Query: 45  KVGRKLLGDHEVKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVHELEKVKQQNDVESEFLR 104
           K GRK L D E KNKRTAQNRAAQ                 V  LE+V++Q+++ESEFLR
Sbjct: 24  KPGRKPL-DTEAKNKRTAQNRAAQRAFRERKERKMRELEEQVERLERVREQSELESEFLR 82

Query: 105 NQLTLMIDELKKYRPEKSSDIKVLEYLAKHEE 136
           +QL  ++ E++KYRP +SSD +VL +LAK EE
Sbjct: 83  SQLQKLLAEIQKYRPRQSSDSQVLNFLAKAEE 114

 Score = 83.2 bits (204), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 41/66 (62%)

Query: 526 DMVIPTSDGKLLKCSEVWDRITAHPRYSDIDIDGLCQELMHNAXXXXXXXXXXXXXXXXA 585
           D V+P  DG LLKCSEVWDRIT+HP+YSDIDIDGLC EL   A                A
Sbjct: 519 DAVVPARDGTLLKCSEVWDRITSHPKYSDIDIDGLCLELRTKAKCSEKGVVVNIDDVQRA 578

Query: 586 LSNHMS 591
           L+ HMS
Sbjct: 579 LTKHMS 584

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 62/170 (36%), Gaps = 48/170 (28%)

Query: 301 QQVSSFCVKMNQACGTKQNPVPKTMAESNKSQKTPPSEGNPSTTPNESSNDSSLSIAKFD 360
           +QVS FC +MN+ CGT++ PV   +  S     T PS   P                   
Sbjct: 289 EQVSEFCTRMNEVCGTRECPVAPALPPSTAMAHTTPSSAQP------------------- 329

Query: 361 DPNFLFDSPSNDFT-----NTLDIPSVDSSNANSNFGQLGFHGLSNDITFNSNDSNWNDF 415
            P+ L   PS + +     N L   +  S      FG  GF     D T     + W  F
Sbjct: 330 QPDSLTRRPSQELSEKHLQNQLSPQAASSVWDTPQFGHSGFGSDLEDPT-----NRWM-F 383

Query: 416 ISLKTDSMTSVPTTSSVATNDHPINISKPSEENSPRKEVLPFIDTSIAFP 465
                 +   V  T+S AT D                  LPFIDTS+AFP
Sbjct: 384 AGFNAATEGGVIRTTS-ATADS-----------------LPFIDTSMAFP 415

>CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {ON}
           similar to uniprot|P19880 Saccharomyces cerevisiae
           YML007w YAP1
          Length = 588

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 35/64 (54%), Positives = 41/64 (64%)

Query: 528 VIPTSDGKLLKCSEVWDRITAHPRYSDIDIDGLCQELMHNAXXXXXXXXXXXXXXXXALS 587
           V+P+ D  LL+CSE+WDRITAHP+YSDIDIDGLC ELM  A                AL+
Sbjct: 525 VVPSRDDGLLRCSEIWDRITAHPKYSDIDIDGLCSELMAKAKCSERGVVINADDVQVALN 584

Query: 588 NHMS 591
            HMS
Sbjct: 585 KHMS 588

 Score = 79.7 bits (195), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 29  ASTDVDASTVANANKKKVGRKLLGDHEVKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVHE 88
           A  D   +  ++A++KK  ++L  D E + KR AQNRAAQ                 V +
Sbjct: 2   AEVDNGGAQKSSASRKKRYQEL--DPETRMKRVAQNRAAQKAFRERKERKMKELERKVVD 59

Query: 89  LEKVKQQNDVESEFLRNQLTLMIDELKKYRPEKSSDIKVLEYLAKHE 135
           LE + + N+VE+ FLR+QL++++ EL+KYRPE   D KVL+YL KH+
Sbjct: 60  LENLTKLNEVETNFLRDQLSILVKELRKYRPETKQDHKVLKYLEKHK 106

 Score = 66.6 bits (161), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 61/199 (30%), Positives = 90/199 (45%), Gaps = 40/199 (20%)

Query: 301 QQVSSFCVKMNQACGTKQNPVPKTMAESNKSQKTPPSEGNPSTTP---NESSNDSSLSIA 357
           +QVS FC K+NQACGTK  P+P++ + +        S GN S +P   N++  D SL++ 
Sbjct: 247 EQVSEFCTKLNQACGTKACPIPQSKSAATTPLPGTSSNGN-SNSPMIINDTMGDVSLNMQ 305

Query: 358 K----------FDDPNFLFDSPSNDFTNTLDIPSVDSSNANSNFGQLGFHG--LSNDITF 405
                        DP FL    SN + +     +  S+     FGQLGF    L NDI F
Sbjct: 306 GNEHGNATNNLVTDPAFL----SNTWDDMSPASNQHSTGGAPGFGQLGFGDNLLGNDILF 361

Query: 406 NSNDSNWNDFI--SLKTDSMTSVPTTSSVATNDHPINISKPSEENSPRKEVLPFIDTSIA 463
           + N   ++  +  S +T  +   P    V             +EN  +    PFI++S+A
Sbjct: 362 SPNSPAYSPSVLGSGRTQEVYRSPAVQKVV-----------EKENESKSVNFPFINSSLA 410

Query: 464 FPETKADFDAFDNQMFFRD 482
           FP    D+D      FFR+
Sbjct: 411 FP---GDYD----NNFFRE 422

>TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {ON}
           Anc_5.528 YDR423C
          Length = 506

 Score = 79.7 bits (195), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 37/41 (90%)

Query: 528 VIPTSDGKLLKCSEVWDRITAHPRYSDIDIDGLCQELMHNA 568
           ++P +DG+LL+C E+WDRIT +PRYSDIDIDGLC+ELM +A
Sbjct: 443 IVPLTDGRLLECGEIWDRITTYPRYSDIDIDGLCEELMASA 483

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 46/80 (57%), Gaps = 2/80 (2%)

Query: 59  KRTAQNRAAQXXXXXXXXXXXXXXXXXVHELEKVKQQNDVESEFLRNQLTLMIDELKKYR 118
           KR AQNRAAQ                 V +LE + ++N++E+ FLR QL  +++ELKKYR
Sbjct: 21  KRIAQNRAAQKAFRERKEKKMKELQEKVRKLENINEKNEIETVFLRTQLLSLVNELKKYR 80

Query: 119 PEKSSD--IKVLEYLAKHEE 136
            +K+ D  +K +    KHE+
Sbjct: 81  IDKNDDFRLKKIGSQLKHEK 100

>NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {ON}
           Anc_5.528 YDR423C
          Length = 475

 Score = 73.6 bits (179), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 61/102 (59%), Gaps = 2/102 (1%)

Query: 43  KKKVGR--KLLGDHEVKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVHELEKVKQQNDVES 100
           K++VGR  +   D   KN+RTAQNRAAQ                 + +LE++K  N+VES
Sbjct: 18  KRRVGRPGRKPLDTAAKNRRTAQNRAAQRAFRERKERKMKELEDKISDLERIKDNNEVES 77

Query: 101 EFLRNQLTLMIDELKKYRPEKSSDIKVLEYLAKHEENGSTEK 142
            FLR+ +  +I +++KYRP  S+D KVL+YL+  ++N  + K
Sbjct: 78  TFLRDYMMDLICDMQKYRPNNSTDSKVLKYLSLKKKNQPSMK 119

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 535 KLLKCSEVWDRI-TAHPRYSDIDIDGLCQELMHNA 568
           K  KCS +W R  T  P++SD DID LCQEL+  A
Sbjct: 418 KYSKCSAIWKRFKTQKPKFSDDDIDSLCQELITKA 452

>Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {ON}
           complement(45952..47379) [1428 nt, 476 aa]
          Length = 475

 Score = 72.4 bits (176), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 53/85 (62%)

Query: 53  DHEVKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVHELEKVKQQNDVESEFLRNQLTLMID 112
           D E + +RTAQNRAAQ                 V+ LE + Q+N+VE+EFLR+Q+  +++
Sbjct: 40  DAEARIRRTAQNRAAQRAFRERKEKKMKELENKVNSLENIHQKNEVETEFLRSQVLTLVN 99

Query: 113 ELKKYRPEKSSDIKVLEYLAKHEEN 137
           ELKKYR E +SD K+L+ ++   EN
Sbjct: 100 ELKKYRSETTSDSKILKLVSNSREN 124

>CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {ON}
           some similarities with uniprot|P24813 Saccharomyces
           cerevisiae YDR423c CAD1 transcriptional activator
          Length = 486

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 52/96 (54%), Gaps = 1/96 (1%)

Query: 36  STVANANKKKVGRKLLGDHEVKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVHELEKVKQQ 95
           S V+   KKK GRK++ D E KNKRTAQNRAAQ                 +  L+ +  +
Sbjct: 2   SKVSKEGKKKAGRKII-DTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSK 60

Query: 96  NDVESEFLRNQLTLMIDELKKYRPEKSSDIKVLEYL 131
            + E+E+L+  L+ ++ E+ KYRP    D  +L+ L
Sbjct: 61  KNSETEYLKECLSELLTEVTKYRPANEKDQGILKRL 96

>Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar to
           Ashbya gossypii ADR195C
          Length = 426

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 44/75 (58%), Gaps = 1/75 (1%)

Query: 45  KVGRKLLGDHEVKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVHELEKVKQQNDVESEFLR 104
           K GRK L D E KN+RTAQNRAAQ                 V +LE+ + Q++ E + LR
Sbjct: 44  KPGRKPL-DTEAKNRRTAQNRAAQRAFRERKERKMKDLEDKVRKLEEQRLQSEREVQSLR 102

Query: 105 NQLTLMIDELKKYRP 119
           NQ+  ++ ELKKYRP
Sbjct: 103 NQVVSLLRELKKYRP 117

>NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {ON}
           Anc_5.528 YDR423C
          Length = 519

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 37/47 (78%)

Query: 86  VHELEKVKQQNDVESEFLRNQLTLMIDELKKYRPEKSSDIKVLEYLA 132
           +  LEK+K +N +E+ FLR+ +T +I+E+ K+RP+ ++D K+L+YL+
Sbjct: 8   ISSLEKIKDENSIETSFLRSYMTDLINEVNKFRPKNTTDSKILKYLS 54

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 64/155 (41%), Gaps = 52/155 (33%)

Query: 454 VLPFIDTSIAFPETKADFDAFDNQ---------------MFFRDDG---FNESLNISDDI 495
           V P ID+++AFP T  + D F  +               M   DD     N+  N  D+ 
Sbjct: 354 VRPIIDSTLAFPSTMTENDLFAQRYGTMQSSSSSLSESAMQLGDDKKCTCNDQCNSDDEE 413

Query: 496 VGAESXXXXXXXXXXXLISKNLVCEE-----VKEHDM----VIPTS-----DGKLLKCSE 541
           +  E            L+S+NL+ +E     +KE       V P+        +  KCS+
Sbjct: 414 IECE------------LLSRNLLNDESMKSIIKEKQTRPSNVAPSCCNGGYGNRFAKCSK 461

Query: 542 VWDRIT--------AHPRYSDIDIDGLCQELMHNA 568
           +W+RI         + PR+ D DID LC ELM  A
Sbjct: 462 IWERINNKMNIETNSGPRFKDSDIDDLCNELMTKA 496

>TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.528
           YDR423C
          Length = 599

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 31/41 (75%), Gaps = 1/41 (2%)

Query: 528 VIPTSDGKLLKCSEVWDRITAHPRYSDIDIDGLCQELMHNA 568
           ++P +D ++L C+++WDRITA P+Y+  DI+ LC ELM  A
Sbjct: 529 MVP-ADPEMLPCTKIWDRITALPKYTSADIENLCNELMSKA 568

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 36/62 (58%)

Query: 55  EVKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVHELEKVKQQNDVESEFLRNQLTLMIDEL 114
           E+K+KRTAQNRAAQ                 V ELEKV + ++ E+ FLR+QL L   EL
Sbjct: 31  ELKSKRTAQNRAAQRAFRERKEKKMKSLEEKVVELEKVCRAHESETSFLRSQLILFGTEL 90

Query: 115 KK 116
           +K
Sbjct: 91  RK 92

>YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}
           CAD1AP-1-like basic leucine zipper (bZIP)
           transcriptional activator involved in stress responses,
           iron metabolism, and pleiotropic drug resistance;
           controls a set of genes involved in stabilizing
           proteins; binds consensus sequence TTACTAA
          Length = 409

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 55/120 (45%), Gaps = 2/120 (1%)

Query: 43  KKKVGR--KLLGDHEVKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVHELEKVKQQNDVES 100
           K+KVGR  +   D E K++RTAQNRAAQ                 V  LE+   QN   +
Sbjct: 30  KRKVGRPGRKRIDSEAKSRRTAQNRAAQRAFRDRKEAKMKSLQERVELLEQKDAQNKTTT 89

Query: 101 EFLRNQLTLMIDELKKYRPEKSSDIKVLEYLAKHEENGSTEKIKKNIQRKEDFSFEYPPP 160
           +FL   L  ++ E+ KYR + S D ++L +L   +E    E  K         + E P P
Sbjct: 90  DFLLCSLKSLLSEITKYRAKNSDDERILAFLDDLQEQQKRENEKGTSTAVSKAAKELPSP 149

 Score = 35.0 bits (79), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (64%), Gaps = 1/37 (2%)

Query: 532 SDGKLLKCSEVWDRITAHPRYSDIDIDGLCQELMHNA 568
           S+GK   C  + + I++ P+YS +DID LC EL+  A
Sbjct: 350 SNGKA-SCYHILEEISSLPKYSSLDIDDLCSELIIKA 385

>KNAG0C03210 Chr3 (631277..632431) [1155 bp, 384 aa] {ON} Anc_5.528
           YDR423C gene spans a gap in the genome sequence
          Length = 384

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 52/119 (43%), Gaps = 8/119 (6%)

Query: 38  VANANKKKVGR----KLLGDHEVKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVHELEKVK 93
            A    KKVGR    KL  D E KNKRT QNR AQ                 +  LE++ 
Sbjct: 7   AAAETAKKVGRPGRRKL--DVEAKNKRTQQNRVAQRAYRERKEAKLRTLEHKIAALERLN 64

Query: 94  QQNDVESEFLRNQLTLMIDELKKYRPEKSSDIKVLEYLAKHEENGSTEKIKKNIQRKED 152
             N+  +E +   L  ++ E  K+R EK  D  V E L   +    T  +++ ++  ED
Sbjct: 65  SYNEDRAELMAAHLRDLLGEANKFRGEKPRDKTVRELLTARDPTRDT--LRRELEAAED 121

>ADR195C Chr4 complement(1041896..1042762) [867 bp, 288 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML007W
           (YAP1) and YDR423C (CAD1)
          Length = 288

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 38/74 (51%), Gaps = 1/74 (1%)

Query: 45  KVGRKLLGDHEVKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVHELEKVKQQNDVESEFLR 104
           K GRK L D E KN+RTAQNRAAQ                 V  LE+ +   + E + LR
Sbjct: 28  KPGRKPL-DTEAKNRRTAQNRAAQRAFRERKERKMRDLEDQVRRLEEERSSAECEVQSLR 86

Query: 105 NQLTLMIDELKKYR 118
             +  ++ EL+++R
Sbjct: 87  GHVIALVRELRRWR 100

>Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1182
           bp, 393 aa] {ON} YDR423C (REAL)
          Length = 393

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 48/91 (52%), Gaps = 2/91 (2%)

Query: 43  KKKVGR--KLLGDHEVKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVHELEKVKQQNDVES 100
           K+KVGR  +   D E KN+RTAQNRAAQ                 +  LE+   QN    
Sbjct: 14  KRKVGRPGRKRVDSEAKNRRTAQNRAAQRAFRDRKEARLKSLLERIELLEQKDAQNKSVI 73

Query: 101 EFLRNQLTLMIDELKKYRPEKSSDIKVLEYL 131
           +FL++ L  ++ E+ KYR +  +D ++L +L
Sbjct: 74  DFLQSSLKSLLSEVTKYRAKNVNDERILAFL 104

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 539 CSEVWDRITAHPRYSDIDIDGLCQELMHNA 568
           C  +   I++ P+YS +DID LC ELM  A
Sbjct: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKA 369

>KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.528
           YDR423C
          Length = 265

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 48/100 (48%), Gaps = 6/100 (6%)

Query: 43  KKKVGR----KLLGDHEVKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVHELEKVKQQNDV 98
           K++VGR    KL  D + KNKRT QNR AQ                 V +L+        
Sbjct: 6   KRRVGRPGRKKL--DADAKNKRTQQNRMAQRAFRERKEAKLKLLENEVDKLQLENLSKAE 63

Query: 99  ESEFLRNQLTLMIDELKKYRPEKSSDIKVLEYLAKHEENG 138
             EFL+  +  ++ E+K YR + + D K+L+ + K E +G
Sbjct: 64  IIEFLKQNVMTLLGEIKNYRKQTNKDKKLLDTIGKLENDG 103

>Suva_2.600 Chr2
           complement(1070824..1071000,1071004..1071024,
           1071028..1071144,1071132..1071362,1071366..1071527,
           1071531..1071734,1071738..1071752,1071756..1071953,
           1071957..1071977) [1146 bp, 382 aa] {OFF} YDR423C
           (PSEUDO)
          Length = 382

 Score = 34.3 bits (77), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 539 CSEVWDRITAHPRYSDIDIDGLCQELMHNA 568
           CS +   I++ P++S +DID LC ELM  A
Sbjct: 329 CSHILRHISSIPKHSSLDIDNLCCELMVKA 358

 Score = 31.2 bits (69), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 27/59 (45%)

Query: 55  EVKNKRTAQNRAAQXXXXXXXXXXXXXXXXXVHELEKVKQQNDVESEFLRNQLTLMIDE 113
           E KN+RTAQNRAAQ                    LE    Q+ V +++L+  L  ++ E
Sbjct: 11  EAKNERTAQNRAAQQAFRNRKEDKWKQLEEKTELLESRDAQSKVATDYLQGSLRSLLLE 69

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.125    0.350 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,076,213
Number of extensions: 2927774
Number of successful extensions: 19629
Number of sequences better than 10.0: 505
Number of HSP's gapped: 19826
Number of HSP's successfully gapped: 676
Length of query: 591
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 476
Effective length of database: 40,294,809
Effective search space: 19180329084
Effective search space used: 19180329084
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 69 (31.2 bits)