Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1018.352.531ON51751723850.0
Kpol_495.20singletonON486622664e-24
TBLA0B064102.531ON449652442e-21
NCAS0J00640na 1ON102722223e-21
KAFR0A018402.531ON414592371e-20
NDAI0C06260na 1ON582642348e-20
NDAI0B030808.116ON460552282e-19
Ecym_1383na 2ON381692227e-19
NCAS0B05750singletonON505562249e-19
TPHA0A04530singletonON501592194e-18
AEL077Wna 2ON336612121e-17
KNAG0G011408.117ON519592123e-17
Skud_16.2988.116ON317582064e-17
Suva_16.3358.116ON317582055e-17
YPR013C8.116ON317582056e-17
Smik_16.2538.116ON317582056e-17
NDAI0B02080singletonON273672036e-17
Skud_16.3008.117ON249592017e-17
Smik_16.2558.117ON247592018e-17
YPR015C8.117ON247592009e-17
Ecym_8387na 3ON179571941e-16
Suva_16.3388.117ON247591972e-16
CAGL0L05786g8.116ON348662012e-16
KAFR0C031408.117ON370592013e-16
KAFR0B020008.117ON303591993e-16
NCAS0B046708.116ON266841964e-16
ZYRO0E02684g8.116ON133591875e-16
KNAG0D022808.117ON435552016e-16
NCAS0B046608.117ON256591939e-16
SAKL0H20394g8.117ON359651979e-16
KAFR0B019908.116ON410631981e-15
NCAS0C042308.117ON338581961e-15
NCAS0F009202.531ON354671961e-15
TBLA0E039308.116ON462581981e-15
SAKL0H20416g8.116ON317591942e-15
ADL051Wna 4ON173511843e-15
CAGL0J01595g8.117ON344621924e-15
ADL050Wna 3ON146541805e-15
KLLA0F20636gsingletonON285511886e-15
TDEL0F011708.116ON162581816e-15
SAKL0A09438g2.531ON441551892e-14
Ecym_8388na 4ON223571802e-14
Kwal_26.80112.531ON190601783e-14
NCAS0F00910singletonON350551853e-14
SAKL0A10582gsingletonON288631833e-14
Ecym_4128na 5ON312581834e-14
AGR186Cna 5ON287581815e-14
KNAG0D022908.116ON435521856e-14
NDAI0B019408.116ON336721826e-14
Kpol_541.398.116ON291581808e-14
KNAG0J022503.296ON296641782e-13
SAKL0D02618g3.298ON321601782e-13
KLLA0F11682g3.298ON374601792e-13
Kpol_1052.83.298ON386591774e-13
KLTH0D06798g2.531ON111621625e-13
KAFR0C003403.298ON394581765e-13
TPHA0A039103.298ON351581756e-13
Ecym_8377na 6ON310581728e-13
CAGL0M01870g3.298ON315631721e-12
Ecym_8389singletonON251511691e-12
ADL040Wna 6ON330541712e-12
Ecym_8011na 7ON276511692e-12
Kpol_1065.483.298ON364591712e-12
ADR308Cna 7ON278511682e-12
AGL207W3.298ON277641655e-12
NCAS0I014603.298ON330591676e-12
NDAI0A075403.298ON370641677e-12
SAKL0D15136gsingletonON271621638e-12
Kwal_14.22068.117ON254551629e-12
SAKL0A10648gsingletonON261601621e-11
Ecym_26733.298ON301551641e-11
TBLA0G032403.298ON511651652e-11
KLTH0C04884g3.298ON342651632e-11
Kwal_27.104673.298ON302641594e-11
KLTH0H08800g8.117ON168551534e-11
ADL042Wna 8ON281511575e-11
KLLA0A04609gsingletonON423521606e-11
KNAG0H010703.298ON322591561e-10
KAFR0H012903.298ON330551542e-10
KLLA0F22319gsingletonON203471492e-10
Ecym_8379na 8ON305511523e-10
TBLA0I020603.298ON833611537e-10
CAGL0E01331g8.326ON689651384e-08
TPHA0A058203.518ON276701354e-08
Kpol_1036.708.326ON674651385e-08
SAKL0E10714g2.162ON819561376e-08
Kwal_56.239258.326ON745651341e-07
Kpol_1050.193.518ON221531282e-07
Kpol_1003.502.303ON614581332e-07
SAKL0H20988g4.80ON548531322e-07
KNAG0D037104.80ON459711322e-07
ZYRO0B16148g2.162ON930551332e-07
TDEL0B052502.162ON714551313e-07
ACR264W2.162ON769561313e-07
Ecym_54242.162ON775561304e-07
CAGL0M06831g2.303ON645581304e-07
ZYRO0A02288g2.303ON619641304e-07
CAGL0M04323g8.326ON703641304e-07
Skud_14.3012.303ON682661304e-07
Smik_14.3032.303ON673661304e-07
TPHA0B029102.162ON717561304e-07
Suva_14.3182.303ON681661304e-07
YNL027W (CRZ1)2.303ON678661295e-07
CAGL0A01628g4.80ON424521277e-07
KAFR0B045802.162ON729561287e-07
SAKL0H15488g8.326ON798651287e-07
KLTH0E09724g2.162ON768561287e-07
Kwal_47.178882.162ON786561278e-07
Skud_7.2494.80ON502701278e-07
NDAI0G025608.326ON794631278e-07
TPHA0C008008.326ON680651279e-07
ZYRO0G20526g1.326ON849561279e-07
AGL197W8.326ON844761271e-06
Smik_7.2514.80ON505701261e-06
Suva_7.2404.80ON515601261e-06
AFR471C4.80ON389531241e-06
KLLA0E11023g4.80ON474531241e-06
KNAG0E016003.518ON338681232e-06
TBLA0B060502.303ON762641252e-06
KAFR0F036004.80ON335781232e-06
YGL035C (MIG1)4.80ON504531242e-06
NDAI0B042902.162ON1064561242e-06
TPHA0A039803.281ON314771222e-06
CAGL0L03916g2.162ON642531242e-06
TBLA0I032803.518ON330531222e-06
TPHA0O014401.326ON778751232e-06
NCAS0A018204.80ON455571223e-06
Kwal_14.22784.80ON463531223e-06
Kpol_1072.582.162ON794551233e-06
Klac_YGOB_Anc_3.5183.518ON239671193e-06
KLTH0G12254g8.326ON746651233e-06
ZYRO0E08426g3.518ON171601163e-06
KLLA0E08713g2.303ON596641223e-06
Kpol_1026.84.80ON412601213e-06
NCAS0B069602.162ON839551223e-06
KLTH0H09196g4.80ON460541214e-06
TBLA0B012802.162ON823551224e-06
Kpol_505.152.162ON510541214e-06
SAKL0F01980g3.518ON385721204e-06
Smik_15.2912.162ON909491224e-06
KLLA0F23782g2.162ON782561224e-06
TPHA0D034003.518ON338601204e-06
Skud_15.2762.162ON917491224e-06
YOR113W (AZF1)2.162ON914491224e-06
KAFR0C04550singletonON467491214e-06
Kpol_1035.221.326ON797721214e-06
Ecym_14154.80ON504531215e-06
TPHA0G008202.303ON532661215e-06
ZYRO0F10428g8.326ON813511215e-06
Kpol_344.48.326ON756661215e-06
NDAI0G058001.326ON836551215e-06
KAFR0B057408.326ON619651205e-06
KLLA0A10373gna 9ON206631165e-06
NDAI0I029003.518ON524601205e-06
TDEL0F045108.326ON743651215e-06
KAFR0H032402.303ON519661205e-06
CAGL0I02816gsingletonOFF291551185e-06
YER028C (MIG3)3.518ON394631195e-06
KNAG0I020702.162ON572551206e-06
NCAS0A091601.326ON773561207e-06
KNAG0A070402.533ON352591187e-06
TPHA0K017704.80ON518511197e-06
Kpol_1052.183.281ON357611187e-06
TPHA0G03750singletonON346601187e-06
NDAI0G007202.303ON708581197e-06
KLTH0G10802g2.303ON526641197e-06
Kpol_1050.116singletonON329531178e-06
KNAG0A051708.326ON645651198e-06
TBLA0F013001.326ON985691198e-06
Smik_10.1841.326ON885721199e-06
TBLA0A089104.80ON390511189e-06
Suva_8.1662.162ON948491191e-05
Suva_2.3078.326ON691651181e-05
Smik_4.3908.326ON708651181e-05
CAGL0K12078g3.281ON463561181e-05
Skud_5.1373.518ON394601171e-05
NCAS0B036008.326ON635651181e-05
TDEL0F026904.80ON350511161e-05
NCAS0G037302.303ON571591171e-05
Kwal_23.54007.543ON429551161e-05
KAFR0F041503.518ON416671161e-05
SAKL0E07216g2.303ON548641171e-05
KNAG0H019302.303ON618661171e-05
NCAS0E006103.518ON401601162e-05
ZYRO0G09438g4.80ON329751152e-05
Kwal_47.190453.518ON266601142e-05
Suva_6.1321.326ON878721172e-05
Skud_4.4058.326ON707651162e-05
Skud_10.1521.326ON879721162e-05
TDEL0D019501.326ON755561162e-05
TBLA0A039608.326ON850621162e-05
YJL056C (ZAP1)1.326ON880721162e-05
NCAS0F037403.518ON288571132e-05
KNAG0H034802.162ON796531152e-05
TDEL0G023302.303ON506641152e-05
YDR146C (SWI5)8.326ON709651152e-05
CAGL0J05060g1.326ON713561152e-05
CAGL0C02519g3.518ON318691133e-05
TPHA0A015408.326ON746481153e-05
Kwal_27.114602.303ON531641143e-05
Suva_5.1243.518ON406601143e-05
NDAI0J009908.326ON719661143e-05
TBLA0H012608.326ON572581134e-05
KAFR0C004903.281ON224661104e-05
KLTH0G01826g3.518ON307601124e-05
Suva_13.2062.598ON709631134e-05
KNAG0B005903.518ON439531124e-05
YMR037C (MSN2)2.598ON704631134e-05
Ecym_33412.303ON560641134e-05
Kwal_14.25431.326ON711751135e-05
KNAG0G024708.326ON736651135e-05
KAFR0I023703.518ON391631125e-05
TPHA0C041902.533ON417671125e-05
KLTH0H10538g1.326ON682561126e-05
ADL198W2.303ON547641116e-05
Kpol_423.153.518ON392531106e-05
KLLA0D16456g8.326ON854581117e-05
TDEL0D058603.518ON330741107e-05
Smik_13.2072.598ON703631118e-05
Smik_5.1513.518ON388661108e-05
KLLA0F18524g3.281ON357711098e-05
KLLA0E18547g2.533ON431531108e-05
KNAG0E026101.326ON746581118e-05
Suva_7.523.518ON400601099e-05
NDAI0D037504.80ON493511101e-04
YGL209W (MIG2)3.518ON382601091e-04
Skud_7.593.518ON383601091e-04
KLLA0F01463g1.326ON781531091e-04
Smik_7.543.518ON382601081e-04
NCAS0E00170na 10ON327641081e-04
SAKL0D06776g1.326ON767561091e-04
Kpol_489.4na 10ON339621081e-04
NCAS0A129102.598ON822581091e-04
ZYRO0C13508g3.281ON189671041e-04
TPHA0M011803.281ON350841071e-04
TPHA0G035102.533ON387571072e-04
CAGL0K09372g3.518ON396621072e-04
KAFR0H022408.326ON623511072e-04
NCAS0C032408.326ON620511072e-04
SAKL0F16170g7.543ON437571062e-04
AGR031W3.281ON14061993e-04
KAFR0B063608.425ON627551063e-04
YPR186C (PZF1)7.543ON429561053e-04
Skud_13.1932.598ON704561063e-04
TBLA0C048803.518ON339641043e-04
KAFR0J02980singletonON319621044e-04
KLLA0F26961g2.598ON694621054e-04
AEL174W1.326ON661601054e-04
Suva_2.2003.281ON232731024e-04
KAFR0A008001.326ON753531054e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1018.35
         (517 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON} (1186...   923   0.0  
Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON} (65876..6...   107   4e-24
TBLA0B06410 Chr2 (1511970..1513319) [1350 bp, 449 aa] {ON} Anc_2...    99   2e-21
NCAS0J00640 Chr10 complement(98043..98351) [309 bp, 102 aa] {ON}       90   3e-21
KAFR0A01840 Chr1 complement(379714..380958) [1245 bp, 414 aa] {O...    96   1e-20
NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON}             95   8e-20
NDAI0B03080 Chr2 complement(785326..786708) [1383 bp, 460 aa] {O...    92   2e-19
Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}...    90   7e-19
NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa] ...    91   9e-19
TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON}             89   4e-18
AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; N...    86   1e-17
KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {O...    86   3e-17
Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {O...    84   4e-17
Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {O...    84   5e-17
YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON} P...    84   6e-17
Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {O...    84   6e-17
NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON}                83   6e-17
Skud_16.300 Chr16 complement(554576..555325) [750 bp, 249 aa] {O...    82   7e-17
Smik_16.255 Chr16 complement(465909..466652) [744 bp, 247 aa] {O...    82   8e-17
YPR015C Chr16 complement(590283..591026) [744 bp, 247 aa] {ON} P...    82   9e-17
Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON} ...    79   1e-16
Suva_16.338 Chr16 complement(594847..595590) [744 bp, 247 aa] {O...    80   2e-16
CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa] ...    82   2e-16
KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON}               82   3e-16
KAFR0B02000 Chr2 complement(392263..393174) [912 bp, 303 aa] {ON...    81   3e-16
NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON}                80   4e-16
ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly ...    77   5e-16
KNAG0D02280 Chr4 (393332..394639) [1308 bp, 435 aa] {ON}               82   6e-16
NCAS0B04660 Chr2 (850607..851377) [771 bp, 256 aa] {ON}                79   9e-16
SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weak...    80   9e-16
KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {O...    81   1e-15
NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON}               80   1e-15
NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531     80   1e-15
TBLA0E03930 Chr5 complement(990944..992332) [1389 bp, 462 aa] {O...    81   1e-15
SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakl...    79   2e-15
ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No...    75   3e-15
CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some ...    79   4e-15
ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No...    74   5e-15
KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa] ...    77   6e-15
TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.11...    74   6e-15
SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {...    77   2e-14
Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON} ...    74   2e-14
Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON...    73   3e-14
NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON}               76   3e-14
SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {O...    75   3e-14
Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to...    75   4e-14
AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON} ...    74   5e-14
KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {O...    76   6e-14
NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {O...    75   6e-14
Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON...    74   8e-14
KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON}               73   2e-13
SAKL0D02618g Chr4 complement(208093..209058) [966 bp, 321 aa] {O...    73   2e-13
KLLA0F11682g Chr6 complement(1068992..1070116) [1125 bp, 374 aa]...    74   2e-13
Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON...    73   4e-13
KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {O...    67   5e-13
KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}...    72   5e-13
TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {O...    72   6e-13
Ecym_8377 Chr8 complement(764541..765473) [933 bp, 310 aa] {ON} ...    71   8e-13
CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {...    71   1e-12
Ecym_8389 Chr8 (797626..798381) [756 bp, 251 aa] {ON} similar to...    70   1e-12
ADL040W Chr4 (618852..619844) [993 bp, 330 aa] {ON} Syntenic hom...    70   2e-12
Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON} si...    70   2e-12
Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa] ...    70   2e-12
ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON} ...    69   2e-12
AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No...    68   5e-12
NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON...    69   6e-12
NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON} Anc_3...    69   7e-12
SAKL0D15136g Chr4 (1255926..1256741) [816 bp, 271 aa] {ON} some ...    67   8e-12
Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C ...    67   9e-12
SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some si...    67   1e-11
Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON...    68   1e-11
TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298     68   2e-11
KLTH0C04884g Chr3 complement(422344..423372) [1029 bp, 342 aa] {...    67   2e-11
Kwal_27.10467 s27 complement(354071..354979) [909 bp, 302 aa] {O...    66   4e-11
KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some si...    64   4e-11
ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic hom...    65   5e-11
KLLA0A04609g Chr1 complement(411494..412765) [1272 bp, 423 aa] {...    66   6e-11
KNAG0H01070 Chr8 complement(178080..179048) [969 bp, 322 aa] {ON...    65   1e-10
KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON...    64   2e-10
KLLA0F22319g Chr6 complement(2086613..2087224) [612 bp, 203 aa] ...    62   2e-10
Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON} ...    63   3e-10
TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298     64   7e-10
CAGL0E01331g Chr5 (124599..126668) [2070 bp, 689 aa] {ON} some s...    58   4e-08
TPHA0A05820 Chr1 complement(1319614..1320444) [831 bp, 276 aa] {...    57   4e-08
Kpol_1036.70 s1036 complement(192400..194424) [2025 bp, 674 aa] ...    58   5e-08
SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly...    57   6e-08
Kwal_56.23925 s56 complement(779625..781862) [2238 bp, 745 aa] {...    56   1e-07
Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON...    54   2e-07
Kpol_1003.50 s1003 (114648..116492) [1845 bp, 614 aa] {ON} (1146...    56   2e-07
SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]...    55   2e-07
KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.8...    55   2e-07
ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weak...    56   2e-07
TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {O...    55   3e-07
ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic ho...    55   3e-07
Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar t...    55   4e-07
CAGL0M06831g Chr13 (695162..697099) [1938 bp, 645 aa] {ON} weakl...    55   4e-07
ZYRO0A02288g Chr1 (181918..183777) [1860 bp, 619 aa] {ON} simila...    55   4e-07
CAGL0M04323g Chr13 complement(474158..476269) [2112 bp, 703 aa] ...    55   4e-07
Skud_14.301 Chr14 (550283..552331) [2049 bp, 682 aa] {ON} YNL027...    55   4e-07
Smik_14.303 Chr14 (542116..544137) [2022 bp, 673 aa] {ON} YNL027...    55   4e-07
TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {O...    55   4e-07
Suva_14.318 Chr14 (561697..562047,562519..564213) [2046 bp, 681 ...    55   4e-07
YNL027W Chr14 (579580..581616) [2037 bp, 678 aa] {ON}  CRZ1Trans...    54   5e-07
CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} simila...    54   7e-07
KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.1...    54   7e-07
SAKL0H15488g Chr8 (1347432..1349828) [2397 bp, 798 aa] {ON} simi...    54   7e-07
KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly...    54   7e-07
Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113...    54   8e-07
Skud_7.249 Chr7 complement(434181..435689) [1509 bp, 502 aa] {ON...    54   8e-07
NDAI0G02560 Chr7 (585170..587554) [2385 bp, 794 aa] {ON} Anc_8.326     54   8e-07
TPHA0C00800 Chr3 (156349..158391) [2043 bp, 680 aa] {ON} Anc_8.3...    54   9e-07
ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weak...    54   9e-07
AGL197W Chr7 (325717..328251) [2535 bp, 844 aa] {ON} Syntenic ho...    54   1e-06
Smik_7.251 Chr7 complement(423105..424622) [1518 bp, 505 aa] {ON...    53   1e-06
Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 ...    53   1e-06
AFR471C Chr6 complement(1287518..1288687) [1170 bp, 389 aa] {ON}...    52   1e-06
KLLA0E11023g Chr5 (966805..968229) [1425 bp, 474 aa] {ON} unipro...    52   1e-06
KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {O...    52   2e-06
TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON} Anc_2...    53   2e-06
KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.8...    52   2e-06
YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}  ...    52   2e-06
NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON} Anc_...    52   2e-06
TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.28...    52   2e-06
CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa] ...    52   2e-06
TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON...    52   2e-06
TPHA0O01440 Chr15 (289051..291387) [2337 bp, 778 aa] {ON} Anc_1....    52   2e-06
NCAS0A01820 Chr1 (351123..352490) [1368 bp, 455 aa] {ON} Anc_4.80      52   3e-06
Kwal_14.2278 s14 complement(686159..687550) [1392 bp, 463 aa] {O...    52   3e-06
Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa] ...    52   3e-06
Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 a...    50   3e-06
KLTH0G12254g Chr7 (1040230..1042470) [2241 bp, 746 aa] {ON} weak...    52   3e-06
ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {O...    49   3e-06
KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some s...    52   3e-06
Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa] ...    51   3e-06
NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON} Anc_2...    52   3e-06
KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {...    51   4e-06
TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {O...    52   4e-06
Kpol_505.15 s505 (42259..43791) [1533 bp, 510 aa] {ON} (42259..4...    51   4e-06
SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some s...    51   4e-06
Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113...    52   4e-06
KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weak...    52   4e-06
TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {O...    51   4e-06
Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113...    52   4e-06
YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}  AZF1Zinc-...    52   4e-06
KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON}               51   4e-06
Kpol_1035.22 s1035 (53205..55598) [2394 bp, 797 aa] {ON} (53205....    51   4e-06
Ecym_1415 Chr1 complement(863049..864563) [1515 bp, 504 aa] {ON}...    51   5e-06
TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.3...    51   5e-06
ZYRO0F10428g Chr6 complement(846822..849263) [2442 bp, 813 aa] {...    51   5e-06
Kpol_344.4 s344 complement(5351..7621) [2271 bp, 756 aa] {ON} co...    51   5e-06
NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa] ...    51   5e-06
KAFR0B05740 Chr2 complement(1184382..1186241) [1860 bp, 619 aa] ...    51   5e-06
KLLA0A10373g Chr1 complement(907244..907864) [621 bp, 206 aa] {O...    49   5e-06
NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {O...    51   5e-06
TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {O...    51   5e-06
KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.3...    51   5e-06
CAGL0I02816g Chr9 complement(247817..248692) [876 bp, 291 aa] {O...    50   5e-06
YER028C Chr5 complement(210692..211876) [1185 bp, 394 aa] {ON}  ...    50   5e-06
KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.1...    51   6e-06
NCAS0A09160 Chr1 (1811448..1813769) [2322 bp, 773 aa] {ON} Anc_1...    51   7e-06
KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON} Anc_2...    50   7e-06
TPHA0K01770 Chr11 (374701..376257) [1557 bp, 518 aa] {ON} Anc_4....    50   7e-06
Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON} (58087....    50   7e-06
TPHA0G03750 Chr7 complement(794102..795142) [1041 bp, 346 aa] {O...    50   7e-06
NDAI0G00720 Chr7 complement(155060..157186) [2127 bp, 708 aa] {O...    50   7e-06
KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some s...    50   7e-06
Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa] ...    50   8e-06
KNAG0A05170 Chr1 (761499..763436) [1938 bp, 645 aa] {ON} Anc_8.3...    50   8e-06
TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.3...    50   8e-06
Smik_10.184 Chr10 complement(322050..324707) [2658 bp, 885 aa] {...    50   9e-06
TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa] ...    50   9e-06
Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W ...    50   1e-05
Suva_2.307 Chr2 complement(544040..546115) [2076 bp, 691 aa] {ON...    50   1e-05
Smik_4.390 Chr4 complement(709330..711456) [2127 bp, 708 aa] {ON...    50   1e-05
CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa...    50   1e-05
Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON...    50   1e-05
NCAS0B03600 Chr2 complement(637749..639656) [1908 bp, 635 aa] {O...    50   1e-05
TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.8...    49   1e-05
NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303     50   1e-05
Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa] ...    49   1e-05
KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {O...    49   1e-05
SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {...    50   1e-05
KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.3...    50   1e-05
NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518     49   2e-05
ZYRO0G09438g Chr7 complement(752797..753786) [990 bp, 329 aa] {O...    49   2e-05
Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa] ...    49   2e-05
Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C ...    50   2e-05
Skud_4.405 Chr4 complement(720227..722350) [2124 bp, 707 aa] {ON...    49   2e-05
Skud_10.152 Chr10 (285800..288439) [2640 bp, 879 aa] {ON} YJL056...    49   2e-05
TDEL0D01950 Chr4 complement(377508..379775) [2268 bp, 755 aa] {O...    49   2e-05
TBLA0A03960 Chr1 complement(989886..992438) [2553 bp, 850 aa] {O...    49   2e-05
YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON} ...    49   2e-05
NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON...    48   2e-05
KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.1...    49   2e-05
TDEL0G02330 Chr7 (449585..451105) [1521 bp, 506 aa] {ON} Anc_2.3...    49   2e-05
YDR146C Chr4 complement(748613..750742) [2130 bp, 709 aa] {ON}  ...    49   2e-05
CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} simil...    49   2e-05
CAGL0C02519g Chr3 (253051..254007) [957 bp, 318 aa] {ON} some si...    48   3e-05
TPHA0A01540 Chr1 (306674..308914) [2241 bp, 746 aa] {ON} Anc_8.3...    49   3e-05
Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {...    49   3e-05
Suva_5.124 Chr5 complement(186591..187811) [1221 bp, 406 aa] {ON...    49   3e-05
NDAI0J00990 Chr10 (226704..228863) [2160 bp, 719 aa] {ON} Anc_8....    49   3e-05
TBLA0H01260 Chr8 (283947..285665) [1719 bp, 572 aa] {ON} Anc_8.3...    48   4e-05
KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON} ...    47   4e-05
KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some si...    48   4e-05
Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {...    48   4e-05
KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518...    48   4e-05
YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON} ...    48   4e-05
Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar t...    48   4e-05
Kwal_14.2543 s14 (807668..809803) [2136 bp, 711 aa] {ON} YJL056C...    48   5e-05
KNAG0G02470 Chr7 complement(562235..564445) [2211 bp, 736 aa] {O...    48   5e-05
KAFR0I02370 Chr9 (480591..481766) [1176 bp, 391 aa] {ON} Anc_3.5...    48   5e-05
TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.5...    48   5e-05
KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly...    48   6e-05
ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic ho...    47   6e-05
Kpol_423.15 s423 (33422..34600) [1179 bp, 392 aa] {ON} (33422..3...    47   6e-05
KLLA0D16456g Chr4 complement(1387846..1390410) [2565 bp, 854 aa]...    47   7e-05
TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {...    47   7e-05
Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {...    47   8e-05
Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON...    47   8e-05
KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]...    47   8e-05
KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]...    47   8e-05
KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {O...    47   8e-05
Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)    47   9e-05
NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80      47   1e-04
YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc fin...    47   1e-04
Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W (...    47   1e-04
KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some s...    47   1e-04
Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)    46   1e-04
NCAS0E00170 Chr5 (20556..21539) [984 bp, 327 aa] {ON}                  46   1e-04
SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly...    47   1e-04
Kpol_489.4 s489 (17106..18125) [1020 bp, 339 aa] {ON} (17106..18...    46   1e-04
NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa] ...    47   1e-04
ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa] ...    45   1e-04
TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {...    46   1e-04
TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.5...    46   2e-04
CAGL0K09372g Chr11 complement(925647..926837) [1191 bp, 396 aa] ...    46   2e-04
KAFR0H02240 Chr8 (426388..428259) [1872 bp, 623 aa] {ON} Anc_8.3...    46   2e-04
NCAS0C03240 Chr3 (636172..638034) [1863 bp, 620 aa] {ON} Anc_8.326     46   2e-04
SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]...    45   2e-04
AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic hom...    43   3e-04
KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON} Anc_8...    45   3e-04
YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON} ...    45   3e-04
Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {...    45   3e-04
TBLA0C04880 Chr3 complement(1187913..1188932) [1020 bp, 339 aa] ...    45   3e-04
KAFR0J02980 Chr10 complement(567857..568816) [960 bp, 319 aa] {O...    45   4e-04
KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weak...    45   4e-04
AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic ho...    45   4e-04
Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}...    44   4e-04
KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {O...    45   4e-04
KLLA0B03454g Chr2 complement(314015..315433) [1419 bp, 472 aa] {...    45   4e-04
Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}...    44   4e-04
Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}...    45   4e-04
SAKL0F00242g Chr6 (16275..17150) [876 bp, 291 aa] {ON} similar t...    44   4e-04
SAKL0B12672g Chr2 complement(1096894..1097751) [858 bp, 285 aa] ...    44   5e-04
YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}  MSN4Trans...    45   5e-04
SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {...    45   5e-04
Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062...    45   5e-04
Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062...    45   5e-04
AEL278W Chr5 (117043..118473) [1431 bp, 476 aa] {ON} Syntenic ho...    44   5e-04
YLR131C Chr12 complement(404510..406822) [2313 bp, 770 aa] {ON} ...    45   6e-04
Smik_12.194 Chr12 complement(385837..388146) [2310 bp, 769 aa] {...    44   6e-04
Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {O...    44   7e-04
YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}  N...    43   7e-04
TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.53...    43   8e-04
TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa] ...    44   8e-04
ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON} S...    44   9e-04
Skud_12.200 Chr12 complement(387195..389498) [2304 bp, 767 aa] {...    44   9e-04
Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {...    44   9e-04
TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.28...    42   0.001
CAGL0H07557g Chr8 (738086..739516) [1431 bp, 476 aa] {ON} some s...    44   0.001
SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some s...    44   0.001
NDAI0I03330 Chr9 complement(781013..782065) [1053 bp, 350 aa] {O...    43   0.001
SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {O...    42   0.001
Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}...    42   0.001
Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON} (43237.....    42   0.001
NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.1...    44   0.001
YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbo...    44   0.001
NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3....    43   0.001
AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON} S...    43   0.001
KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {...    44   0.001
Smik_7.7 Chr7 (16965..17897) [933 bp, 310 aa] {ON} YGL254W (REAL)      43   0.001
Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W...    44   0.001
Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W...    44   0.001
KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON...    42   0.001
TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.5...    43   0.001
ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar ...    43   0.001
CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa...    43   0.001
Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {...    43   0.001
Kwal_27.10167 s27 (225940..226797) [858 bp, 285 aa] {ON} YGL254W...    42   0.002
KLTH0A00682g Chr1 (69084..70385) [1302 bp, 433 aa] {ON} similar ...    43   0.002
KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {O...    42   0.002
NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598     43   0.002
TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.1...    43   0.002
KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.5...    43   0.002
ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some si...    42   0.002
Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}...    43   0.002
TBLA0B04960 Chr2 complement(1167778..1169124) [1347 bp, 448 aa] ...    43   0.002
NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281      42   0.002
Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {O...    43   0.002
KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.1...    42   0.002
KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598...    43   0.002
Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W...    43   0.002
KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON}       42   0.002
KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.28...    42   0.002
KNAG0I00130 Chr9 (10977..11972) [996 bp, 331 aa] {ON}                  42   0.002
Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON} co...    42   0.002
Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W...    42   0.003
Skud_2.189 Chr2 complement(338427..339089) [663 bp, 220 aa] {ON}...    41   0.003
Suva_10.224 Chr10 complement(413051..415345) [2295 bp, 764 aa] {...    42   0.003
NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {...    42   0.003
TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {O...    42   0.003
CAGL0K02343g Chr11 (209474..212962) [3489 bp, 1162 aa] {ON} simi...    42   0.003
Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {...    42   0.003
Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar t...    42   0.003
NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {O...    42   0.003
Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {O...    42   0.003
KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {O...    42   0.004
NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {O...    42   0.004
TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543...    42   0.004
Skud_7.13 Chr7 (26414..27304) [891 bp, 296 aa] {ON} YGL254W (REAL)     41   0.004
TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.53...    41   0.004
NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa] ...    42   0.004
TBLA0I01970 Chr9 complement(446033..446899) [867 bp, 288 aa] {ON...    41   0.005
NCAS0A10650 Chr1 complement(2121866..2122747) [882 bp, 293 aa] {...    41   0.005
AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON} ...    42   0.005
TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {O...    41   0.005
NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144      41   0.006
CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some s...    41   0.006
CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {...    41   0.006
KLLA0F07073g Chr6 (675221..676897) [1677 bp, 558 aa] {ON} some s...    41   0.006
Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062...    41   0.007
CAGL0L07480g Chr12 complement(824237..825181) [945 bp, 314 aa] {...    40   0.007
Suva_4.305 Chr4 complement(536954..537616) [663 bp, 220 aa] {ON}...    40   0.007
Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar ...    40   0.007
SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa...    41   0.008
TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4....    41   0.009
KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {...    40   0.010
Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {O...    40   0.010
Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C ...    40   0.010
Ecym_2817 Chr2 complement(1587029..1588324) [1296 bp, 431 aa] {O...    40   0.010
NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {...    40   0.011
NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {...    40   0.011
NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598     40   0.012
TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {...    40   0.012
KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly...    40   0.013
KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {...    40   0.013
KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} simil...    40   0.014
Suva_7.7 Chr7 (16721..17614) [894 bp, 297 aa] {ON} YGL254W (REAL)      40   0.014
KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some s...    40   0.015
YBR066C Chr2 complement(370037..370699) [663 bp, 220 aa] {ON}  N...    39   0.015
Kpol_1050.109 s1050 complement(246366..247520) [1155 bp, 384 aa]...    40   0.017
YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}  MOT3Trans...    40   0.018
TDEL0H00280 Chr8 (38901..40175) [1275 bp, 424 aa] {ON} Anc_7.543...    39   0.018
Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070...    39   0.019
CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {...    39   0.019
Smik_2.199 Chr2 complement(351916..352578) [663 bp, 220 aa] {ON}...    38   0.024
Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON...    39   0.025
KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]...    39   0.025
CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {...    39   0.025
NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {O...    39   0.025
NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa] ...    39   0.026
Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON...    39   0.026
TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.2...    39   0.027
TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.35...    39   0.028
YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON} P...    39   0.029
SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]...    39   0.030
CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} simil...    39   0.030
NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {O...    39   0.033
TDEL0F01030 Chr6 (182054..185287) [3234 bp, 1077 aa] {ON} Anc_8....    39   0.035
NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {O...    39   0.040
TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144...    39   0.041
KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa] ...    39   0.042
KNAG0D02220 Chr4 (378969..382589) [3621 bp, 1206 aa] {ON} Anc_8....    39   0.045
CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakl...    38   0.047
TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]...    39   0.051
Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..71...    38   0.055
Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 ...    38   0.056
NCAS0A15270 Chr1 complement(3003516..3004817) [1302 bp, 433 aa] ...    38   0.059
Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)...    38   0.061
YGL254W Chr7 (22304..23203) [900 bp, 299 aa] {ON}  FZF1Transcrip...    37   0.062
KAFR0B00280 Chr2 (65006..66256) [1251 bp, 416 aa] {ON} Anc_7.543...    38   0.063
NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]...    38   0.067
CAGL0G10021g Chr7 complement(959154..960338) [1185 bp, 394 aa] {...    37   0.072
TDEL0G01700 Chr7 complement(334394..335848) [1455 bp, 484 aa] {O...    38   0.075
ZYRO0D00902g Chr4 (68162..69379) [1218 bp, 405 aa] {ON} similar ...    37   0.075
KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.5...    37   0.080
Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}...    37   0.084
Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130...    37   0.084
Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {O...    38   0.091
KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON} sim...    37   0.092
YPL038W Chr16 (480535..481068) [534 bp, 177 aa] {ON}  MET31Zinc-...    36   0.095
Skud_16.243 Chr16 (445581..446114) [534 bp, 177 aa] {ON} YPL038W...    36   0.10 
CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} simila...    37   0.10 
ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic ho...    37   0.11 
SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa...    37   0.13 
Skud_10.351 Chr10 complement(617553..621332,621389..621469,62146...    37   0.13 
Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa] ...    37   0.13 
ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} simil...    37   0.13 
YJR127C Chr10 complement(658917..663059) [4143 bp, 1380 aa] {ON}...    37   0.13 
Kwal_55.20634 s55 (498959..500218) [1260 bp, 419 aa] {ON} YHL027...    37   0.14 
TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON} Anc_...    37   0.14 
KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {...    37   0.14 
KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.14...    36   0.14 
Smik_10.420 Chr10 complement(647997..651776,651798..651836,65184...    37   0.14 
NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144     37   0.14 
NCAS0A02310 Chr1 complement(433632..436271) [2640 bp, 879 aa] {O...    37   0.15 
Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W...    37   0.16 
Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa] ...    36   0.16 
KNAG0F03980 Chr6 complement(754914..756041) [1128 bp, 375 aa] {O...    36   0.16 
Smik_16.197 Chr16 (357835..358350) [516 bp, 171 aa] {ON} YPL038W...    35   0.17 
Suva_16.278 Chr16 (483789..484316) [528 bp, 175 aa] {ON} YPL038W...    35   0.18 
KLTH0E03124g Chr5 complement(280411..283056) [2646 bp, 881 aa] {...    37   0.18 
Kwal_47.16577 s47 complement(9960..12605) [2646 bp, 881 aa] {ON}...    37   0.18 
KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {O...    36   0.19 
TBLA0A08460 Chr1 (2080390..2082015) [1626 bp, 541 aa] {ON} Anc_4...    36   0.19 
Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W...    36   0.19 
Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081...    36   0.21 
TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {O...    36   0.22 
NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON} Anc_...    36   0.22 
KAFR0A03500 Chr1 (718961..719914) [954 bp, 317 aa] {ON} Anc_1.27...    36   0.23 
Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar t...    36   0.23 
KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {O...    36   0.24 
KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} wea...    36   0.25 
KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {O...    35   0.25 
KAFR0B02050 Chr2 complement(402767..405958) [3192 bp, 1063 aa] {...    36   0.26 
TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.14...    35   0.26 
Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081...    36   0.27 
KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weak...    36   0.27 
ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some s...    36   0.31 
TBLA0C01990 Chr3 complement(466321..467190) [870 bp, 289 aa] {ON...    35   0.32 
KLLA0E13487g Chr5 complement(1190615..1191307) [693 bp, 230 aa] ...    35   0.34 
YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}  TDA9DNA-...    36   0.36 
KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.3...    35   0.37 
Kpol_472.3 s472 complement(4365..5300) [936 bp, 311 aa] {ON} com...    35   0.37 
KNAG0D04480 Chr4 (810336..813578) [3243 bp, 1080 aa] {ON} Anc_4....    35   0.38 
TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.5...    35   0.39 
ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa...    35   0.39 
TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {...    35   0.40 
Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON...    35   0.42 
ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]...    35   0.43 
Suva_16.349 Chr16 complement(610937..612562) [1626 bp, 541 aa] {...    35   0.44 
YPR022C Chr16 complement(603911..607312) [3402 bp, 1133 aa] {ON}...    35   0.44 
TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {...    35   0.46 
Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON} (235...    35   0.46 
AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}...    35   0.50 
Suva_1.89 Chr1 complement(157170..157334) [165 bp, 55 aa] {ON} Y...    32   0.51 
KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]...    35   0.57 
AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic...    35   0.59 
KAFR0I01440 Chr9 complement(300092..301702) [1611 bp, 536 aa] {O...    35   0.61 
Smik_16.263 Chr16 complement(479612..482980) [3369 bp, 1122 aa] ...    35   0.61 
NDAI0J02060 Chr10 (505150..506619) [1470 bp, 489 aa] {ON} Anc_4....    35   0.62 
Skud_16.307 Chr16 complement(568219..570672,570703..571623) [337...    35   0.63 
AFR588W Chr6 (1496952..1497911) [960 bp, 319 aa] {ON} Syntenic h...    34   0.68 
Ecym_2768 Chr2 (1495608..1496903) [1296 bp, 431 aa] {ON} similar...    34   0.68 
NDAI0J00160 Chr10 (19695..21068) [1374 bp, 457 aa] {ON} Anc_7.543      34   0.69 
Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON...    35   0.69 
KLTH0E05962g Chr5 (539474..540739) [1266 bp, 421 aa] {ON} weakly...    34   0.71 
KNAG0D04190 Chr4 complement(754846..757878) [3033 bp, 1010 aa] {...    35   0.72 
SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some s...    35   0.74 
NDAI0D04240 Chr4 complement(993054..996563) [3510 bp, 1169 aa] {...    35   0.74 
CAGL0E03762g Chr5 complement(351240..352994) [1755 bp, 584 aa] {...    34   0.75 
Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W (...    34   0.75 
KLLA0E00793g Chr5 (80516..82069) [1554 bp, 517 aa] {ON} weakly s...    34   0.79 
Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {O...    33   0.85 
NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {...    34   0.85 
Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {O...    33   0.88 
TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON} Anc_...    34   0.90 
Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {O...    33   0.93 
TBLA0I02770 Chr9 (650889..652730) [1842 bp, 613 aa] {ON} Anc_4.2...    34   0.99 
TBLA0A08200 Chr1 complement(2024809..2025861) [1053 bp, 350 aa] ...    34   1.0  
KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some s...    34   1.1  
CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa] ...    34   1.1  
Skud_8.17 Chr8 (39078..40961) [1884 bp, 627 aa] {ON} YHL027W (REAL)    34   1.2  
Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {O...    34   1.2  
SAKL0H24464g Chr8 complement(2118553..2121405) [2853 bp, 950 aa]...    34   1.2  
NDAI0H00300 Chr8 (52362..54269) [1908 bp, 635 aa] {ON}                 33   1.4  
Ecym_6216 Chr6 (406161..407630) [1470 bp, 489 aa] {ON} similar t...    33   1.4  
NDAI0F01400 Chr6 (347938..349122) [1185 bp, 394 aa] {ON} Anc_6.256     33   1.5  
NCAS0J02140 Chr10 complement(410960..415012) [4053 bp, 1350 aa] ...    33   1.5  
NCAS0B04500 Chr2 (815788..819411) [3624 bp, 1207 aa] {ON} Anc_8....    33   1.5  
CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]...    33   1.5  
Smik_8.14 Chr8 (34679..36568) [1890 bp, 629 aa] {ON} YHL027W (REAL)    33   1.6  
Kpol_388.8 s388 (25278..26939) [1662 bp, 553 aa] {ON} (25278..26...    33   1.7  
Suva_8.24 Chr8 (53077..54972) [1896 bp, 631 aa] {ON} YHL027W (REAL)    33   1.7  
YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putat...    33   1.8  
YHL027W Chr8 (51111..52988) [1878 bp, 625 aa] {ON}  RIM101Transc...    33   1.9  
Smik_6.150 Chr6 complement(248356..250776) [2421 bp, 806 aa] {ON...    33   1.9  
AFR190C Chr6 complement(783107..784405) [1299 bp, 432 aa] {ON} S...    33   1.9  
Suva_7.349 Chr7 complement(598667..601105) [2439 bp, 812 aa] {ON...    33   2.1  
Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON} (31069..3...    33   2.1  
YGR067C Chr7 complement(622372..624786) [2415 bp, 804 aa] {ON} P...    33   2.2  
NCAS0D02520 Chr4 (478610..479341) [732 bp, 243 aa] {ON}                32   2.2  
KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {O...    33   2.2  
KLTH0E09922g Chr5 (894838..898197) [3360 bp, 1119 aa] {ON} weakl...    33   2.4  
TPHA0F00260 Chr6 (50020..51600) [1581 bp, 526 aa] {ON} Anc_4.21 ...    33   2.5  
SAKL0H25674g Chr8 complement(2249157..2250503) [1347 bp, 448 aa]...    32   2.9  
NCAS0A02360 Chr1 (448263..449699) [1437 bp, 478 aa] {ON} Anc_4.222     32   3.1  
KNAG0D00900 Chr4 (144302..145270) [969 bp, 322 aa] {ON} Anc_6.25...    32   3.2  
ZYRO0G07964g Chr7 (645949..647400) [1452 bp, 483 aa] {ON} weakly...    32   3.4  
ZYRO0B12738g Chr2 (1027933..1030119) [2187 bp, 728 aa] {ON} some...    32   3.7  
YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}  ...    32   3.8  
Kwal_47.16773 s47 complement(104725..106182) [1458 bp, 485 aa] {...    32   4.3  
KLLA0B03047g Chr2 complement(275298..277343) [2046 bp, 681 aa] {...    32   4.4  
NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256      32   4.6  
NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {O...    32   4.9  
Kwal_23.4156 s23 complement(597084..599204) [2121 bp, 706 aa] {O...    32   5.1  
KNAG0J02850 Chr10 complement(545071..546573) [1503 bp, 500 aa] {...    31   6.5  
KLTH0D14718g Chr4 (1206105..1208195) [2091 bp, 696 aa] {ON} some...    32   6.6  
TPHA0B00710 Chr2 complement(160987..162735) [1749 bp, 582 aa] {O...    31   6.7  
NCAS0C05820 Chr3 complement(1197669..1199426) [1758 bp, 585 aa] ...    31   7.2  
Kpol_529.26 s529 complement(73634..78334) [4701 bp, 1566 aa] {ON...    32   7.2  
Kpol_1008.21 s1008 (41825..44221) [2397 bp, 798 aa] {ON} (41825....    31   7.7  
TPHA0E02650 Chr5 (554820..555743) [924 bp, 307 aa] {ON} Anc_6.25...    31   8.7  
KNAG0F01710 Chr6 (320407..321648) [1242 bp, 413 aa] {ON} Anc_6.2...    31   9.0  
NDAI0D04320 Chr4 complement(1015358..1017577) [2220 bp, 739 aa] ...    31   9.1  
SAKL0G15752g Chr7 (1355625..1357604) [1980 bp, 659 aa] {ON} some...    31   10.0 

>Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON}
           (118605..120158) [1554 nt, 518 aa]
          Length = 517

 Score =  923 bits (2385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/517 (89%), Positives = 461/517 (89%)

Query: 1   MNNGNPFDDKYFTQHQGKNADIDSLRNTSIIPKXXXXXXXXXXXXXXLSRSPTHVSNISG 60
           MNNGNPFDDKYFTQHQGKNADIDSLRNTSIIPK              LSRSPTHVSNISG
Sbjct: 1   MNNGNPFDDKYFTQHQGKNADIDSLRNTSIIPKNSTPFNVNYNNTNNLSRSPTHVSNISG 60

Query: 61  GLPKSGDCMPSXXXXXXXXXXXXXXXXHDSTSNNINNSKIFQLVNNDSIQLPNGISSTSN 120
           GLPKSGDCMPS                HDSTSNNINNSKIFQLVNNDSIQLPNGISSTSN
Sbjct: 61  GLPKSGDCMPSNIYPTNNTITNRTNYNHDSTSNNINNSKIFQLVNNDSIQLPNGISSTSN 120

Query: 121 LPNPNSKVSNSHQMLYQXXXXXXXXXXXXXXCGEFSSNHSIDCNGPMKPHLIRRRKTIDN 180
           LPNPNSKVSNSHQMLYQ              CGEFSSNHSIDCNGPMKPHLIRRRKTIDN
Sbjct: 121 LPNPNSKVSNSHQMLYQNYNNSNMHYRNNSSCGEFSSNHSIDCNGPMKPHLIRRRKTIDN 180

Query: 181 SHRNNIIEPGFQTGINYDSGIMDKNHLSLEDIKFQNVGEVRPNIMKQKLPIMFPSLSGSP 240
           SHRNNIIEPGFQTGINYDSGIMDKNHLSLEDIKFQNVGEVRPNIMKQKLPIMFPSLSGSP
Sbjct: 181 SHRNNIIEPGFQTGINYDSGIMDKNHLSLEDIKFQNVGEVRPNIMKQKLPIMFPSLSGSP 240

Query: 241 VMNSPFILNDNQSIERNSNYGNLLANFSNLPNHSQSFGHHGLSSTKDMSSGSHMIPNLKP 300
           VMNSPFILNDNQSIERNSNYGNLLANFSNLPNHSQSFGHHGLSSTKDMSSGSHMIPNLKP
Sbjct: 241 VMNSPFILNDNQSIERNSNYGNLLANFSNLPNHSQSFGHHGLSSTKDMSSGSHMIPNLKP 300

Query: 301 SREEERSMKINDYVSKLDIVETGERMESMVNRHNDTDCNSKISSHGDGFRNDNIQSNSTN 360
           SREEERSMKINDYVSKLDIVETGERMESMVNRHNDTDCNSKISSHGDGFRNDNIQSNSTN
Sbjct: 301 SREEERSMKINDYVSKLDIVETGERMESMVNRHNDTDCNSKISSHGDGFRNDNIQSNSTN 360

Query: 361 NGSSQKLNKNTIGDTSEEKSESDLKGLEETVESTLSNLMQSHDYSMVMDWLTHNFVRTYS 420
           NGSSQKLNKNTIGDTSEEKSESDLKGLEETVESTLSNLMQSHDYSMVMDWLTHNFVRTYS
Sbjct: 361 NGSSQKLNKNTIGDTSEEKSESDLKGLEETVESTLSNLMQSHDYSMVMDWLTHNFVRTYS 420

Query: 421 LHQLQQXXXXXXXXXXXXDIDQKNMFQYPNKEKKQVSYQCPVCGKSVSRASSLHSHMFIH 480
           LHQLQQ            DIDQKNMFQYPNKEKKQVSYQCPVCGKSVSRASSLHSHMFIH
Sbjct: 421 LHQLQQSSSSTGSTGSSGDIDQKNMFQYPNKEKKQVSYQCPVCGKSVSRASSLHSHMFIH 480

Query: 481 TNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK 517
           TNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK
Sbjct: 481 TNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK 517

>Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON}
           (65876..67336) [1461 nt, 487 aa]
          Length = 486

 Score =  107 bits (266), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%)

Query: 454 KQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKK 513
           K+ +Y+C VCGK V+RA SLH+HM IHT  RPYKC WE C KTFNVKSNLNRH K+H+KK
Sbjct: 420 KKATYECSVCGKRVTRAYSLHAHMLIHTKVRPYKCDWENCGKTFNVKSNLNRHVKIHLKK 479

Query: 514 QQ 515
           Q+
Sbjct: 480 QK 481

>TBLA0B06410 Chr2 (1511970..1513319) [1350 bp, 449 aa] {ON}
           Anc_2.531
          Length = 449

 Score = 98.6 bits (244), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 53/65 (81%)

Query: 452 EKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHI 511
           ++K   +QC +CGK ++R+SSL +HM++HTN RP+KC WE C KTFNVKSNLNRH KLH+
Sbjct: 375 KRKVARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHL 434

Query: 512 KKQQK 516
           ++Q K
Sbjct: 435 RRQAK 439

>NCAS0J00640 Chr10 complement(98043..98351) [309 bp, 102 aa] {ON} 
          Length = 102

 Score = 90.1 bits (222), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 53/72 (73%), Gaps = 7/72 (9%)

Query: 441 DQKNMFQYPNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVK 500
            QK +++ P++       QCP+CGK V+R+SSL +HM +HT  RP+KC+W  C KTFNVK
Sbjct: 30  QQKFIYRRPSR-------QCPICGKIVTRSSSLQTHMLVHTGDRPFKCKWLNCGKTFNVK 82

Query: 501 SNLNRHTKLHIK 512
           SN+NRH KLH+K
Sbjct: 83  SNMNRHYKLHLK 94

>KAFR0A01840 Chr1 complement(379714..380958) [1245 bp, 414 aa] {ON}
           Anc_2.531
          Length = 414

 Score = 95.9 bits (237), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 37/59 (62%), Positives = 49/59 (83%)

Query: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK 517
           QCP+CGK+V+R+SSL  HMF+HT  RPY C+W  C K FNVKSN+NRH KLH+KK++++
Sbjct: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEKEQ 394

>NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score = 94.7 bits (234), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 37/64 (57%), Positives = 51/64 (79%)

Query: 451 KEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           + +++ S QC +CGKSV+R S+L +HM +HT  RP++C W GC+K FNVKSN+NRH KLH
Sbjct: 484 RVRRRKSRQCHICGKSVTRTSTLQTHMLVHTGDRPFECVWSGCHKRFNVKSNMNRHYKLH 543

Query: 511 IKKQ 514
           +KKQ
Sbjct: 544 LKKQ 547

>NDAI0B03080 Chr2 complement(785326..786708) [1383 bp, 460 aa] {ON}
           Anc_8.116
          Length = 460

 Score = 92.4 bits (228), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 35/55 (63%), Positives = 44/55 (80%)

Query: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKK 513
           QCP+CGK V+R +SL +HM IH+  RPYKC+W  C K FNVKSN+NRH K+H+KK
Sbjct: 389 QCPICGKIVTRVNSLQTHMLIHSGYRPYKCKWPACEKMFNVKSNMNRHYKIHLKK 443

>Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}
           similar to Ashbya gossypii AEL077W
          Length = 381

 Score = 90.1 bits (222), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 48/69 (69%)

Query: 449 PNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTK 508
           PNK +K V  QCPVC K   R SSL +HM+IHT  RP+ C+W GC K FNVKSN+ RH +
Sbjct: 287 PNKRRKCVRNQCPVCAKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHYR 346

Query: 509 LHIKKQQKK 517
           LH  ++ K+
Sbjct: 347 LHQVQENKE 355

>NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa]
           {ON} 
          Length = 505

 Score = 90.9 bits (224), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 43/56 (76%)

Query: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQ 514
           QC +CGK V+R SSL +HM IHT  RP+ C W GC KTFNVKSN+NRH KLH+ K+
Sbjct: 448 QCKLCGKVVTRTSSLQTHMLIHTGVRPFSCTWPGCKKTFNVKSNMNRHLKLHLIKE 503

>TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON} 
          Length = 501

 Score = 89.0 bits (219), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 31/59 (52%), Positives = 47/59 (79%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQK 516
           +QCP+C +  +R+ SLH+HM +HT  +P+KC+W+ C K F++KSNL+RH K+HI KQ+K
Sbjct: 426 HQCPICNRVTTRSYSLHAHMLVHTKDKPFKCEWQDCGKAFSIKSNLSRHMKIHIHKQKK 484

>AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; No
           homolog in Saccharomyces cerevisiae'
          Length = 336

 Score = 86.3 bits (212), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 44/61 (72%)

Query: 450 NKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKL 509
           +K +K V  QCPVCGK   R SSL +HM+IHT  RP+ C+W GC K FNVKSN+ RH +L
Sbjct: 266 DKRQKGVRNQCPVCGKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHYRL 325

Query: 510 H 510
           H
Sbjct: 326 H 326

>KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {ON} 
          Length = 519

 Score = 86.3 bits (212), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 44/59 (74%)

Query: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK 517
           QCPVCGK  SR S+L +H  IHT   P+KC WEGCNK+FNVKSN+ RH K H +K +++
Sbjct: 456 QCPVCGKICSRPSTLKTHYMIHTGDTPFKCPWEGCNKSFNVKSNMFRHLKSHKRKLEQR 514

>Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 84.0 bits (206), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 43/58 (74%)

Query: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQK 516
           QCPVCGK  SR S+L +H  IHT   P+KC WEGC+K+FNVKSN+ RH K H +K+ K
Sbjct: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCSKSFNVKSNMLRHLKSHERKRNK 312

>Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 83.6 bits (205), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 43/58 (74%)

Query: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQK 516
           QCPVCGK  SR S+L +H  IHT   P+KC WEGC+K+FNVKSN+ RH K H +K+ K
Sbjct: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCSKSFNVKSNMLRHLKSHERKRNK 312

>YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON}
           Putative zinc finger protein; YPR013C is not an
           essential gene
          Length = 317

 Score = 83.6 bits (205), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 42/58 (72%)

Query: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQK 516
           QCPVCGK  SR S+L +H  IHT   P+KC WEGC K+FNVKSN+ RH K H +K+ K
Sbjct: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKRNK 312

>Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 83.6 bits (205), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 43/58 (74%)

Query: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQK 516
           QCPVCGK  SR S+L +H  IHT   P+KC WEGC+K+FNVKSN+ RH K H +K+ K
Sbjct: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCSKSFNVKSNMLRHLKSHERKRNK 312

>NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON} 
          Length = 273

 Score = 82.8 bits (203), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 36/67 (53%), Positives = 46/67 (68%)

Query: 451 KEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           K K ++  QC VCGK  SR S+L +H  IHT   P+KC WEGC+K FNVKSN+ RH K H
Sbjct: 202 KAKVRLRKQCSVCGKVCSRPSTLKTHFLIHTGDTPFKCSWEGCHKAFNVKSNMLRHMKSH 261

Query: 511 IKKQQKK 517
            +++ KK
Sbjct: 262 ERRRNKK 268

>Skud_16.300 Chr16 complement(554576..555325) [750 bp, 249 aa] {ON}
           YPR015C (REAL)
          Length = 249

 Score = 82.0 bits (201), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 42/59 (71%)

Query: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK 517
           QCP+CGK  SR S+L +H  IHT   P+KC WE CNK+FNVKSN+ RH + H KK  KK
Sbjct: 188 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKKVAKK 246

>Smik_16.255 Chr16 complement(465909..466652) [744 bp, 247 aa] {ON}
           YPR015C (REAL)
          Length = 247

 Score = 82.0 bits (201), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 42/59 (71%)

Query: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK 517
           QCP+CGK  SR S+L +H  IHT   P+KC WE CNK+FNVKSN+ RH + H KK  KK
Sbjct: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKKIAKK 244

>YPR015C Chr16 complement(590283..591026) [744 bp, 247 aa] {ON}
           Putative protein of unknown function; overexpression
           causes a cell cycle delay or arrest
          Length = 247

 Score = 81.6 bits (200), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 42/59 (71%)

Query: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK 517
           QCP+CGK  SR S+L +H  IHT   P+KC WE CNK+FNVKSN+ RH + H KK  KK
Sbjct: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKKIAKK 244

>Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON}
           similar to Ashbya gossypii ADL050W
          Length = 179

 Score = 79.3 bits (194), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 44/57 (77%)

Query: 460 CPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQK 516
           CPVC K  +R +SL++H+ IH + RPY+C++  C KTFNVKSNLNRH K+H K++ K
Sbjct: 111 CPVCLKEFTRKTSLNTHLLIHADIRPYRCKYPDCKKTFNVKSNLNRHLKIHKKQELK 167

>Suva_16.338 Chr16 complement(594847..595590) [744 bp, 247 aa] {ON}
           YPR015C (REAL)
          Length = 247

 Score = 80.5 bits (197), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 34/59 (57%), Positives = 42/59 (71%)

Query: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK 517
           QCP+CGK  SR S+L +H  IHT   P+KC WE C+K+FNVKSN+ RH + H KK  KK
Sbjct: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCSKSFNVKSNMLRHLRTHQKKIAKK 244

>CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa]
           {ON} some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 348

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (66%)

Query: 452 EKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHI 511
           E  ++  QCPVCGK  SR S+L +H  IHT   P+KC W+ C K FNVKSN+ RH K H 
Sbjct: 279 ELSKLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHE 338

Query: 512 KKQQKK 517
           +K+Q K
Sbjct: 339 RKKQAK 344

>KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON} 
          Length = 370

 Score = 82.0 bits (201), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 41/59 (69%)

Query: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK 517
           QCPVCGK  SR S+L +H  IHT   P+KC W+GC K+FNVKSN+ RH K H KK   K
Sbjct: 299 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCPWKGCTKSFNVKSNMLRHFKSHEKKAASK 357

>KAFR0B02000 Chr2 complement(392263..393174) [912 bp, 303 aa] {ON}
           Anc_8.117 YPR015C
          Length = 303

 Score = 81.3 bits (199), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 40/59 (67%)

Query: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK 517
           +CPVCGK  SR S+L +H  IHT   P+KC W GC K FNVKSN+ RH K H KK  KK
Sbjct: 232 KCPVCGKMCSRPSTLKTHYLIHTGDTPFKCTWSGCPKAFNVKSNMLRHVKSHEKKLSKK 290

>NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON} 
          Length = 266

 Score = 80.1 bits (196), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 40/84 (47%), Positives = 50/84 (59%), Gaps = 6/84 (7%)

Query: 440 IDQKNMFQYPNKEKK------QVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGC 493
           I  KN  + P+K++       ++  QCP CGK  SR S+L +H  IHT   P+KC W  C
Sbjct: 176 IINKNSSKVPSKKRANRTLLSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNC 235

Query: 494 NKTFNVKSNLNRHTKLHIKKQQKK 517
           NK FNVKSN+ RH K H KK  KK
Sbjct: 236 NKAFNVKSNMLRHLKAHEKKVIKK 259

>ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 133

 Score = 76.6 bits (187), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 41/59 (69%)

Query: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK 517
           QCPVCGK  SR S+L +H  IHT   P+KC W+ C K+FNVKSN+ RH K H ++  K+
Sbjct: 67  QCPVCGKICSRPSTLKTHFLIHTGDTPFKCTWQNCQKSFNVKSNMLRHLKSHERRLAKQ 125

>KNAG0D02280 Chr4 (393332..394639) [1308 bp, 435 aa] {ON} 
          Length = 435

 Score = 82.0 bits (201), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 39/55 (70%)

Query: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKK 513
           QCPVCGK  SR S+L +H FIHT   P+KC W  C ++FNVKSN+ RH K H KK
Sbjct: 353 QCPVCGKICSRPSTLKTHYFIHTGDTPFKCTWPNCGRSFNVKSNMMRHMKAHAKK 407

>NCAS0B04660 Chr2 (850607..851377) [771 bp, 256 aa] {ON} 
          Length = 256

 Score = 79.0 bits (193), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 33/59 (55%), Positives = 42/59 (71%)

Query: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK 517
           +CPVCGK  SR S+L +H  IHT   P+KC + GC K+FNVKSN+ RH K H +K+ KK
Sbjct: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKKNKK 254

>SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 359

 Score = 80.5 bits (197), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 45/65 (69%)

Query: 452 EKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHI 511
           EK     QC +CGK  SR S+L +H+ +HT  +PY C+W GCN++FNVKSN+ RH K H 
Sbjct: 279 EKNLARNQCHICGKVCSRPSTLRTHVLVHTGVKPYPCEWPGCNRSFNVKSNMIRHYKNHE 338

Query: 512 KKQQK 516
           KK ++
Sbjct: 339 KKTKE 343

>KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {ON}
           Anc_8.116 YPR013C
          Length = 410

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 37/63 (58%), Positives = 44/63 (69%), Gaps = 4/63 (6%)

Query: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH----IKKQ 514
           QCPVCGK  SR S+L +H  IHT   P+KC WE C+K+FNVKSN+ RH K H    IKK 
Sbjct: 341 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEDCSKSFNVKSNMLRHLKSHERRLIKKN 400

Query: 515 QKK 517
           +KK
Sbjct: 401 RKK 403

>NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON} 
          Length = 338

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 34/58 (58%), Positives = 41/58 (70%)

Query: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQK 516
           QCPVCGK  SR S+L +H  IHT   P++C W+ CNK+FNVKSN+ RH K H KK  K
Sbjct: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAK 328

>NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531
          Length = 354

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 48/67 (71%), Gaps = 1/67 (1%)

Query: 449 PNKEKKQVS-YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHT 507
           P++EKK    ++CP+C K V+R++SL SH+ IHT  +PYKC W  C+ + +VKSN+ RH 
Sbjct: 286 PSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHY 345

Query: 508 KLHIKKQ 514
           K H+K Q
Sbjct: 346 KSHLKSQ 352

>TBLA0E03930 Chr5 complement(990944..992332) [1389 bp, 462 aa] {ON} 
          Length = 462

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 41/58 (70%)

Query: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQK 516
           QCPVCGK  SR S+L +H  IHT   PYKC+W  C K+FNVKSN+ RH K H KK +K
Sbjct: 356 QCPVCGKVCSRPSTLKTHYLIHTGDTPYKCKWLNCTKSFNVKSNMLRHLKNHEKKLEK 413

>SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 317

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 42/59 (71%)

Query: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK 517
           QCP+CGK  SR S+L +H  IHT A P+KC W  CNK+FNVKSN+ RH K H + ++ +
Sbjct: 259 QCPICGKLCSRPSTLKTHFLIHTGATPFKCPWLNCNKSFNVKSNMLRHYKSHERNEKYR 317

>ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No
           homolog in Saccharomyces cerevisiae
          Length = 173

 Score = 75.5 bits (184), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 30/51 (58%), Positives = 39/51 (76%)

Query: 460 CPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           C +C KS +R +SL +HM IHT A+PY+C +  CNKTFNVKSNL RH ++H
Sbjct: 118 CAICRKSFTRKTSLQTHMLIHTKAKPYRCPYRTCNKTFNVKSNLYRHERIH 168

>CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some
           similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c or uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q03825 Saccharomyces
           cerevisiae YMR164c MSS11
          Length = 344

 Score = 78.6 bits (192), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 34/62 (54%), Positives = 41/62 (66%)

Query: 451 KEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           K   ++  QCPVCGK  SR S+L +H+ IHT   P+KC W+ C K FNVKSNL RH K H
Sbjct: 277 KATTRLRKQCPVCGKICSRPSTLKTHILIHTGDTPFKCTWKDCRKAFNVKSNLLRHLKSH 336

Query: 511 IK 512
            K
Sbjct: 337 EK 338

>ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No
           homolog in Saccharomyces cerevisiae
          Length = 146

 Score = 73.9 bits (180), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 30/54 (55%), Positives = 40/54 (74%)

Query: 457 SYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           S  CPVC K  +R +SL++H+ IH + RPY C +  CNK+FNVKSNLNRH ++H
Sbjct: 75  SKTCPVCLKEFTRKTSLNTHLLIHADIRPYLCDYANCNKSFNVKSNLNRHLRIH 128

>KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa]
           {ON} some similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 285

 Score = 77.0 bits (188), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 30/51 (58%), Positives = 38/51 (74%)

Query: 460 CPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           C  CGK  +R S+L +HM +H+  +P++C WEGCNK FNVKSNL RH KLH
Sbjct: 234 CAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLKLH 284

>TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.117
           YPR015C
          Length = 162

 Score = 74.3 bits (181), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 32/58 (55%), Positives = 40/58 (68%)

Query: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQK 516
           QCPVCGK  SR S+L +H  IHT   P+KC W  C K+FNVKSN+ RH K H +K ++
Sbjct: 102 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCSWGNCTKSFNVKSNMLRHLKSHERKLKR 159

>SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {ON}
           weakly similar to uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 441

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 39/55 (70%)

Query: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKK 513
           QC  CGK  SR+SSL +H  +HT  RP+KC W  C KTFNVKSN+ RH +LH K+
Sbjct: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436

>Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON}
           similar to Ashbya gossypii ADL051W
          Length = 223

 Score = 73.9 bits (180), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 41/57 (71%)

Query: 454 KQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           K V   C +C KS +R +SL +HM IHT  +PY+C ++ CNKTFNVKSNL RH ++H
Sbjct: 155 KGVGKTCHICLKSFTRKTSLQTHMLIHTKVKPYRCSYQRCNKTFNVKSNLYRHERIH 211

>Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON}
           YPR013C - Hypothetical ORF [contig 55] FULL
          Length = 190

 Score = 73.2 bits (178), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 43/60 (71%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK 517
           YQC +C K  SR+S+L +H+  HT +RP++C +  C+KTFNVKSN+ RH K H + + ++
Sbjct: 128 YQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLKTHKQPEVRR 187

>NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON} 
          Length = 350

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 30/55 (54%), Positives = 41/55 (74%)

Query: 460 CPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQ 514
           C VCGKS++R++SL +HM IHT +RP+KC W  C  + +VKSN+ RH K H+K Q
Sbjct: 287 CVVCGKSLTRSTSLRTHMLIHTGSRPFKCSWPNCKASSSVKSNITRHFKSHLKGQ 341

>SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {ON}
           conserved hypothetical protein
          Length = 288

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 41/63 (65%)

Query: 453 KKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           + ++ + CP CGKS  R S+L +H  IH    PY C W GC+K FNVK NL RH ++H K
Sbjct: 213 RPKLQHLCPECGKSFRRPSALKTHSIIHVGRSPYACTWNGCSKRFNVKGNLLRHYRIHTK 272

Query: 513 KQQ 515
           K++
Sbjct: 273 KKE 275

>Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to
           Ashbya gossypii AGR186C
          Length = 312

 Score = 75.1 bits (183), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 33/58 (56%), Positives = 43/58 (74%), Gaps = 2/58 (3%)

Query: 456 VSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKK 513
           VS  CP+CGKS +R S+L  H+ IHTN +P+KC +  C K FNVKSNLNRH ++H +K
Sbjct: 169 VSKICPLCGKSFTRRSTLQIHLLIHTNLKPFKCSF--CEKEFNVKSNLNRHERIHRQK 224

>AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON}
           NOHBY743; No homolog in Saccharomyces cerevisiae
          Length = 287

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 33/58 (56%), Positives = 44/58 (75%), Gaps = 2/58 (3%)

Query: 456 VSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKK 513
           VS  CP+CGKS +R S+L  H+ IHTN +P+KC +  C+K FNVKSNLNRH ++H +K
Sbjct: 165 VSKICPLCGKSFTRRSTLQIHLLIHTNLKPFKCSF--CDKEFNVKSNLNRHERIHRQK 220

>KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {ON} 
          Length = 435

 Score = 75.9 bits (185), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 32/52 (61%), Positives = 36/52 (69%)

Query: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           QCPVCGK  SR S+L +H  IHT   P+KC W  C K+FNVKSNL RH K H
Sbjct: 371 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCTWGDCTKSFNVKSNLMRHLKSH 422

>NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {ON} 
          Length = 336

 Score = 74.7 bits (182), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 47/72 (65%), Gaps = 3/72 (4%)

Query: 444 NMFQYPNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNL 503
           N+++ P  + K+   QC +CGK  SR S+L +H  IH+   P+KC W+GC K FNVKSN+
Sbjct: 244 NIYRDPKIKNKK---QCDICGKICSRPSTLKTHYLIHSGDTPFKCAWKGCTKAFNVKSNM 300

Query: 504 NRHTKLHIKKQQ 515
            RH K H KK +
Sbjct: 301 LRHFKCHEKKAR 312

>Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON}
           complement(124703..125578) [876 nt, 292 aa]
          Length = 291

 Score = 73.9 bits (180), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (68%)

Query: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQK 516
           QC +C K  SR ++L +H+ IHT   P+KC WE C K+FNVKSN+ RH K H +KQ K
Sbjct: 150 QCHICKKICSRPATLKTHLLIHTGDTPFKCPWENCPKSFNVKSNMLRHLKSHQRKQVK 207

>KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 449 PNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTK 508
           PN E K+  ++C VCGK   R SSL +H  IHT  +PY C +E C+K+FN KSN+ RH K
Sbjct: 200 PNIENKR-KFKCCVCGKGFRRPSSLATHSNIHTGFKPYVCPYENCHKSFNAKSNMFRHYK 258

Query: 509 LHIK 512
           LH K
Sbjct: 259 LHFK 262

>SAKL0D02618g Chr4 complement(208093..209058) [966 bp, 321 aa] {ON}
           some similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 321

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 41/60 (68%)

Query: 453 KKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           +K   Y+CP CGK   R SSL++HM IHT  +P+ C ++ C KTFN KSN+ RH KLH K
Sbjct: 230 QKFPKYECPQCGKGFVRPSSLNTHMNIHTGDKPFVCPFKNCGKTFNAKSNMLRHHKLHFK 289

>KLLA0F11682g Chr6 complement(1068992..1070116) [1125 bp, 374 aa]
           {ON} weakly similar to uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 374

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 41/60 (68%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK 517
           Y+C  CGK+ +R SSL +HM IHT  +PYKC +  C K FN KSN+ RH KLH+K  + K
Sbjct: 304 YRCAECGKAFARPSSLSTHMNIHTGDKPYKCLYPNCYKQFNAKSNMLRHYKLHLKTPKVK 363

>Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON}
           complement(23868..25028) [1161 nt, 387 aa]
          Length = 386

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 39/59 (66%)

Query: 454 KQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           +++ Y C +CGK   R SSL +HM IHT  +P+ C +  C K+FN KSN+ RH KLH K
Sbjct: 301 EKIKYHCSICGKKFKRPSSLSTHMNIHTGNKPFTCPFTNCTKSFNAKSNMLRHYKLHFK 359

>KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {ON}
           some similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 111

 Score = 67.0 bits (162), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 41/62 (66%)

Query: 449 PNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTK 508
           P +  K + YQC  C K  +R+S+L SH+ +HT  RP+ C    C+K+FNVKSN+NRH K
Sbjct: 40  PAEAPKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFK 99

Query: 509 LH 510
            H
Sbjct: 100 TH 101

>KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}
           Anc_3.298
          Length = 394

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 38/58 (65%)

Query: 455 QVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           +V Y C VC K   R SSL +HM IHT  +PY+C +  C K+FN KSN+ RH KLH K
Sbjct: 275 KVKYCCKVCSKRFKRPSSLSTHMNIHTGYKPYQCPFSNCQKSFNAKSNMLRHYKLHFK 332

>TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 72.0 bits (175), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 39/58 (67%)

Query: 455 QVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           ++ Y C +CGK   R SSL++HM IHT  +PY+C    C+K FN KSN+ RH KLH K
Sbjct: 267 KIKYDCNICGKKFKRPSSLNTHMNIHTGQKPYRCPHISCSKAFNAKSNMLRHYKLHFK 324

>Ecym_8377 Chr8 complement(764541..765473) [933 bp, 310 aa] {ON}
           similar to Ashbya gossypii ADL040W
          Length = 310

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 38/58 (65%)

Query: 460 CPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK 517
           C VCG+  +R S+L +HM IHT   P++C W GC K FNV+SN+ RH   H +K  KK
Sbjct: 230 CTVCGRHCTRPSTLKTHMLIHTGELPFECNWPGCRKRFNVRSNMKRHLNSHKRKLIKK 287

>CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {ON}
           some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 315

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 39/63 (61%)

Query: 450 NKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKL 509
           NK  +   + C VC K   R SSL +HM IHT  +PY C ++ C K+FN KSN+ RH KL
Sbjct: 165 NKTSEDTKFICKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLRHYKL 224

Query: 510 HIK 512
           H K
Sbjct: 225 HFK 227

>Ecym_8389 Chr8 (797626..798381) [756 bp, 251 aa] {ON} similar to
           Ashbya gossypii ADL050W
          Length = 251

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 36/51 (70%)

Query: 460 CPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           CP+C K+ +R  S++ HM +HTN +PY C + GC K FNVK NL RH+K H
Sbjct: 157 CPICYKTFTRKISVNIHMVVHTNLKPYACDYPGCKKKFNVKGNLQRHSKCH 207

>ADL040W Chr4 (618852..619844) [993 bp, 330 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR013C
          Length = 330

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%)

Query: 460 CPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKK 513
           C VCG+  +R S+L +HM IHT   P++C W GC+K FNV+SN+NRH   H ++
Sbjct: 260 CLVCGRRCTRPSTLKTHMLIHTGELPFQCSWPGCSKRFNVRSNMNRHVNSHKRR 313

>Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON}
           similar to Ashbya gossypii ADR308C
          Length = 276

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 36/51 (70%)

Query: 460 CPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           C VCG+   R S+L +HM  HT  RP+ C+  GCNK+FNV+SN+ RH +LH
Sbjct: 215 CKVCGRECRRPSTLKTHMLTHTGQRPFCCRHPGCNKSFNVRSNMLRHERLH 265

>Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa]
           {ON} complement(127243..128337) [1095 nt, 365 aa]
          Length = 364

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 37/59 (62%)

Query: 454 KQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           +Q+ Y C VCGK   R SSL++H  IHT  +PY C    C K FN KSN+ RH KLH +
Sbjct: 272 QQMKYSCDVCGKKFKRPSSLNTHTNIHTGNKPYSCPAAKCKKAFNAKSNMLRHYKLHFR 330

>ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON}
           NOHBY437; No homolog in Saccharomyces cerevisiae
          Length = 278

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 36/51 (70%)

Query: 460 CPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           C VCG+   R S+L +HM  HT  RP+ C+  GC+K+FNV+SN+ RH +LH
Sbjct: 206 CKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFNVRSNMLRHERLH 256

>AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No
           homolog in Saccharomyces cerevisiae
          Length = 277

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 40/64 (62%)

Query: 449 PNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTK 508
           P + K    Y C  CGK  +RASSL +H  IHT  RP+ C ++ C K+FN +SN+ RH K
Sbjct: 174 PVQNKAPQRYVCTECGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNMLRHHK 233

Query: 509 LHIK 512
           LH +
Sbjct: 234 LHFR 237

>NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON}
           Anc_3.298
          Length = 330

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%)

Query: 454 KQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           +++ Y C VCGK   R SSL +H  I +  RPYKC +  C K+FN KSN+ RH KLH +
Sbjct: 235 EKLGYFCDVCGKGFRRPSSLRTHSNIRSGNRPYKCPYSNCTKSFNAKSNMLRHYKLHFR 293

>NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON}
           Anc_3.298
          Length = 370

 Score = 68.9 bits (167), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (62%)

Query: 449 PNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTK 508
           P+  ++   Y C  C K   R SSL++HM IHT  +PY C +E C K+FN KSN+ RH K
Sbjct: 249 PSISEEIAKYGCKHCNKRFKRPSSLNTHMNIHTGNKPYVCPYEECRKSFNAKSNMLRHYK 308

Query: 509 LHIK 512
           LH K
Sbjct: 309 LHFK 312

>SAKL0D15136g Chr4 (1255926..1256741) [816 bp, 271 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 271

 Score = 67.4 bits (163), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 37/62 (59%)

Query: 449 PNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTK 508
           P K++   +Y CP C K   R S L +HM IH    P+ C+W  C+K FNVKSNL RH +
Sbjct: 207 PRKKRVSYTYCCPKCKKEFKRPSGLRTHMVIHYGRNPFFCKWPNCSKKFNVKSNLLRHYR 266

Query: 509 LH 510
            H
Sbjct: 267 SH 268

>Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C -
           Hypothetical ORF [contig 227] FULL
          Length = 254

 Score = 67.0 bits (162), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 29/55 (52%), Positives = 36/55 (65%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           ++C +CGK+ SR S L +H  IHT  +PY C    C K FNVKSNL RH K+H K
Sbjct: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248

>SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 261

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/60 (51%), Positives = 36/60 (60%)

Query: 451 KEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           ++KK+  Y CP C K   R S+L +H  IH    PY CQ  GC K FNVKSNL RH K H
Sbjct: 192 RKKKEHGYSCPECEKVFGRPSALRTHSIIHIGKSPYICQLPGCAKRFNVKSNLLRHVKSH 251

>Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON}
           similar to Ashbya gossypii AGL207W
          Length = 301

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 29/55 (52%), Positives = 37/55 (67%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           Y C  CGK  +RASSL +H  IHT  RP+ C ++ C K+FN +SN+ RH KLH K
Sbjct: 207 YICSDCGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNMLRHHKLHFK 261

>TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298
          Length = 511

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 38/65 (58%), Gaps = 2/65 (3%)

Query: 448 YPNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHT 507
           YPN   K   Y C +C K   R SSL +HM IHT  +PY C +  C K FN KSN+ RH 
Sbjct: 407 YPNP--KNFKYHCDICHKFFRRPSSLKTHMNIHTGVKPYLCPYNNCYKPFNAKSNMLRHF 464

Query: 508 KLHIK 512
           KLH +
Sbjct: 465 KLHYR 469

>KLTH0C04884g Chr3 complement(422344..423372) [1029 bp, 342 aa] {ON}
           conserved hypothetical protein
          Length = 342

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (61%)

Query: 450 NKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKL 509
           +K K Q  Y C  CGK  +R SSL +H   HT  +P+ C +E C+K FN +SN+ RH KL
Sbjct: 230 SKLKLQPRYVCASCGKCFNRPSSLATHNNTHTGDKPFTCPFENCDKQFNARSNMTRHYKL 289

Query: 510 HIKKQ 514
           H K +
Sbjct: 290 HFKTE 294

>Kwal_27.10467 s27 complement(354071..354979) [909 bp, 302 aa] {ON}
           YDR043C (NRG1) - transcriptional repressor which can
           bind to UAS-1 in the STA1 promoter and which can
           interact with Ssn6p [contig 36] FULL
          Length = 302

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (60%)

Query: 449 PNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTK 508
           P + + Q  Y C  CGK  +R SSL +H   HT  +PY C ++ C+K FN +SN+ RH K
Sbjct: 189 PPRLRNQPRYTCTKCGKVFNRPSSLATHNNTHTGDKPYCCPFDNCDKQFNARSNMTRHYK 248

Query: 509 LHIK 512
           LH K
Sbjct: 249 LHFK 252

>KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 168

 Score = 63.5 bits (153), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 29/55 (52%), Positives = 37/55 (67%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           ++C VCGK+ SR S L++H  IHT  +P+ C    C K FNVKSNL RH K+H K
Sbjct: 111 HECHVCGKTFSRPSGLNTHALIHTGHQPFVCDVPHCGKRFNVKSNLIRHKKIHDK 165

>ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR015C
          Length = 281

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 34/51 (66%)

Query: 460 CPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           C +CGK   R S+L +HM +H N +PY C+  GC K FNVKSN+ RH + H
Sbjct: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRKH 277

>KLLA0A04609g Chr1 complement(411494..412765) [1272 bp, 423 aa] {ON}
           weakly similar to uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C
          Length = 423

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 28/52 (53%), Positives = 36/52 (69%)

Query: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           QC +CG+  SR S+L +H+ IHT  +PYKC    C+K FNVKSN+ RH K H
Sbjct: 342 QCHICGRICSRPSTLQTHLSIHTGDKPYKCPKRNCHKRFNVKSNMLRHYKRH 393

>KNAG0H01070 Chr8 complement(178080..179048) [969 bp, 322 aa] {ON}
           Anc_3.298
          Length = 322

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 37/59 (62%)

Query: 454 KQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           K+  Y C +CGK  +R SSL++H+  HT  +PY C    C+K FN +SN+ RH K H K
Sbjct: 233 KKNRYGCSICGKRFARPSSLNTHLNTHTGDKPYTCPHGSCSKVFNARSNMTRHYKTHFK 291

>KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON}
           Anc_3.298
          Length = 330

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 33/55 (60%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           Y C VCGK   R SSL +H  IHT  +P+ C    C KTFN +SN+ RH K H K
Sbjct: 233 YCCNVCGKRFKRPSSLSTHTNIHTGKKPFHCPLAKCTKTFNARSNMLRHYKAHFK 287

>KLLA0F22319g Chr6 complement(2086613..2087224) [612 bp, 203 aa]
           {ON} some similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 203

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 35/47 (74%)

Query: 464 GKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           GK  SR S+L +H+ +H+ A+P+KC +  CNK++NVKSNL RH K H
Sbjct: 152 GKEFSRPSTLKTHIVVHSQAKPFKCTYLDCNKSYNVKSNLRRHEKKH 198

>Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON}
           similar to Ashbya gossypii ADL042W
          Length = 305

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 34/51 (66%)

Query: 460 CPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           C +CGK   R S+L +HM +H N +PYKC+   C K FNVKSN+ RH + H
Sbjct: 251 CEICGKDFKRPSALRTHMVVHNNDKPYKCEHIDCQKRFNVKSNMLRHMRKH 301

>TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298
          Length = 833

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 38/61 (62%)

Query: 452 EKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHI 511
           E K    +C  C K   R SSL +H+ IHT  +P+KC  + C+K+FN +SN+ RH KLH 
Sbjct: 708 ENKLTKNKCEYCLKKFRRPSSLKTHLNIHTGIQPFKCPSKRCDKSFNARSNMLRHYKLHF 767

Query: 512 K 512
           K
Sbjct: 768 K 768

>CAGL0E01331g Chr5 (124599..126668) [2070 bp, 689 aa] {ON} some
           similarities with uniprot|P08153 Saccharomyces
           cerevisiae YDR146c SWI5 or uniprot|P21192 Saccharomyces
           cerevisiae YLR131c ACE2
          Length = 689

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 37/65 (56%), Gaps = 2/65 (3%)

Query: 451 KEKKQVSYQC--PVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTK 508
           KE     Y+C  P CGK+  R  ++ SH+  H   RPY+C ++GC+K F    +L RH K
Sbjct: 549 KELPDRMYECLYPQCGKTFKRRYNIRSHIQTHLEDRPYRCDYDGCDKAFVRNHDLVRHKK 608

Query: 509 LHIKK 513
            H +K
Sbjct: 609 THQEK 613

>TPHA0A05820 Chr1 complement(1319614..1320444) [831 bp, 276 aa] {ON}
           Anc_3.518 YGL209W
          Length = 276

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 39/70 (55%), Gaps = 1/70 (1%)

Query: 447 QYPNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRH 506
           ++PN +  +  + C  CG+   R      H+ IHT  +PYKC++E C K+F+    L RH
Sbjct: 27  KFPN-DNSERPFFCESCGRGFYRLEHKKRHLKIHTGEKPYKCKFEQCIKSFSRSDELRRH 85

Query: 507 TKLHIKKQQK 516
           +K+HI    K
Sbjct: 86  SKIHISPATK 95

>Kpol_1036.70 s1036 complement(192400..194424) [2025 bp, 674 aa]
           {ON} complement(192400..194424) [2025 nt, 675 aa]
          Length = 674

 Score = 57.8 bits (138), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 36/65 (55%), Gaps = 2/65 (3%)

Query: 451 KEKKQVSYQC--PVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTK 508
           KE     +QC  P C K+  R  ++ SH+  H   RPYKC +EGC+K F    +L RH K
Sbjct: 479 KEMPDKKFQCLYPKCDKTFKRRYNIRSHIQTHLEDRPYKCDFEGCDKAFVRNHDLIRHKK 538

Query: 509 LHIKK 513
            H +K
Sbjct: 539 SHAEK 543

>SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 819

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHT-KLHIK 512
           Y C  CGK  SR  +L +HM  H N +PY C+ +GC+K+F    NL  H  + H++
Sbjct: 596 YSCEKCGKRFSRKGNLAAHMLTHENLKPYHCKLDGCSKSFTQLGNLKAHQNRFHLQ 651

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           +QC  CGK  ++  +L +H  +HT  +PY C  E C K F+ K NL  H   H
Sbjct: 568 FQCEYCGKRFTQGGNLRTHTRLHTGEKPYSC--EKCGKRFSRKGNLAAHMLTH 618

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQ 514
           ++CP C K  ++++ L  H+  H   +P++C++  C K F    NL  HT+LH  ++
Sbjct: 540 HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHTRLHTGEK 594

>Kwal_56.23925 s56 complement(779625..781862) [2238 bp, 745 aa] {ON}
           YLR131C (ACE2) - zinc finger transcription factor
           [contig 171] FULL
          Length = 745

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 37/65 (56%), Gaps = 2/65 (3%)

Query: 451 KEKKQVSYQC--PVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTK 508
           KE    +++C  P CGK+  R  ++ SH+  H   RPY C +EGC+K F    +L RH K
Sbjct: 578 KELPDKTFECLHPDCGKTFRRRYNIRSHIQTHLEDRPYFCDFEGCHKAFVRNHDLIRHKK 637

Query: 509 LHIKK 513
            H +K
Sbjct: 638 THAEK 642

>Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON}
           complement(48007..48672) [666 nt, 222 aa]
          Length = 221

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 30/53 (56%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           Y C VC +   R      H+ IHT  +PYKC +  C+K F+    LNRH+K+H
Sbjct: 19  YLCEVCNRGFYRLEHKKRHLKIHTGEKPYKCLYLNCSKKFSRSDELNRHSKVH 71

>Kpol_1003.50 s1003 (114648..116492) [1845 bp, 614 aa] {ON}
           (114648..116492) [1845 nt, 615 aa]
          Length = 614

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQ 515
           Y CPVC K  +R  +L SH   HTN RP+ C    C KTF  + +  RH  LH  K++
Sbjct: 493 YACPVCDKKFTRPYNLKSHKRTHTNERPFSCSQ--CGKTFAREHDRKRHEDLHTGKKR 548

 Score = 37.4 bits (85), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 24/59 (40%), Gaps = 9/59 (15%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKC--------QWEGCNKTFNVKSNLNRHTK 508
           + C  CGK+ +R      H  +HT  + Y C         W GC K F     L RH K
Sbjct: 521 FSCSQCGKTFAREHDRKRHEDLHTGKKRYVCGGKLKSGESW-GCGKRFARSDALGRHFK 578

>SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P27705 Saccharomyces
           cerevisiae YGL035C MIG1 Transcription factor involved in
           glucose repression; C2H2 zinc finger protein similar to
           mammalian Egr and Wilms tumor proteins
          Length = 548

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           Y CP+C ++  R      H+  HT  +P+ C++ GC K F+    L RHT++H
Sbjct: 34  YVCPICSRAFHRLEHQTRHIRTHTGEKPHACEFPGCGKRFSRSDELTRHTRIH 86

>KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.80
           YGL035C
          Length = 459

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 440 IDQKNMFQYPNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNV 499
           +++  + + P  E     + CPVCG++  R      HM  HT  +P+ C + GC K F+ 
Sbjct: 26  VEESGLKKIPG-ENAPRPHVCPVCGRAFHRLEHQTRHMRTHTGEKPHACDFPGCTKRFSR 84

Query: 500 KSNLNRHTKLH 510
              L RH ++H
Sbjct: 85  SDELTRHKRIH 95

>ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 930

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHT-KLHI 511
           Y+C +CGK  SR  +L +H+  H   +P+ C+ +GCNKTF    N+  H  + H+
Sbjct: 618 YECELCGKRFSRKGNLAAHIVTHQKLKPFVCKLDGCNKTFTQLGNMKAHQNRFHL 672

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           + C  CGK  ++  +L +H  +HT  +PY+C+   C K F+ K NL  H   H K
Sbjct: 590 FLCECCGKRFTQGGNLRTHQRLHTGEKPYECEL--CGKRFSRKGNLAAHIVTHQK 642

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQ 514
           ++CP C +  ++++ L  H+  H   +P+ C  E C K F    NL  H +LH  ++
Sbjct: 562 HECPYCHRFFTQSTHLEVHVRSHIGYKPFLC--ECCGKRFTQGGNLRTHQRLHTGEK 616

>TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {ON}
           Anc_2.162 YOR113W
          Length = 714

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHT-KLHI 511
           Y+C +CGK  SR  +L +H+  H   +P+ C+ +GCNKTF    N+  H  + H+
Sbjct: 480 YECELCGKRFSRKGNLAAHVVTHQKLKPFICKLDGCNKTFTQLGNMKAHQNRFHL 534

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           +QC  CGK  ++  +L +H  +HT  +PY+C  E C K F+ K NL  H   H K
Sbjct: 452 FQCQYCGKRFTQGGNLRTHQRLHTGEKPYEC--ELCGKRFSRKGNLAAHVVTHQK 504

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           ++CP C +  ++++ L  H+  H   +P++CQ+  C K F    NL  H +LH
Sbjct: 424 HECPYCHRFFTQSTHLEVHVRSHIGYKPFQCQY--CGKRFTQGGNLRTHQRLH 474

>ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR113W (AZF1)
          Length = 769

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 1/56 (1%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHT-KLHIK 512
           Y+C  CGK  SR  +L +HM  H N +P++C+ + CNK+F    N+  H  + H++
Sbjct: 543 YECDKCGKRFSRKGNLAAHMLTHENYKPFQCKLDDCNKSFTQLGNMKAHQNRFHLQ 598

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           +QC  CGK  ++  +L +H+ +HT  RPY+C  + C K F+ K NL  H   H
Sbjct: 515 FQCEYCGKRFTQGGNLRTHVRLHTGERPYEC--DKCGKRFSRKGNLAAHMLTH 565

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           ++CP C K  ++++ L  H+  H   +P++C++  C K F    NL  H +LH
Sbjct: 487 HKCPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 537

>Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii ACR264W
          Length = 775

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 1/56 (1%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHT-KLHIK 512
           Y+C  CGK  SR  +L +HM  H N +P++C+ + CNK+F    N+  H  + H++
Sbjct: 547 YECDKCGKRFSRKGNLAAHMLTHENHKPFQCKLDDCNKSFTQLGNMKAHQNRFHLQ 602

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           +QC  CGK  ++  +L +H+ +HT  RPY+C  + C K F+ K NL  H   H
Sbjct: 519 FQCEYCGKRFTQGGNLRTHVRLHTGERPYEC--DKCGKRFSRKGNLAAHMLTH 569

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           ++CP C K  ++++ L  H+  H   +P++C++  C K F    NL  H +LH
Sbjct: 491 HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 541

>CAGL0M06831g Chr13 (695162..697099) [1938 bp, 645 aa] {ON} weakly
           similar to uniprot|P53968 Saccharomyces cerevisiae
           YNL027w CRZ1
          Length = 645

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQ 515
           Y C VCGK  SR  +L SH+  HT+ +PY+C    C K F  + +  RH  LH  K++
Sbjct: 521 YVCEVCGKVFSRPYNLKSHLRTHTDEKPYQCSI--CGKAFARQHDKKRHEDLHTGKKR 576

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 7/58 (12%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKC-------QWEGCNKTFNVKSNLNRHTK 508
           YQC +CGK+ +R      H  +HT  + Y C        + GC K F     L RH K
Sbjct: 549 YQCSICGKAFARQHDKKRHEDLHTGKKRYVCGGKLKDGTFWGCGKKFARSDALGRHFK 606

>ZYRO0A02288g Chr1 (181918..183777) [1860 bp, 619 aa] {ON} similar
           to uniprot|Q288C3 Torulaspora delbrueckii CRZ1
           Calcineurin-responsive zinc finger transcription factor
           and some similarites with YNL027W uniprot|P53968
           Saccharomyces cerevisiae YNL027W CRZ1 Transcription
           factor that activates transcription of genes involved in
           stress response nuclear localization is positively
           regulated by calcineurin-mediated dephosphorylation
          Length = 619

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 2/64 (3%)

Query: 452 EKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHI 511
           +K   ++ C +CGK  +R  +L SH+  HTN RP++C    C K F  + +  RH  LH 
Sbjct: 502 QKNPAAFACELCGKRFTRPYNLKSHLRTHTNERPFECSI--CGKAFARQHDRKRHEDLHT 559

Query: 512 KKQQ 515
            K++
Sbjct: 560 GKKR 563

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 26/59 (44%), Gaps = 9/59 (15%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKC--------QWEGCNKTFNVKSNLNRHTK 508
           ++C +CGK+ +R      H  +HT  + Y C         W GC K F     L RH K
Sbjct: 536 FECSICGKAFARQHDRKRHEDLHTGKKRYVCGGTLKNGSSW-GCGKKFARSDALGRHFK 593

>CAGL0M04323g Chr13 complement(474158..476269) [2112 bp, 703 aa]
           {ON} similar to uniprot|P21192 Saccharomyces cerevisiae
           YLR131c ACE2 or uniprot|P08153 Saccharomyces cerevisiae
           YDR146c SWI5
          Length = 703

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 35/64 (54%), Gaps = 2/64 (3%)

Query: 451 KEKKQVSYQC--PVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTK 508
           KE    +++C  P CGK   R  ++ SH+  H   +PYKC +EGC K F    +L RH K
Sbjct: 516 KELPDKNFECLFPNCGKFFRRRYNIKSHIQTHLEDKPYKCDFEGCTKAFVRNHDLARHKK 575

Query: 509 LHIK 512
            H K
Sbjct: 576 THDK 579

>Skud_14.301 Chr14 (550283..552331) [2049 bp, 682 aa] {ON} YNL027W
           (REAL)
          Length = 682

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 35/66 (53%), Gaps = 2/66 (3%)

Query: 450 NKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKL 509
           N  K   ++ C VCGK  +R  +L SH+  HTN RP+ C    C K F  + +  RH  L
Sbjct: 565 NNRKNPANFACDVCGKKFTRPYNLKSHLRTHTNERPFICSI--CGKAFARQHDRKRHEDL 622

Query: 510 HIKKQQ 515
           H  K++
Sbjct: 623 HTGKKR 628

 Score = 37.7 bits (86), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 25/59 (42%), Gaps = 9/59 (15%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKC--------QWEGCNKTFNVKSNLNRHTK 508
           + C +CGK+ +R      H  +HT  + Y C         W GC K F     L RH K
Sbjct: 601 FICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPW-GCGKKFARSDALGRHFK 658

>Smik_14.303 Chr14 (542116..544137) [2022 bp, 673 aa] {ON} YNL027W
           (REAL)
          Length = 673

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 35/66 (53%), Gaps = 2/66 (3%)

Query: 450 NKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKL 509
           N  K   ++ C VCGK  +R  +L SH+  HTN RP+ C    C K F  + +  RH  L
Sbjct: 556 NNRKNPANFACDVCGKKFTRPYNLKSHLRTHTNERPFICSI--CGKAFARQHDRKRHEDL 613

Query: 510 HIKKQQ 515
           H  K++
Sbjct: 614 HTGKKR 619

 Score = 37.7 bits (86), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 25/59 (42%), Gaps = 9/59 (15%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKC--------QWEGCNKTFNVKSNLNRHTK 508
           + C +CGK+ +R      H  +HT  + Y C         W GC K F     L RH K
Sbjct: 592 FICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPW-GCGKKFARSDALGRHFK 649

>TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {ON}
           Anc_2.162 YOR113W
          Length = 717

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHT-KLHIK 512
           Y C +CGK  SR  +L +H   H   +PY C+ E CNK+F    N+  H  + H+K
Sbjct: 465 YNCEMCGKRFSRKGNLAAHALTHQKLKPYICKLENCNKSFTQLGNMKAHQNRFHLK 520

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           +QC  CGK  ++  +L +H  +HT  +PY C  E C K F+ K NL  H   H K
Sbjct: 437 FQCEFCGKRFTQGGNLRTHQRLHTGEKPYNC--EMCGKRFSRKGNLAAHALTHQK 489

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           ++CP C +  ++++ L  H+  H   +P++C++  C K F    NL  H +LH
Sbjct: 409 HECPYCHRFFTQSTHLEVHVRSHIGYKPFQCEF--CGKRFTQGGNLRTHQRLH 459

>Suva_14.318 Chr14 (561697..562047,562519..564213) [2046 bp, 681 aa]
           {ON} YNL027W (REAL)
          Length = 681

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 35/66 (53%), Gaps = 2/66 (3%)

Query: 450 NKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKL 509
           N  K   ++ C VCGK  +R  +L SH+  HTN RP+ C    C K F  + +  RH  L
Sbjct: 564 NNRKNPANFACDVCGKKFTRPYNLKSHLRTHTNERPFICSI--CGKAFARQHDRKRHEDL 621

Query: 510 HIKKQQ 515
           H  K++
Sbjct: 622 HTGKKR 627

 Score = 38.1 bits (87), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 26/59 (44%), Gaps = 9/59 (15%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKC--------QWEGCNKTFNVKSNLNRHTK 508
           + C +CGK+ +R      H  +HT  + Y C         W GC+K F     L RH K
Sbjct: 600 FICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPW-GCSKKFARSDALGRHFK 657

>YNL027W Chr14 (579580..581616) [2037 bp, 678 aa] {ON}
           CRZ1Transcription factor that activates transcription of
           genes involved in stress response; nuclear localization
           is positively regulated by calcineurin-mediated
           dephosphorylation
          Length = 678

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 35/66 (53%), Gaps = 2/66 (3%)

Query: 450 NKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKL 509
           N  K   ++ C VCGK  +R  +L SH+  HTN RP+ C    C K F  + +  RH  L
Sbjct: 561 NNRKNPANFACDVCGKKFTRPYNLKSHLRTHTNERPFICSI--CGKAFARQHDRKRHEDL 618

Query: 510 HIKKQQ 515
           H  K++
Sbjct: 619 HTGKKR 624

 Score = 38.1 bits (87), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 25/59 (42%), Gaps = 9/59 (15%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQ--------WEGCNKTFNVKSNLNRHTK 508
           + C +CGK+ +R      H  +HT  + Y C         W GC K F     L RH K
Sbjct: 597 FICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPW-GCGKKFARSDALGRHFK 654

>CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} similar
           to uniprot|P27705 Saccharomyces cerevisiae YGL035c MIG1
           transcriptional repressor
          Length = 424

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%)

Query: 460 CPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHI 511
           CP+CG++  R      HM  HT  +P+ C + GC K F+    L RH ++H 
Sbjct: 45  CPICGRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRIHT 96

>KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.162
           YOR113W
          Length = 729

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHT-KLHIK 512
           YQC +CGK  SR  +L +H+  H   +P+ C+ + CNK+F    N+  H  K H++
Sbjct: 549 YQCELCGKRFSRKGNLAAHVLTHKKIKPFICKLDNCNKSFTQLGNMKGHQNKFHLE 604

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           YQC  CGK  ++  +L +H  +HT  +PY+C+   C K F+ K NL  H   H K
Sbjct: 521 YQCQYCGKKFTQGGNLRTHERLHTGEKPYQCEL--CGKRFSRKGNLAAHVLTHKK 573

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           ++C  C +  ++ + L  H+  H   +PY+CQ+  C K F    NL  H +LH
Sbjct: 493 HECRYCHRFFTQLTHLEVHIRSHIGIKPYQCQY--CGKKFTQGGNLRTHERLH 543

>SAKL0H15488g Chr8 (1347432..1349828) [2397 bp, 798 aa] {ON} similar
           to uniprot|P21192 Saccharomyces cerevisiae YLR131C ACE2
           Transcription factor that activates expression of early
           G1-specific genes localizes to daughter cell nuclei
           after cytokinesis and delays G1 progression in daughters
           localization is regulated by phosphorylation potential
           Cdc28p substrate
          Length = 798

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 451 KEKKQVSYQC--PVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTK 508
           +E    ++QC  P C K+  R  ++ SH+  H   RPY C +EGC K F    +L RH K
Sbjct: 610 RELPDKTFQCMYPDCNKTFRRRYNIRSHIQTHLEDRPYVCDYEGCTKAFVRNHDLIRHKK 669

Query: 509 LHIKK 513
            H  K
Sbjct: 670 THADK 674

>KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 768

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHT-KLHIK 512
           Y+C  CG+  SR  +L +H   H N +P+ C+ +GCNK+F    N+  H  + H++
Sbjct: 542 YECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGNMKAHQNRFHLQ 597

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           +QC  CGK  ++  +L +H+ +HT  +PY+C  E C + F+ K NL  H   H
Sbjct: 514 FQCEYCGKRFTQGGNLRTHVRLHTGEKPYEC--EKCGRRFSRKGNLAAHRLTH 564

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 34/64 (53%), Gaps = 2/64 (3%)

Query: 451 KEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           K +    ++CP C K  ++++ L  H+  H   +P++C++  C K F    NL  H +LH
Sbjct: 479 KARGAKQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 536

Query: 511 IKKQ 514
             ++
Sbjct: 537 TGEK 540

>Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113W
           (AZF1) - similar to Zn-finger transcription factors
           [contig 204] FULL
          Length = 786

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHT-KLHIK 512
           Y+C  CG+  SR  +L +H   H N +P+ C+ +GCNK+F    N+  H  + H++
Sbjct: 559 YECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGNMKAHQNRFHLQ 614

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           +QC  CGK  ++  +L +H+ +HT  +PY+C  E C + F+ K NL  H   H
Sbjct: 531 FQCEYCGKRFTQGGNLRTHVRLHTGEKPYEC--EKCGRRFSRKGNLAAHRLTH 581

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 34/64 (53%), Gaps = 2/64 (3%)

Query: 451 KEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           K +    ++CP C K  ++++ L  H+  H   +P++C++  C K F    NL  H +LH
Sbjct: 496 KARGAKQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 553

Query: 511 IKKQ 514
             ++
Sbjct: 554 TGEK 557

>Skud_7.249 Chr7 complement(434181..435689) [1509 bp, 502 aa] {ON}
           YGL035C (REAL)
          Length = 502

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 35/70 (50%)

Query: 441 DQKNMFQYPNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVK 500
           D K+  +   K +    + CP+C ++  R      HM IHT  +P+ C + GC K F+  
Sbjct: 21  DSKSKSKTAAKSEAPRPHACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRS 80

Query: 501 SNLNRHTKLH 510
             L RH ++H
Sbjct: 81  DELTRHRRIH 90

>NDAI0G02560 Chr7 (585170..587554) [2385 bp, 794 aa] {ON} Anc_8.326
          Length = 794

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 33/63 (52%)

Query: 454 KQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKK 513
           KQ     P C K   R  ++ +H+  H   RPY+C++ GC K F    +L RH KLH +K
Sbjct: 659 KQFGCLYPNCDKIFKRRYNVRTHIQTHLEDRPYRCEFRGCEKAFVRNHDLVRHKKLHAEK 718

Query: 514 QQK 516
             K
Sbjct: 719 HMK 721

>TPHA0C00800 Chr3 (156349..158391) [2043 bp, 680 aa] {ON} Anc_8.326
           YLR131C
          Length = 680

 Score = 53.5 bits (127), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 36/65 (55%), Gaps = 2/65 (3%)

Query: 451 KEKKQVSYQC--PVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTK 508
           KE +   ++C  P CGK+  R  ++ SH+  H   RPYKC   GC+K F    +L RH K
Sbjct: 485 KELEGKMFECLYPDCGKTFKRRYNVRSHIQTHLQDRPYKCDMPGCDKGFVRNHDLLRHKK 544

Query: 509 LHIKK 513
            H +K
Sbjct: 545 CHEEK 549

>ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weakly
           similar to uniprot|P47043 Saccharomyces cerevisiae
           YJL056C ZAP1 Zinc-regulated transcription factor binds
           to zinc-responsive promoter elements to induce
           transcription of certain genes in the presence of zinc
           regulates its own transcription contains seven zinc-
           finger domains
          Length = 849

 Score = 53.5 bits (127), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKK 513
           ++C +CGKS S +SSL  H+  HT  +P +C+   C K FN  SNLN+H K H KK
Sbjct: 763 FKCHLCGKSFSVSSSLKIHIRTHTGEKPLQCKI--CGKRFNESSNLNKHLKTHRKK 816

 Score = 34.7 bits (78), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 463 CGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           C +  ++   +  H+ +H+  +P+KCQ   C K+F+ +  LN+H + H
Sbjct: 712 CCRKFTQRQKMVRHLKVHSGYKPFKCQV--CLKSFSSEDTLNQHMRTH 757

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 3/51 (5%)

Query: 463 CGKSVSRASSLHSHM---FIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           C +  S A  L +H+    +      Y C W+GC + F  +  + RH K+H
Sbjct: 679 CDQCFSGAEDLSNHLEKFHLPRGKSEYHCHWKGCCRKFTQRQKMVRHLKVH 729

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 4/48 (8%)

Query: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRH 506
           QC +CGK  + +S+L+ H+  H   + YKC    C ++F+ +     H
Sbjct: 792 QCKICGKRFNESSNLNKHLKTH--RKKYKCSC--CFRSFDTEEKFKAH 835

>AGL197W Chr7 (325717..328251) [2535 bp, 844 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR146C (SWI5) and
           YLR131C (ACE2)
          Length = 844

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 42/76 (55%), Gaps = 3/76 (3%)

Query: 440 IDQKNMFQYPNKEKKQVSYQC--PVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTF 497
           + Q  + QY  K + + ++QC  P CGK  +R  ++ SH+  H   RP++C  EGC K F
Sbjct: 657 LPQGEIDQYIKKLQDK-TFQCLYPECGKLFNRRYNIRSHIQTHLEDRPFRCDHEGCTKAF 715

Query: 498 NVKSNLNRHTKLHIKK 513
               +L RH K H +K
Sbjct: 716 VRNHDLIRHKKTHAEK 731

>Smik_7.251 Chr7 complement(423105..424622) [1518 bp, 505 aa] {ON}
           YGL035C (REAL)
          Length = 505

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 35/70 (50%)

Query: 441 DQKNMFQYPNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVK 500
           D K+  +   K +    + CP+C ++  R      HM IHT  +P+ C + GC K F+  
Sbjct: 21  DSKSKSKTTAKSEAPRPHACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRS 80

Query: 501 SNLNRHTKLH 510
             L RH ++H
Sbjct: 81  DELTRHRRIH 90

>Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 bp,
           515 aa] {ON} YGL035C (REAL)
          Length = 515

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%)

Query: 451 KEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           K +    + CP+C ++  R      HM IHT  +P+ C + GC K F+    L RH ++H
Sbjct: 31  KSEAPRPHACPICQRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIH 90

>AFR471C Chr6 complement(1287518..1288687) [1170 bp, 389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL035C
           (MIG1)
          Length = 389

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           Y CP+C ++  R      H+  HT  +P+ C + GC K F+ +  L RH ++H
Sbjct: 22  YVCPICARAFHRLEHQTRHIRTHTGEKPHACDFAGCGKRFSRQDELTRHRRIH 74

>KLLA0E11023g Chr5 (966805..968229) [1425 bp, 474 aa] {ON}
           uniprot|P50898 Kluyveromyces lactis MIG1 Regulatory
           protein MIG1
          Length = 474

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           Y CP+C +   R      H+  HT  RP+ C + GC+K F+    L RH ++H
Sbjct: 26  YVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH 78

>KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 8/68 (11%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH------- 510
           ++CP+C +   R      H+  HT  +PYKC +  C K+F+    L RH+K+H       
Sbjct: 17  FKCPLCQRGFHRLEHKKRHVRTHTGEKPYKCSFPDCPKSFSRTDELKRHSKIHGNFLSTA 76

Query: 511 -IKKQQKK 517
            IK+ +KK
Sbjct: 77  TIKRLEKK 84

>TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON}
           Anc_2.303 YNL027W
          Length = 762

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 34/64 (53%), Gaps = 2/64 (3%)

Query: 452 EKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHI 511
           +K    Y C +C K  +R  +L SH+  HTN RP+ C    CNK F  + +  RH  LH 
Sbjct: 645 QKNPAIYACELCDKKFTRPYNLKSHLRTHTNERPFICSI--CNKAFARQHDRKRHEDLHT 702

Query: 512 KKQQ 515
            K++
Sbjct: 703 GKKR 706

 Score = 35.0 bits (79), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 26/65 (40%), Gaps = 9/65 (13%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKC--------QWEGCNKTFNVKSNLNRHTKL 509
           + C +C K+ +R      H  +HT  + Y C         W GC K F     L RH K 
Sbjct: 679 FICSICNKAFARQHDRKRHEDLHTGKKRYICGGKLKNGTSW-GCGKKFARSDALGRHFKT 737

Query: 510 HIKKQ 514
              K+
Sbjct: 738 ESGKR 742

>KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.80
           YGL035C
          Length = 335

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 37/78 (47%)

Query: 439 DIDQKNMFQYPNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFN 498
           D  +K   +  N ++    + CP+C ++  R      HM  HT  +P+ C + GC K F+
Sbjct: 2   DTQKKTSQKKSNSDEAPRPHVCPICQRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFS 61

Query: 499 VKSNLNRHTKLHIKKQQK 516
               L RH ++H   Q +
Sbjct: 62  RSDELTRHRRIHTNTQPR 79

>YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}
           MIG1Transcription factor involved in glucose repression;
           sequence specific DNA binding protein containing two
           Cys2His2 zinc finger motifs; regulated by the SNF1
           kinase and the GLC7 phosphatase
          Length = 504

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           + CP+C ++  R      HM IHT  +P+ C + GC K F+    L RH ++H
Sbjct: 38  HACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIH 90

>NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON}
           Anc_2.162
          Length = 1064

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRH-TKLHIK 512
           Y+C +C K  SR  +L +H   H + +P+ C+ + CNKTF    N+  H  K H++
Sbjct: 656 YRCEICDKRFSRKGNLAAHKLTHRDVKPFVCKLDNCNKTFTQLGNMKAHQNKFHLQ 711

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           +QC  CGK  ++  +L +H  +HT  +PY+C  E C+K F+ K NL  H   H
Sbjct: 628 FQCNFCGKRFTQGGNLRTHQRLHTGEKPYRC--EICDKRFSRKGNLAAHKLTH 678

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           ++CP C +  S+++ L  H+  H   +P++C +  C K F    NL  H +LH
Sbjct: 600 HECPYCHRLFSQSTHLEVHIRSHLGYKPFQCNF--CGKRFTQGGNLRTHQRLH 650

>TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.281
           YBR066C
          Length = 314

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 38/77 (49%)

Query: 440 IDQKNMFQYPNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNV 499
           ID   +   P++   +  Y C VC K ++ +  L  H  IHT  + Y C  EGC++ F+ 
Sbjct: 238 IDDDELKLDPSQYDPKKKYICKVCSKGLTTSGHLARHYRIHTGEKNYSCLHEGCDQKFSR 297

Query: 500 KSNLNRHTKLHIKKQQK 516
             N  +H K H+K   K
Sbjct: 298 HDNCKQHYKTHLKNYTK 314

>CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa]
           {ON} weakly similar to uniprot|P41696 Saccharomyces
           cerevisiae YOR113w AZF1 asparagine-rich zinc finger
           protein
          Length = 642

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           ++C  CGK  ++A +L +H  +HT  RP+KC  + C+KTF  + NL  H   H
Sbjct: 508 FECEFCGKRFTQAGNLRTHRRLHTGERPFKC--DKCDKTFARRGNLTAHEFTH 558

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           YQC  C K  S+++ L  H+  H   +P++C++  C K F    NL  H +LH
Sbjct: 480 YQCAYCSKMFSQSTHLDVHIKAHMGYKPFECEF--CGKRFTQAGNLRTHRRLH 530

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 37/64 (57%), Gaps = 4/64 (6%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTF----NVKSNLNRHTKLHIKK 513
           ++C  C K+ +R  +L +H F H + +PY C+ + C K F    N+KS+ N++    IK+
Sbjct: 536 FKCDKCDKTFARRGNLTAHEFTHESIKPYICRLDNCFKRFSQLGNMKSHQNKYHPQTIKE 595

Query: 514 QQKK 517
             +K
Sbjct: 596 LTQK 599

>TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           ++CP+C +   RA     H+  HT  +P+ C   GCNK+F+    L RH K+H
Sbjct: 16  FKCPMCHRGFYRAEHKKRHIRTHTGEKPHLCPILGCNKSFSRTDELKRHMKVH 68

>TPHA0O01440 Chr15 (289051..291387) [2337 bp, 778 aa] {ON} Anc_1.326
           YJL056C
          Length = 778

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 40/75 (53%), Gaps = 3/75 (4%)

Query: 442 QKNMFQYPNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKS 501
           Q+ + Q+      +  Y+C +CG S S ASSL  H   HT  +P  C    C K FN  S
Sbjct: 685 QEILIQHQRVHSGEKPYKCDMCGNSFSSASSLKVHKRTHTGEKPLSCN--VCGKRFNSSS 742

Query: 502 NLNRHTKLHIKKQQK 516
           NL++H K H KKQ K
Sbjct: 743 NLSKHVKTH-KKQYK 756

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 463 CGKSVSRASSLHSHM---FIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           CGK       L++H+    + +    Y C+WE C++ F  K  L RH ++H
Sbjct: 617 CGKLFENEEMLNNHVEKTHLLSRQSEYYCKWENCDRRFTQKQKLVRHLRVH 667

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 31/59 (52%), Gaps = 4/59 (6%)

Query: 454 KQVSYQCPV--CGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           +Q  Y C    C +  ++   L  H+ +HT+ +P+ C+   C K F+ +  L +H ++H
Sbjct: 639 RQSEYYCKWENCDRRFTQKQKLVRHLRVHTHYKPFTCK--TCGKNFSNQEILIQHQRVH 695

>NCAS0A01820 Chr1 (351123..352490) [1368 bp, 455 aa] {ON} Anc_4.80
          Length = 455

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%)

Query: 460 CPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQK 516
           CP+C ++  R      HM  HT  +P++C + GC K F+    L RH ++H   Q +
Sbjct: 70  CPICQRAFHRLEHQTRHMRTHTGEKPHECDFPGCVKKFSRSDELTRHKRIHTNPQPR 126

>Kwal_14.2278 s14 complement(686159..687550) [1392 bp, 463 aa] {ON}
           YGL035C (MIG1) - 1:1 [contig 227] FULL
          Length = 463

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           Y CP+C ++  R      H+  HT  +P+ C + GC K F+    L RH ++H
Sbjct: 23  YICPICSRAFHRLEHQTRHIRTHTGEKPHACDFAGCTKRFSRSDELTRHKRIH 75

>Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa]
           {ON} complement(131384..133768) [2385 nt, 795 aa]
          Length = 794

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHT-KLHI 511
           Y C +CGK  SR  +L +H   H   +PY C+ + CNK+F    N+  H  + H+
Sbjct: 564 YSCELCGKKFSRKGNLAAHFLTHQKLKPYVCKLDECNKSFTQLGNMKAHQNRFHL 618

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           +QC  CGK  ++  +L +H  +HT  RPY C+   C K F+ K NL  H   H K
Sbjct: 536 FQCEYCGKRFTQGGNLRTHQRLHTGERPYSCEL--CGKKFSRKGNLAAHFLTHQK 588

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           ++CP C +  ++++ L  H+  H   +P++C++  C K F    NL  H +LH
Sbjct: 508 HECPYCHRFFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHQRLH 558

>Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 239

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 31/67 (46%)

Query: 451 KEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           KE     Y C +CG    R      H+  HT  +P+ C   GC K F+    L RH K H
Sbjct: 5   KECNDRPYLCEICGNRFHRLEHKTRHIRTHTGEKPFACTVPGCPKRFSRNDELKRHIKTH 64

Query: 511 IKKQQKK 517
            K +++K
Sbjct: 65  FKSRKRK 71

>KLTH0G12254g Chr7 (1040230..1042470) [2241 bp, 746 aa] {ON} weakly
           similar to uniprot|P21192 Saccharomyces cerevisiae
           YLR131C ACE2 Transcription factor that activates
           expression of early G1-specific genes localizes to
           daughter cell nuclei after cytokinesis and delays G1
           progression in daughters localization is regulated by
           phosphorylation potential Cdc28p substrate
          Length = 746

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 451 KEKKQVSYQC--PVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTK 508
           KE    +++C  P CGK+  R  ++ SH+  H   RPY C +  CNK F    +L RH K
Sbjct: 576 KELPDKTFECLHPDCGKNFRRRYNIRSHIQTHLEDRPYICDFPDCNKAFVRNHDLIRHKK 635

Query: 509 LHIKK 513
            H +K
Sbjct: 636 THAEK 640

>ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {ON}
           some similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 171

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 31/60 (51%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK 517
           ++C +C +   R      H+  HT  +P+KC + GC K+F+    L RH + H    Q+K
Sbjct: 14  FRCEICNRGFHRLEHKKRHIRTHTGEKPHKCSFPGCGKSFSRSDELKRHLRTHTGTSQRK 73

>KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some
           similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 596

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 33/64 (51%), Gaps = 2/64 (3%)

Query: 452 EKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHI 511
           +K    Y C +C K  +R  +L SH+  HT+ RPY C    C K F    + NRH  LH 
Sbjct: 463 QKHPAVYACDICDKKFTRPYNLKSHLRSHTDERPYVCSV--CGKAFARMHDKNRHEDLHT 520

Query: 512 KKQQ 515
            K++
Sbjct: 521 GKRR 524

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 29/65 (44%), Gaps = 9/65 (13%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKC--------QWEGCNKTFNVKSNLNRHTKL 509
           Y C VCGK+ +R    + H  +HT  R Y C         W GC K F     L RH K 
Sbjct: 497 YVCSVCGKAFARMHDKNRHEDLHTGKRRYVCGGILKNGNSW-GCGKKFARSDALGRHFKT 555

Query: 510 HIKKQ 514
            + K+
Sbjct: 556 ELGKK 560

>Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa]
           {ON} (16151..16525,16527..17390) [1239 nt, 413 aa]
          Length = 412

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 1/60 (1%)

Query: 451 KEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           KEK +  + CP+C ++  R      HM  HT  +P++C + GC K F+    L RH ++H
Sbjct: 33  KEKPR-PHVCPICNRAFHRLEHQTRHMRTHTGEKPHECDFPGCVKKFSRSDELTRHRRIH 91

>NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON}
           Anc_2.162
          Length = 839

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           YQC  CGK  ++  +L +H  +HT  +PY+C  E C+K F+ K NL  H   H K
Sbjct: 543 YQCGYCGKRFTQGGNLRTHQRLHTGEKPYEC--ELCDKKFSRKGNLAAHLLTHQK 595

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 28/49 (57%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRH 506
           Y+C +C K  SR  +L +H+  H   +P+ C+ + CN++F    N+  H
Sbjct: 571 YECELCDKKFSRKGNLAAHLLTHQKVKPFICKLDNCNRSFTQLGNMKAH 619

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           ++CP C +  ++++ L  H+  H   +PY+C +  C K F    NL  H +LH
Sbjct: 515 HKCPYCHRLFAQSTHLEVHIRSHLGYKPYQCGY--CGKRFTQGGNLRTHQRLH 565

>KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {ON}
           some similarities with uniprot|P27705 Saccharomyces
           cerevisiae YGL035C
          Length = 460

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (51%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHI 511
           Y CP+C ++  R      H+  HT  +P+ C + GC K F+    L RH ++H 
Sbjct: 26  YICPICSRAFHRLEHQTRHIRTHTGEKPHACDFPGCTKKFSRSDELTRHKRIHT 79

>TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {ON}
           Anc_2.162 YOR113W
          Length = 823

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           YQC  CGK  ++  +L +H  +HT  +PY C+   CNK F+ K NL  H   H K
Sbjct: 545 YQCNFCGKKFTQGGNLKTHQRLHTGEKPYSCKI--CNKRFSRKGNLTAHVLTHKK 597

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRH 506
           Y C +C K  SR  +L +H+  H   +PY C+ + CNKTF    N+  H
Sbjct: 573 YSCKICNKRFSRKGNLTAHVLTHKKLKPYFCKLDNCNKTFTQLGNMKAH 621

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 454 KQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           K+ ++QCP C +  S+++ L  H+  H   +PY+C +  C K F    NL  H +LH
Sbjct: 513 KKKTHQCPYCHRFFSQSTHLEVHIRSHIGYKPYQCNF--CGKKFTQGGNLKTHQRLH 567

>Kpol_505.15 s505 (42259..43791) [1533 bp, 510 aa] {ON}
           (42259..43791) [1533 nt, 511 aa]
          Length = 510

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHT-KLH 510
           Y+C +C K  SR  +L +H+  H   +PY C+ +GCNK F    N+  H  K H
Sbjct: 405 YECHICNKRFSRKGNLTAHVITHKKLKPYICKVDGCNKKFTQLGNMKVHQNKFH 458

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           ++C  C K  S+  +L++H  +HT  RPY+C    CNK F+ K NL  H   H K
Sbjct: 377 HKCAYCDKRFSQTGNLNTHQRLHTGERPYECHI--CNKRFSRKGNLTAHVITHKK 429

>SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 385

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 1/72 (1%)

Query: 446 FQYPNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNR 505
            +YP  +  Q  Y+C +C K   R      H+  HT  +P+ C + GC K F+    L R
Sbjct: 14  MEYP-ADNDQRPYKCELCNKGFHRLEHKRRHIRTHTGEKPHACTFPGCMKRFSRSDELKR 72

Query: 506 HTKLHIKKQQKK 517
           H ++H    ++K
Sbjct: 73  HLRIHTNTSKRK 84

>Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113W
           (REAL)
          Length = 909

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRH 506
           Y C +C K  SR  +L +H+  H   +P+ C+ E CNKTF    N+  H
Sbjct: 639 YSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAH 687

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           + C  CGK  ++  +L +H  +HT  +PY C    C+K F+ K NL  H   H K
Sbjct: 611 FVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQK 663

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           ++CP C +  S+A+ L  H+  H   +P+ C +  C K F    NL  H +LH
Sbjct: 583 HECPYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLH 633

>KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 782

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHT-KLHIK 512
           Y+C  CG+  SR  +L +H   H N +P++C+ + CNK F    N+  H  + H++
Sbjct: 579 YECERCGRKFSRKGNLAAHKLTHDNLKPFECKLDDCNKNFTQLGNMKAHQNRFHLQ 634

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           + C  CGK  ++  +L +H+ +HT  +PY+C  E C + F+ K NL  H   H
Sbjct: 551 FSCEFCGKRFTQGGNLRTHIRLHTGEKPYEC--ERCGRKFSRKGNLAAHKLTH 601

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 451 KEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           K K    +QCP C K  ++++ L  H+  H   +P+ C++  C K F    NL  H +LH
Sbjct: 516 KSKGVKQFQCPYCHKYFTQSTHLEVHVRSHIGYKPFSCEF--CGKRFTQGGNLRTHIRLH 573

>TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 32/60 (53%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK 517
           + C +C K   R      H+  HT  +P+ C ++GC K F+    L RH K+H+ K++ +
Sbjct: 13  FICDICSKGFRRLEHKKRHIRTHTGEKPHHCTFKGCVKKFSRSDELKRHLKIHVNKKKNR 72

>Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113W
           (REAL)
          Length = 917

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRH 506
           Y C +C K  SR  +L +H+  H   +P+ C+ E CNKTF    N+  H
Sbjct: 650 YSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAH 698

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           + C  CGK  ++  +L +H  +HT  +PY C    C+K F+ K NL  H   H K
Sbjct: 622 FVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQK 674

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           ++CP C +  S+A+ L  H+  H   +P+ C +  C K F    NL  H +LH
Sbjct: 594 HECPYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLH 644

>YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}
           AZF1Zinc-finger transcription factor, involved in
           induction of CLN3 transcription in response to glucose;
           genetic and physical interactions indicate a possible
           role in mitochondrial transcription or genome
           maintenance
          Length = 914

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRH 506
           Y C +C K  SR  +L +H+  H   +P+ C+ E CNKTF    N+  H
Sbjct: 649 YSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAH 697

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           + C  CGK  ++  +L +H  +HT  +PY C    C+K F+ K NL  H   H K
Sbjct: 621 FVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQK 673

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQ 514
           ++CP C +  S+A+ L  H+  H   +P+ C +  C K F    NL  H +LH  ++
Sbjct: 593 HECPYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLHTGEK 647

>KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON} 
          Length = 467

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 29/49 (59%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRH 506
           YQC  CG+  SR  +L +H+  H N +P+ C+ + C+K+F    N+  H
Sbjct: 358 YQCESCGRRFSRKGNLAAHILTHKNLKPFVCKLDNCDKSFTQLGNMKAH 406

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           +QC  CGK  ++  +L +H  +HT  +PY+C  E C + F+ K NL  H   H
Sbjct: 330 FQCQFCGKKFTQGGNLRTHQRLHTGEKPYQC--ESCGRRFSRKGNLAAHILTH 380

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           ++CP C +  S+++ L  H+  H   +P++CQ+  C K F    NL  H +LH
Sbjct: 302 HECPYCHRLFSQSTHLEVHIRSHIGYKPFQCQF--CGKKFTQGGNLRTHQRLH 352

>Kpol_1035.22 s1035 (53205..55598) [2394 bp, 797 aa] {ON}
           (53205..55598) [2394 nt, 798 aa]
          Length = 797

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 38/72 (52%), Gaps = 2/72 (2%)

Query: 442 QKNMFQYPNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKS 501
           ++N+ Q+      +  + C +CG   S  S L  H+ IHT  +P  C+   C K F+  S
Sbjct: 689 EENLIQHKRTHSGEKPFVCQICGSKFSSPSYLKVHIRIHTGEKPLSCK--VCGKKFSSSS 746

Query: 502 NLNRHTKLHIKK 513
           NLN+H K H KK
Sbjct: 747 NLNKHYKTHYKK 758

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 4/61 (6%)

Query: 452 EKKQVSYQCPV--CGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKL 509
           E  Q  Y+C    CG   ++   +  H+ +H+  +P+KC  E CNKTF  + NL +H + 
Sbjct: 641 ESGQSEYRCLWKDCGHKFTQRQKILRHIRVHSGFKPFKC--ESCNKTFASEENLIQHKRT 698

Query: 510 H 510
           H
Sbjct: 699 H 699

 Score = 34.7 bits (78), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 4/49 (8%)

Query: 460 CPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTK 508
           C VCGK  S +S+L+ H    T+ + YKCQ  GC  +F  K     H K
Sbjct: 735 CKVCGKKFSSSSNLNKHY--KTHYKKYKCQ--GCLSSFTDKDKFETHLK 779

>Ecym_1415 Chr1 complement(863049..864563) [1515 bp, 504 aa] {ON}
           similar to Ashbya gossypii AFR471C
          Length = 504

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           Y CP+C ++  R      H+  HT  +P+ C + GC K F+ +  L RH ++H
Sbjct: 22  YVCPICSRAFHRLEHQTRHIRTHTGEKPHGCDFIGCGKKFSRRDELARHRRIH 74

>TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.303
           YNL027W
          Length = 532

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 34/66 (51%), Gaps = 2/66 (3%)

Query: 450 NKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKL 509
           N +K    Y C +C K  +R  +L SH+  HTN RP+ C    C K F  + +  RH  L
Sbjct: 412 NSKKNPSIYDCVICEKKFTRPYNLRSHLRTHTNERPFVCTV--CGKAFAREHDRKRHEDL 469

Query: 510 HIKKQQ 515
           H  K++
Sbjct: 470 HTGKKR 475

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 27/65 (41%), Gaps = 9/65 (13%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKC--------QWEGCNKTFNVKSNLNRHTKL 509
           + C VCGK+ +R      H  +HT  + Y C         W GC K F     L RH K 
Sbjct: 448 FVCTVCGKAFAREHDRKRHEDLHTGKKRYICGGKLKSGEAW-GCGKKFARSDALGRHFKT 506

Query: 510 HIKKQ 514
              K+
Sbjct: 507 ESGKK 511

>ZYRO0F10428g Chr6 complement(846822..849263) [2442 bp, 813 aa] {ON}
           similar to uniprot|P21192 Saccharomyces cerevisiae
           YLR131C ACE2 Transcription factor that activates
           expression of early G1-specific genes localizes to
           daughter cell nuclei after cytokinesis and delays G1
           progression in daughters localization is regulated by
           phosphorylation potential Cdc28p substrate
          Length = 813

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 29/51 (56%)

Query: 463 CGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKK 513
           CGK   R  ++ SH+  H   RPY C +EGC+K F    +L RH K H +K
Sbjct: 634 CGKIFKRRYNIRSHIQTHLEDRPYMCDFEGCDKAFVRNHDLVRHKKSHAEK 684

>Kpol_344.4 s344 complement(5351..7621) [2271 bp, 756 aa] {ON}
           complement(5351..7621) [2271 nt, 757 aa]
          Length = 756

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 37/66 (56%), Gaps = 2/66 (3%)

Query: 451 KEKKQVSYQC--PVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTK 508
           KE  + +Y+C  P C K   R  ++ SH+  H   RPY C ++ CNK+F    +L RH K
Sbjct: 573 KELSERAYECLYPNCHKIFKRRYNIRSHIQTHLKDRPYICDFQECNKSFVRNHDLVRHKK 632

Query: 509 LHIKKQ 514
            H K++
Sbjct: 633 SHSKRK 638

>NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa]
           {ON} Anc_1.326
          Length = 836

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           +QC +C K  + ASSL  H+  HT  +P KC+   C K FN  SNL++H K H K
Sbjct: 766 FQCHLCDKRFTIASSLKIHIRTHTGEKPLKCKI--CGKAFNESSNLSKHIKTHFK 818

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           +CPVC K  S   +L  H   HT  +P++C    C+K F + S+L  H + H
Sbjct: 739 KCPVCNKCFSNLETLKQHQRTHTGEKPFQCHL--CDKRFTIASSLKIHIRTH 788

 Score = 34.3 bits (77), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 16/25 (64%)

Query: 486 YKCQWEGCNKTFNVKSNLNRHTKLH 510
           Y+C W GC+K F  +  + RH K+H
Sbjct: 708 YQCHWHGCSKKFTQRQKMVRHLKVH 732

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 4/60 (6%)

Query: 453 KKQVSYQCPV--CGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           K Q  YQC    C K  ++   +  H+ +H+  +P KC    CNK F+    L +H + H
Sbjct: 703 KGQSQYQCHWHGCSKKFTQRQKMVRHLKVHSGYKPCKC--PVCNKCFSNLETLKQHQRTH 760

>KAFR0B05740 Chr2 complement(1184382..1186241) [1860 bp, 619 aa]
           {ON} Anc_8.326 YLR131C
          Length = 619

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 451 KEKKQVSYQCPV--CGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTK 508
           KE    +++C    CGK+  R  ++ SH+  H   RPY C + GC+K F    +L RH K
Sbjct: 461 KELPDKNFECLFENCGKTFKRRYNIRSHIQTHLEDRPYPCDFPGCDKAFVRNHDLVRHKK 520

Query: 509 LHIKK 513
            H +K
Sbjct: 521 SHFEK 525

>KLLA0A10373g Chr1 complement(907244..907864) [621 bp, 206 aa] {ON}
           some similarities with uniprot|P32805 Saccharomyces
           cerevisiae YGL254W FZF1 Transcription factor involved in
           sulfite metabolism sole identified regulatory target is
           SSU1 overexpression suppresses sulfite-sensitivity of
           many unrelated mutants due to hyperactivation of SSU1
           contains five zinc fingers
          Length = 206

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 33/63 (52%), Gaps = 2/63 (3%)

Query: 452 EKKQVSYQCPV--CGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKL 509
           EK+   Y CP+  CGK  SR   L  H+  HTN +P+ C   GC+K F   S+L  H   
Sbjct: 2   EKRPKRYVCPIESCGKKYSRPCLLRQHVRSHTNEKPFHCPEPGCDKAFLRPSHLRVHMLS 61

Query: 510 HIK 512
           H K
Sbjct: 62  HSK 64

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 25/54 (46%), Gaps = 2/54 (3%)

Query: 461 PVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQ 514
           P C K+  R S L  HM  H+  +PY C    C K F  K    RH + H + Q
Sbjct: 43  PGCDKAFLRPSHLRVHMLSHSKVKPYNC--SVCGKGFATKQQFQRHQQTHTQNQ 94

>NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {ON}
           Anc_3.518
          Length = 524

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 30/60 (50%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK 517
           ++C VC +   R      HM  HT  +P+ C + GC K+F+    L RH + H    Q+K
Sbjct: 18  FKCDVCSRGFHRLEHKKRHMRTHTGEKPHHCNFPGCGKSFSRSDELKRHLRTHTSTSQRK 77

>TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {ON}
           Anc_8.326 YLR131C
          Length = 743

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 451 KEKKQVSYQC--PVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTK 508
           KE     ++C  P C K   R  ++ SH+  H   RPY C +EGC+K F    +L RH K
Sbjct: 564 KELPDRIFECMYPNCNKVFKRRYNIRSHIQTHLEDRPYVCDFEGCDKAFVRNHDLVRHKK 623

Query: 509 LHIKK 513
            H +K
Sbjct: 624 SHAEK 628

>KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.303
           YNL027W
          Length = 519

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 34/66 (51%), Gaps = 2/66 (3%)

Query: 450 NKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKL 509
           N +K    Y C VC K  +R  +L SH+  HTN RP+ C    C K F  + +  RH  L
Sbjct: 389 NSKKNPQLYTCEVCDKKFTRPYNLKSHLRTHTNERPFACTI--CGKAFARQHDRKRHEDL 446

Query: 510 HIKKQQ 515
           H  K++
Sbjct: 447 HSGKKR 452

 Score = 37.7 bits (86), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 25/59 (42%), Gaps = 9/59 (15%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKC--------QWEGCNKTFNVKSNLNRHTK 508
           + C +CGK+ +R      H  +H+  + Y C         W GC K F     L RH K
Sbjct: 425 FACTICGKAFARQHDRKRHEDLHSGKKRYACGGKLKSGIPW-GCGKKFARSDALGRHFK 482

>CAGL0I02816g Chr9 complement(247817..248692) [876 bp, 291 aa] {OFF}
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113w AZF1 asparagine-rich zinc finger protein
          Length = 291

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRH-TKLHI 511
           Y+C +C K  SR  +L +H   H   RP+ C+ + CNK+F+   N+  H  K H+
Sbjct: 11  YECDICKKRFSRKGNLAAHKMTHGKIRPFICKLDNCNKSFSQLGNMKSHQNKFHL 65

>YER028C Chr5 complement(210692..211876) [1185 bp, 394 aa] {ON}
           MIG3Probable transcriptional repressor involved in
           response to toxic agents such as hydroxyurea that
           inhibit ribonucleotide reductase; phosphorylation by
           Snf1p or the Mec1p pathway inactivates Mig3p, allowing
           induction of damage response genes
          Length = 394

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%)

Query: 455 QVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQ 514
           Q  ++C +C +   R      H   HT  +P+KC  +GC K+F+    L RH + H K  
Sbjct: 14  QRPFRCEICSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTHTKGV 73

Query: 515 QKK 517
           Q++
Sbjct: 74  QRR 76

>KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.162
           YOR113W
          Length = 572

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           Y+C  CGK  ++  +L +H+ +HT  +P+ C++  C+K F+ K NL  H   H K
Sbjct: 416 YKCTWCGKGFTQGGNLKTHVRLHTGEKPFSCEF--CSKRFSRKGNLTAHLVTHEK 468

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRH 506
           + C  C K  SR  +L +H+  H   RP+ C+  GC KTF    N+  H
Sbjct: 444 FSCEFCSKRFSRKGNLTAHLVTHEKVRPFVCKLNGCMKTFTQLGNMKSH 492

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           ++C +C K   + + L  H+  H   +PYKC W  C K F    NL  H +LH
Sbjct: 388 HECNICHKLFIQLTHLEVHLRSHLGDKPYKCTW--CGKGFTQGGNLKTHVRLH 438

>NCAS0A09160 Chr1 (1811448..1813769) [2322 bp, 773 aa] {ON}
           Anc_1.326
          Length = 773

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKK 513
           ++C +CGK  + +SSL  H+  HT  +P  C+   C K FN  SNL++H K H+K+
Sbjct: 695 FKCDICGKRFAISSSLKIHIRTHTGEKPLHCKI--CGKAFNESSNLSKHMKTHLKR 748

 Score = 35.0 bits (79), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 3/51 (5%)

Query: 463 CGKSVSRASSLHSHM---FIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           C  S S A  L+ HM    +      Y+C W  C+K F+ +  L RH ++H
Sbjct: 611 CSGSFSSAQELNIHMENMHLLKGQSQYECHWANCHKIFSQRQRLVRHMRVH 661

 Score = 34.7 bits (78), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 4/47 (8%)

Query: 460 CPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRH 506
           C +CGK+ + +S+L  HM  H   + +KC  E C  +FN  S L  H
Sbjct: 725 CKICGKAFNESSNLSKHMKTH--LKRFKC--EKCEASFNTVSKLRSH 767

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 4/60 (6%)

Query: 453 KKQVSYQCPV--CGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           K Q  Y+C    C K  S+   L  HM +H+  +P++C    C K F+ +  L +H + H
Sbjct: 632 KGQSQYECHWANCHKIFSQRQRLVRHMRVHSGYKPFQCSI--CKKHFSNEETLKQHERTH 689

>KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON}
           Anc_2.533 YMR070W
          Length = 352

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 451 KEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKL 509
           K     SY CP C KS  R++ L  H   HTN+ P+KC W  C      + N+ +H KL
Sbjct: 243 KPPTMTSYPCPQCPKSFQRSAWLKRHSITHTNSHPFKCVW--CKSEHKRRDNMFKHMKL 299

>TPHA0K01770 Chr11 (374701..376257) [1557 bp, 518 aa] {ON} Anc_4.80
           YGL035C
          Length = 518

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%)

Query: 460 CPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           C  CG++  R      HM  HT  +P+ C ++GC K F+    L RH ++H
Sbjct: 71  CGTCGRAFHRLEHQTRHMRTHTGEKPHACDFQGCTKRFSRSDELTRHKRIH 121

>Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON}
           (58087..59160) [1074 nt, 358 aa]
          Length = 357

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 35/61 (57%)

Query: 454 KQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKK 513
           K+  Y C VC K ++ +  L  H  IHT  + + C +EGCN+ F+   N  +H + H+KK
Sbjct: 297 KRRKYICRVCSKGLTTSGHLARHYRIHTGEKNHFCPYEGCNQRFSRHDNCIQHYRTHLKK 356

Query: 514 Q 514
           +
Sbjct: 357 R 357

>TPHA0G03750 Chr7 complement(794102..795142) [1041 bp, 346 aa] {ON} 
          Length = 346

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 30/60 (50%), Gaps = 2/60 (3%)

Query: 453 KKQVSYQCPV--CGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           K+   Y+C    CGK   R S L  H + HTN RPY CQ+E C K F    +L  H   H
Sbjct: 9   KRFKKYRCTYEGCGKIYDRPSLLQQHRYSHTNERPYACQYENCGKKFMRPCHLRVHEWTH 68

>NDAI0G00720 Chr7 complement(155060..157186) [2127 bp, 708 aa] {ON}
           Anc_2.303 YNL027W
          Length = 708

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQ 515
           Y C +C K+ +R  +L SH+  HTN +P+ C+   CNK F  + +  RH  LH  K++
Sbjct: 580 YICELCNKTFTRPYNLKSHLRTHTNEKPFICKI--CNKAFARQHDRKRHEDLHTGKKR 635

 Score = 35.0 bits (79), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 26/65 (40%), Gaps = 9/65 (13%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKC--------QWEGCNKTFNVKSNLNRHTKL 509
           + C +C K+ +R      H  +HT  + Y C         W GC K F     L RH K 
Sbjct: 608 FICKICNKAFARQHDRKRHEDLHTGKKRYICGGKLKNGDTW-GCGKKFARSDALGRHFKT 666

Query: 510 HIKKQ 514
              K+
Sbjct: 667 ESGKK 671

>KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some
           similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 526

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 2/64 (3%)

Query: 452 EKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHI 511
           +K    Y C +C K  +R  +L SH+  HT+ RP+ C    C K F  + +  RH  LH 
Sbjct: 402 QKNPAVYACELCDKKFTRPYNLKSHLRTHTDERPFACAI--CGKAFARQHDRKRHEDLHT 459

Query: 512 KKQQ 515
            K++
Sbjct: 460 GKKR 463

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 28/65 (43%), Gaps = 9/65 (13%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKC--------QWEGCNKTFNVKSNLNRHTKL 509
           + C +CGK+ +R      H  +HT  + Y C        QW GC K F     L RH K 
Sbjct: 436 FACAICGKAFARQHDRKRHEDLHTGKKRYTCKGKLKDGTQW-GCGKKFARSDALGRHFKT 494

Query: 510 HIKKQ 514
              K+
Sbjct: 495 EGGKR 499

>Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa]
           {ON} complement(264361..265350) [990 nt, 330 aa]
          Length = 329

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           Y C VCGK ++ +  L  H  IHT  + + C +EGCN+ F+ + N ++H + H
Sbjct: 263 YYCRVCGKGLTTSGHLSRHYRIHTGEKKHCCPFEGCNQRFSRRDNCSQHYQTH 315

>KNAG0A05170 Chr1 (761499..763436) [1938 bp, 645 aa] {ON} Anc_8.326
           YLR131C
          Length = 645

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 33/65 (50%), Gaps = 2/65 (3%)

Query: 451 KEKKQVSYQC--PVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTK 508
           KE    S++C  P C K   R  ++ SH+  H   RPY C + GC K F    +L RH K
Sbjct: 505 KELPDKSFECLYPECKKLFKRRYNIRSHIQTHLEDRPYTCDFPGCTKAFVRNHDLVRHKK 564

Query: 509 LHIKK 513
            H +K
Sbjct: 565 SHSEK 569

>TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.326
           YJL056C
          Length = 985

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 40/69 (57%), Gaps = 2/69 (2%)

Query: 442 QKNMFQYPNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKS 501
           ++ + Q+      +  Y+C +CGKS S +SSL  H+  HT  +P++C+   C K F   S
Sbjct: 912 KETLIQHYRTHSGEKPYKCEICGKSFSISSSLKIHVRTHTGEKPFECK--VCGKRFVESS 969

Query: 502 NLNRHTKLH 510
           N ++H K+H
Sbjct: 970 NYSKHMKVH 978

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           ++C VC +  S   +L  H   H+  +PYKC  E C K+F++ S+L  H + H
Sbjct: 900 FKCDVCSRCFSSKETLIQHYRTHSGEKPYKC--EICGKSFSISSSLKIHVRTH 950

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 4/56 (7%)

Query: 457 SYQCPV--CGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           SY+C    C K   +   +  H+  H+  +P+KC  + C++ F+ K  L +H + H
Sbjct: 869 SYECKWHNCHKVFKQRQKILRHLKTHSGFKPFKC--DVCSRCFSSKETLIQHYRTH 922

>Smik_10.184 Chr10 complement(322050..324707) [2658 bp, 885 aa] {ON}
           YJL056C (REAL)
          Length = 885

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 40/72 (55%), Gaps = 2/72 (2%)

Query: 442 QKNMFQYPNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKS 501
           ++ + Q+      +  Y+C +C K  S +SSL  H+  HT  +P +C+   C K FN  S
Sbjct: 783 EETLVQHTRTHSGEKPYKCDICNKKFSISSSLKIHIRTHTGEKPLQCKI--CGKRFNESS 840

Query: 502 NLNRHTKLHIKK 513
           NL++H K H KK
Sbjct: 841 NLSKHIKTHKKK 852

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           Y+C  C +  S   +L  H   H+  +PYKC  + CNK F++ S+L  H + H
Sbjct: 771 YKCKTCKRCFSSEETLVQHTRTHSGEKPYKC--DICNKKFSISSSLKIHIRTH 821

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 36/72 (50%), Gaps = 3/72 (4%)

Query: 449 PNKEKKQVSYQCPVCGKSVSRASSLHSHM-FIHTN--ARPYKCQWEGCNKTFNVKSNLNR 505
           P K+ +QV  Q   C  S S A  L+ H+  +H       Y+C W  C++TF  +  L R
Sbjct: 701 PLKQPEQVVCQWNNCNTSFSNAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIR 760

Query: 506 HTKLHIKKQQKK 517
           H K+H K +  K
Sbjct: 761 HLKVHSKYKPYK 772

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 458 YQCPV--CGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           YQC    C ++  +   L  H+ +H+  +PYKC+   C + F+ +  L +HT+ H
Sbjct: 741 YQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCK--TCKRCFSSEETLVQHTRTH 793

>TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa]
           {ON} Anc_4.80 YGL035C
          Length = 390

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%)

Query: 460 CPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           CPVC ++  R      H+  HT  +P+ C + GC K F+    L RH ++H
Sbjct: 74  CPVCNRAFHRLEHQTRHIRTHTGEKPHSCDFPGCTKKFSRSDELTRHKRIH 124

>Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W
           (REAL)
          Length = 948

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRH 506
           Y C +C K  SR  +L +H+  H   +P+ C+ E C+KTF    N+  H
Sbjct: 680 YSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCDKTFTQLGNMKAH 728

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           + C  CGK  ++  +L +H  +HT  +PY C    C+K F+ K NL  H   H K
Sbjct: 652 FACDYCGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQK 704

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQ 514
           ++CP C +  S+A+ L  H+  H   +P+ C +  C K F    NL  H +LH  ++
Sbjct: 624 HECPYCHRLFSQATHLEVHVRSHIGYKPFACDY--CGKRFTQGGNLRTHERLHTGEK 678

>Suva_2.307 Chr2 complement(544040..546115) [2076 bp, 691 aa] {ON}
           YDR146C (REAL)
          Length = 691

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 451 KEKKQVSYQC--PVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTK 508
           KE    S++C  P C K+  R  ++ SH+  H   RPY C   GC+K F    +L RH K
Sbjct: 525 KEMPDKSFECLYPGCAKTFKRRYNIRSHIQTHLEDRPYSCDNPGCDKAFVRNHDLIRHKK 584

Query: 509 LHIKK 513
            H +K
Sbjct: 585 SHQEK 589

>Smik_4.390 Chr4 complement(709330..711456) [2127 bp, 708 aa] {ON}
           YDR146C (REAL)
          Length = 708

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 451 KEKKQVSYQC--PVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTK 508
           KE    +++C  P C K+  R  ++ SH+  H   RPY C   GCNK F    +L RH K
Sbjct: 542 KEMPDKTFECLYPECTKTFKRRYNIRSHIQTHLEDRPYSCDHPGCNKAFVRNHDLIRHKK 601

Query: 509 LHIKK 513
            H +K
Sbjct: 602 SHQEK 606

>CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa]
           {ON} weakly similar to uniprot|Q03125 Saccharomyces
           cerevisiae YDR043c NRG1
          Length = 463

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKK 513
           Y C VCGK  + +  L  H  IHT  + + C +EGC + FN   N  +H K H+K+
Sbjct: 402 YLCKVCGKGFTTSGHLARHNRIHTGEKRHVCPYEGCGQRFNRHDNCLQHYKTHLKR 457

>Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON}
           YER028C (REAL)
          Length = 394

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 31/60 (51%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK 517
           ++C +C +   R      H+  HT  +PYKC  + C K+F+    L RH + H +  Q++
Sbjct: 17  FRCEICSRGFHRLEHKKRHVRTHTGEKPYKCSSKNCTKSFSRSDELKRHFRTHTRTVQRR 76

>NCAS0B03600 Chr2 complement(637749..639656) [1908 bp, 635 aa] {ON}
           Anc_8.326
          Length = 635

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 451 KEKKQVSYQC--PVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTK 508
           KE    +++C  P CGK   R  +  SH+  H   RPY C +  C+K F    +L RH K
Sbjct: 482 KELPDKTFECLYPNCGKHFKRRYNTRSHIQTHLEDRPYACDFPNCDKAFVRNHDLVRHKK 541

Query: 509 LHIKK 513
           +H +K
Sbjct: 542 VHSEK 546

>TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.80
           YGL035C
          Length = 350

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%)

Query: 460 CPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           CP+C ++  R      H+  HT  +P+ C + GC K F+    L RH ++H
Sbjct: 31  CPICQRAFRRLEHQTRHLRTHTGEKPHACDFPGCAKRFSRSDELTRHRRIH 81

>NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303
          Length = 571

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 457 SYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQ 515
           +Y C +C K+ +R  +L SH+  HTN +P+ C    C K F  + +  RH  LH  K++
Sbjct: 451 AYACELCDKTFTRPYNLKSHLRTHTNEKPFVCNI--CGKAFARQHDRKRHEDLHTGKKR 507

 Score = 37.4 bits (85), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 26/59 (44%), Gaps = 9/59 (15%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKC--------QWEGCNKTFNVKSNLNRHTK 508
           + C +CGK+ +R      H  +HT  + Y C         W GC+K F     L RH K
Sbjct: 480 FVCNICGKAFARQHDRKRHEDLHTGKKRYVCGGVLKNGTPW-GCHKKFARSDALGRHFK 537

>Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa]
           {ON} YPR186C (PZF1) - Transcription factor IIIA (TFIIIA)
           with putative Zn-fingers [contig 8] FULL
          Length = 429

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           +QC VC +  SR + L  HMF H+  +P+KC +  C K    K  L RH   H +
Sbjct: 81  FQCTVCARQFSRKTHLERHMFSHSEDKPFKCSY--CGKGVTTKQQLRRHEITHTR 133

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 3/57 (5%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHT-KLHIKK 513
           ++C  CGK V+    L  H   HT  R + C  EGC ++F     L  H    H++K
Sbjct: 109 FKCSYCGKGVTTKQQLRRHEITHT--RSFVCPHEGCEESFYKHPQLRAHILAFHLQK 163

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 4/44 (9%)

Query: 459 QCPVCGKSVSRASSLHSHMFIHTNA--RPYKCQWEGCNKTFNVK 500
           QCP CGK+      L  HM IH+NA  + +KC  E CN  +  K
Sbjct: 224 QCPECGKACVGEQGLQMHMKIHSNAVIKNWKC--ETCNDLYFAK 265

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 3/52 (5%)

Query: 460 CPVCGKSVSRASSLHSHMFIHTN---ARPYKCQWEGCNKTFNVKSNLNRHTK 508
           C +CGK   R   L +H+  H N    + Y+C    C + F   S L +H K
Sbjct: 166 CEICGKRFQRPYRLKNHIAKHHNPDVVQKYQCSQGSCIEAFKTWSALQQHMK 217

>KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {ON}
           Anc_3.518 YGL209W
          Length = 416

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 34/67 (50%)

Query: 451 KEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           K+  +  ++C +C +   R    + H+  HT  +P++C + GC K F+    L RH K H
Sbjct: 11  KDNDRRPFKCDICSRGFHRLEHKNRHIMTHTGEKPHQCSFPGCVKKFSRGDELKRHAKTH 70

Query: 511 IKKQQKK 517
               ++K
Sbjct: 71  TSSTRRK 77

>SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {ON}
           some similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 548

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 2/64 (3%)

Query: 452 EKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHI 511
           +K    Y C +C K  +R  +L SH+  HT+ RP+ C    C K F  + +  RH  LH 
Sbjct: 418 QKNPAIYACELCDKKFTRPYNLKSHLRTHTDERPFACNV--CGKAFARQHDRKRHEDLHT 475

Query: 512 KKQQ 515
            K++
Sbjct: 476 GKKR 479

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 25/59 (42%), Gaps = 9/59 (15%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKC--------QWEGCNKTFNVKSNLNRHTK 508
           + C VCGK+ +R      H  +HT  + Y C         W GC K F     L RH K
Sbjct: 452 FACNVCGKAFARQHDRKRHEDLHTGKKRYICGGNLKDGTSW-GCGKKFARSDALGRHFK 509

>KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.303
           YNL027W
          Length = 618

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 33/66 (50%), Gaps = 2/66 (3%)

Query: 450 NKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKL 509
           N  K    Y C +C K  +R  +L SH+  HTN RP+ C    C K F  + +  RH  L
Sbjct: 491 NVRKNPAIYACDMCDKKFTRPYNLKSHLRTHTNERPFVCSI--CGKAFARQHDRKRHEDL 548

Query: 510 HIKKQQ 515
           H  K++
Sbjct: 549 HSGKKR 554

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 28/65 (43%), Gaps = 9/65 (13%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKC--------QWEGCNKTFNVKSNLNRHTKL 509
           + C +CGK+ +R      H  +H+  + Y C        +W GC K F     L RH K 
Sbjct: 527 FVCSICGKAFARQHDRKRHEDLHSGKKRYICGGTLKDGTKW-GCGKKFARSDALGRHFKT 585

Query: 510 HIKKQ 514
              K+
Sbjct: 586 EAGKR 590

>NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518
          Length = 401

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 28/60 (46%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK 517
           ++C  C +   R      HM  HT  +P+ C + GC K F+    L RH + H    Q++
Sbjct: 18  FRCETCARGFHRLEHKKRHMRTHTGEKPHHCAFPGCGKGFSRSDELKRHLRTHTSTSQRR 77

>ZYRO0G09438g Chr7 complement(752797..753786) [990 bp, 329 aa] {ON}
           some similarities with uniprot|P27705 Saccharomyces
           cerevisiae YGL035C
          Length = 329

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 35/75 (46%), Gaps = 3/75 (4%)

Query: 445 MFQYPNK---EKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKS 501
           M + P K   E     + CP+C ++  R      HM  HT  +P+ C ++ C K F+   
Sbjct: 1   MTETPRKNNGEHAPRPHVCPICHRAFHRLEHQTRHMRTHTGEKPHVCDFKNCGKRFSRSD 60

Query: 502 NLNRHTKLHIKKQQK 516
            L RH ++H   Q +
Sbjct: 61  ELTRHRRIHTNPQPR 75

>Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa]
           {ON} YGL209W (MIG2) - 1:1 [contig 188] FULL
          Length = 266

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 30/60 (50%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK 517
           ++C +CGK   R      H+  HT  +P+ C + GC K F+    L RH + H+   + K
Sbjct: 14  FKCDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRHVRTHMSTSRGK 73

>Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C
           (REAL)
          Length = 878

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 40/72 (55%), Gaps = 2/72 (2%)

Query: 442 QKNMFQYPNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKS 501
           ++ + Q+      +  Y+C +C K  + +SSL  H+  HT  +P +C+   C K FN  S
Sbjct: 778 EETLVQHTRTHSGEKPYKCHICDKKFAISSSLKIHIRTHTGEKPLQCKI--CGKRFNESS 835

Query: 502 NLNRHTKLHIKK 513
           NL++H K H KK
Sbjct: 836 NLSKHIKTHKKK 847

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 3/72 (4%)

Query: 449 PNKEKKQVSYQCPVCGKSVSRASSLHSHM---FIHTNARPYKCQWEGCNKTFNVKSNLNR 505
           P K+ +QV  Q   C K  + A  L++H+    +      Y+C W  C++TF  +  L R
Sbjct: 696 PFKQPEQVICQWDGCNKQFTNAQELNNHLESVHLTRGKSEYQCLWHDCHRTFPQRQKLIR 755

Query: 506 HTKLHIKKQQKK 517
           H K+H K +  K
Sbjct: 756 HLKVHSKYKPYK 767

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 458 YQCPV--CGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           YQC    C ++  +   L  H+ +H+  +PYKC+   C + F+ +  L +HT+ H
Sbjct: 736 YQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCK--TCKRCFSSEETLVQHTRTH 788

>Skud_4.405 Chr4 complement(720227..722350) [2124 bp, 707 aa] {ON}
           YDR146C (REAL)
          Length = 707

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 451 KEKKQVSYQC--PVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTK 508
           KE    +++C  P C K+  R  ++ SH+  H   RPY C   GC+K F    +L RH K
Sbjct: 541 KEMLDKTFECLYPGCAKTFKRRYNIRSHIQTHLEDRPYSCDCPGCDKAFVRNHDLIRHKK 600

Query: 509 LHIKK 513
            H +K
Sbjct: 601 SHQEK 605

>Skud_10.152 Chr10 (285800..288439) [2640 bp, 879 aa] {ON} YJL056C
           (REAL)
          Length = 879

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 40/72 (55%), Gaps = 2/72 (2%)

Query: 442 QKNMFQYPNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKS 501
           ++ + Q+      +  Y+C +C K  + +SSL  H+  HT  +P +C+   C K FN  S
Sbjct: 779 EETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKI--CGKRFNESS 836

Query: 502 NLNRHTKLHIKK 513
           NL++H K H KK
Sbjct: 837 NLSKHIKTHKKK 848

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query: 454 KQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           K   Y+C  C +  S   +L  H   H+  +PYKC    CNK F + S+L  H + H
Sbjct: 763 KYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHI--CNKKFAISSSLKIHIRTH 817

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 3/70 (4%)

Query: 451 KEKKQVSYQCPVCGKSVSRASSLHSHM-FIHTN--ARPYKCQWEGCNKTFNVKSNLNRHT 507
           K+ +QV  Q   C +S + A  L+ H+  IH       Y+C W  C++TF  +  L RH 
Sbjct: 699 KQPEQVICQWDNCNRSFANAQELNDHLEAIHLTRGKSEYQCLWHDCHRTFPQRQKLIRHL 758

Query: 508 KLHIKKQQKK 517
           K+H K +  K
Sbjct: 759 KVHSKYKPYK 768

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 458 YQCPV--CGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           YQC    C ++  +   L  H+ +H+  +PYKC+   C + F+ +  L +HT+ H
Sbjct: 737 YQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCK--TCKRCFSSEETLVQHTRTH 789

>TDEL0D01950 Chr4 complement(377508..379775) [2268 bp, 755 aa] {ON}
           Anc_1.326 YJL056C
          Length = 755

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKK 513
           ++C +CGK  + +SSL  H+  HT  +P +C+   C + F+  SNLN+H K H KK
Sbjct: 675 FECRICGKRFAVSSSLKIHIRTHTGEKPLQCKI--CGRRFSESSNLNKHMKSHQKK 728

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           Y+C  CGK  S   +L  H   H+  +P++C+   C K F V S+L  H + H
Sbjct: 647 YKCQDCGKCFSSEDTLTQHKRTHSGEKPFECRI--CGKRFAVSSSLKIHIRTH 697

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 4/61 (6%)

Query: 452 EKKQVSYQCPV--CGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKL 509
           EK +  Y C    C K  ++   L  H+ +H+  +PYKCQ   C K F+ +  L +H + 
Sbjct: 611 EKGKSEYHCHWHGCDKRFAQRQKLVRHLKVHSGYKPYKCQ--DCGKCFSSEDTLTQHKRT 668

Query: 510 H 510
           H
Sbjct: 669 H 669

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 3/51 (5%)

Query: 463 CGKSVSRASSLHSHM---FIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           C +    A++L +H+    +      Y C W GC+K F  +  L RH K+H
Sbjct: 591 CTEVFDSAAALTTHLEALHLEKGKSEYHCHWHGCDKRFAQRQKLVRHLKVH 641

>TBLA0A03960 Chr1 complement(989886..992438) [2553 bp, 850 aa] {ON}
           Anc_8.326 YLR131C
          Length = 850

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 32/62 (51%), Gaps = 2/62 (3%)

Query: 451 KEKKQVSYQC--PVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTK 508
           KE     ++C  P C K   R  ++ SH+  H   RPY C ++GCNK F    +L RH K
Sbjct: 663 KELPDKLFECLYPKCHKIFKRRYNIRSHIQTHLEDRPYICDFDGCNKAFVRNHDLVRHKK 722

Query: 509 LH 510
            H
Sbjct: 723 SH 724

>YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON}
           ZAP1Zinc-regulated transcription factor; binds to
           zinc-responsive promoters to induce transcription of
           certain genes in presence of zinc, represses other genes
           in low zinc; regulates its own transcription; contains
           seven zinc-finger domains
          Length = 880

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 40/72 (55%), Gaps = 2/72 (2%)

Query: 442 QKNMFQYPNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKS 501
           ++ + Q+      +  Y+C +C K  + +SSL  H+  HT  +P +C+   C K FN  S
Sbjct: 780 EETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKI--CGKRFNESS 837

Query: 502 NLNRHTKLHIKK 513
           NL++H K H KK
Sbjct: 838 NLSKHIKTHQKK 849

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 36/72 (50%), Gaps = 3/72 (4%)

Query: 449 PNKEKKQVSYQCPVCGKSVSRASSLHSHM---FIHTNARPYKCQWEGCNKTFNVKSNLNR 505
           P K+ +QV  Q   C KS S A  L+ H+    +      Y+C W  C++TF  +  L R
Sbjct: 698 PIKQPEQVICQWDGCNKSFSSAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIR 757

Query: 506 HTKLHIKKQQKK 517
           H K+H K +  K
Sbjct: 758 HLKVHSKYKPYK 769

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query: 454 KQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           K   Y+C  C +  S   +L  H   H+  +PYKC    CNK F + S+L  H + H
Sbjct: 764 KYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHI--CNKKFAISSSLKIHIRTH 818

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 458 YQCPV--CGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           YQC    C ++  +   L  H+ +H+  +PYKC+   C + F+ +  L +HT+ H
Sbjct: 738 YQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCK--TCKRCFSSEETLVQHTRTH 790

>NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON}
           Anc_3.518
          Length = 288

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 30/57 (52%)

Query: 455 QVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHI 511
           Q  ++CP+C +   R      H+  HT  +P+ C +  C K+F+    L RH ++H+
Sbjct: 14  QRPFRCPICSRGFHRLEHKKRHVRTHTGEKPHPCTFAHCGKSFSRGDELKRHIRIHL 70

>KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.162
           YOR113W
          Length = 796

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           ++C  CGK  ++  +L +H  +HT  +PY CQ   C+K F+ K NL  H   H
Sbjct: 500 FECQFCGKRFTQGGNLRTHQRLHTGEKPYACQH--CSKRFSRKGNLAAHQLTH 550

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 2/66 (3%)

Query: 446 FQYPNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNR 505
           F     +++Q  ++CP C    ++ + L  H+  H   +P++CQ+  C K F    NL  
Sbjct: 460 FPAQTPQQQQKKHECPYCHHKFAQTTHLEVHVRSHLGYKPFECQF--CGKRFTQGGNLRT 517

Query: 506 HTKLHI 511
           H +LH 
Sbjct: 518 HQRLHT 523

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRH 506
           Y C  C K  SR  +L +H   H   +P+ C+ + C KTF    N+  H
Sbjct: 528 YACQHCSKRFSRKGNLAAHQLTHREVKPFLCKLDNCGKTFAQLGNMKNH 576

>TDEL0G02330 Chr7 (449585..451105) [1521 bp, 506 aa] {ON} Anc_2.303
           YNL027W
          Length = 506

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 2/64 (3%)

Query: 452 EKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHI 511
           +K    + C +C K  +R  +L SH+  HTN RP+ C    C K F  + +  RH  LH 
Sbjct: 386 QKNPAMFACELCDKRFTRPYNLKSHLRTHTNERPFICS--SCGKAFARQHDRKRHEDLHT 443

Query: 512 KKQQ 515
            K++
Sbjct: 444 GKKR 447

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 24/59 (40%), Gaps = 9/59 (15%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKC--------QWEGCNKTFNVKSNLNRHTK 508
           + C  CGK+ +R      H  +HT  + Y C         W GC K F     L RH K
Sbjct: 420 FICSSCGKAFARQHDRKRHEDLHTGKKRYVCGGHLKDGTAW-GCGKKFARSDALGRHFK 477

>YDR146C Chr4 complement(748613..750742) [2130 bp, 709 aa] {ON}
           SWI5Transcription factor that recruits the Mediator and
           Swi/Snf complexes; activates transcription of genes
           expressed at the M/G1 phase boundary and in G1 phase;
           required for expression of the HO gene controlling
           mating type switching; localization to the nucleus
           occurs during G1 and appears to be regulated by
           phosphorylation by Cdc28p kinase
          Length = 709

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 451 KEKKQVSYQC--PVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTK 508
           KE    +++C  P C K+  R  ++ SH+  H   RPY C   GC+K F    +L RH K
Sbjct: 543 KEMPDKTFECLFPGCTKTFKRRYNIRSHIQTHLEDRPYSCDHPGCDKAFVRNHDLIRHKK 602

Query: 509 LHIKK 513
            H +K
Sbjct: 603 SHQEK 607

>CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} similar
           to uniprot|P47043 Saccharomyces cerevisiae YJL056c ZAP1
           metalloregulatory protein
          Length = 713

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKK 513
           Y+C +C K  + ++SL  H+  HT  +P KC+   C + FN  SNL++H K H+KK
Sbjct: 625 YECHICHKRFAISNSLKIHIRTHTGEKPLKCK--VCGRCFNESSNLSKHMKTHMKK 678

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 463 CGKSVSRASSLHSH---MFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           C +    A  L+ H   M +      Y C+WEGCNKTF+ +  L RH K+H K
Sbjct: 541 CNERFKSAGDLNDHLEEMHLTKGKSQYTCEWEGCNKTFSQRQKLVRHLKVHSK 593

>CAGL0C02519g Chr3 (253051..254007) [957 bp, 318 aa] {ON} some
           similarities with uniprot|P39943 Saccharomyces
           cerevisiae YER028c or uniprot|P53035 Saccharomyces
           cerevisiae YGL209w MIG2
          Length = 318

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 1/69 (1%)

Query: 443 KNMFQYPNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSN 502
           KN   YP    K+  ++C +C +   R      H   HT  +P+KC++  C K+F+    
Sbjct: 6   KNQDSYPPDNFKR-PFRCEICSRGFHRLEHKKRHFRTHTGEKPHKCKFPSCPKSFSRADE 64

Query: 503 LNRHTKLHI 511
           L RH++ H+
Sbjct: 65  LKRHSRTHM 73

>TPHA0A01540 Chr1 (306674..308914) [2241 bp, 746 aa] {ON} Anc_8.326
           YLR131C
          Length = 746

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 27/48 (56%)

Query: 463 CGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           C KS  R  ++ SH+  H   RPY C +EGC K+F    +L RH K H
Sbjct: 557 CQKSFKRRYNVRSHIQTHLEDRPYTCDYEGCEKSFVRNHDLIRHRKRH 604

>Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {ON}
           YNL027W (CRZ1) - putative transcription factor [contig
           27] FULL
          Length = 531

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 2/64 (3%)

Query: 452 EKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHI 511
           +K    Y C +C K  +R  +L SH+  HT+ RP+ C    C K F  + +  RH  LH 
Sbjct: 407 QKNASVYACELCDKKFTRPYNLKSHLRTHTDERPFSCAI--CGKAFARQHDRKRHEDLHT 464

Query: 512 KKQQ 515
            +++
Sbjct: 465 GQKR 468

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 28/65 (43%), Gaps = 9/65 (13%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKC--------QWEGCNKTFNVKSNLNRHTKL 509
           + C +CGK+ +R      H  +HT  + Y C        +W GC K F     L RH K 
Sbjct: 441 FSCAICGKAFARQHDRKRHEDLHTGQKRYTCHGKLKDGTEW-GCGKKFARSDALGRHFKT 499

Query: 510 HIKKQ 514
              K+
Sbjct: 500 EGGKR 504

>Suva_5.124 Chr5 complement(186591..187811) [1221 bp, 406 aa] {ON}
           YER028C (REAL)
          Length = 406

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 30/60 (50%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK 517
           ++C  C +   R      H+  HT  +P+ C + GC K+F+    L RH + H K  Q++
Sbjct: 17  FKCEFCSRGFHRLEHKKRHVRTHTGEKPHACSFRGCPKSFSRSDELKRHLRTHKKTTQRR 76

>NDAI0J00990 Chr10 (226704..228863) [2160 bp, 719 aa] {ON} Anc_8.326
          Length = 719

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 451 KEKKQVSYQC--PVCGKSV-SRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHT 507
           KE    +++C  P C K    R  ++ SH+  H   RPY C + GC+K F    +L RH 
Sbjct: 539 KELPDKTFECLYPACEKKFFKRRYNIRSHIQTHLEDRPYVCDFFGCDKAFVRNHDLVRHK 598

Query: 508 KLHIKK 513
           K+H +K
Sbjct: 599 KVHCEK 604

>TBLA0H01260 Chr8 (283947..285665) [1719 bp, 572 aa] {ON} Anc_8.326
           YLR131C
          Length = 572

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 458 YQC--PVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKK 513
           ++C  P C K   R  ++ SH+  H   RPY C  EGC K F    +L RH K H +K
Sbjct: 422 FECIYPGCHKIFKRRYNIRSHIQTHLEDRPYVCDHEGCTKAFVRNHDLLRHKKTHAEK 479

>KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON}
           Anc_3.281 YBR066C
          Length = 224

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 37/66 (56%), Gaps = 3/66 (4%)

Query: 450 NKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKL 509
           NK++K V   C VC  + + +  L  H  IHT  + Y C +EGC + F+   N  +H K 
Sbjct: 153 NKQRKHV---CKVCTMAFTTSGHLSRHNKIHTGEKKYVCPFEGCGQRFSRHDNCVQHHKT 209

Query: 510 HIKKQQ 515
           H++K++
Sbjct: 210 HLRKKE 215

>KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 307

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 30/60 (50%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK 517
           ++C +CGK   R      H+  HT  +P+ C + GC K F+    L RH + H+   + K
Sbjct: 13  FKCDMCGKGFHRLEHKRRHIRTHTGEKPHACNFPGCVKRFSRSDELKRHVRTHMSTSRGK 72

>Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {ON}
           YMR037C (REAL)
          Length = 709

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 36/63 (57%), Gaps = 3/63 (4%)

Query: 451 KEKKQVSYQCPVCGKSVSRASSLHSHM-FIHTNARPYKCQWEGCNKTFNVKSNLNRHTKL 509
           KE ++  + C +C KS  R+  L  H+  +H+N RP+ C    C+K F+   NL++H K 
Sbjct: 645 KELEEKPFHCHICSKSFKRSEHLKRHVRSVHSNERPFACHI--CDKKFSRSDNLSQHIKT 702

Query: 510 HIK 512
           H K
Sbjct: 703 HKK 705

>KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518
           YGL209W
          Length = 439

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           Y+C +C +   R      H+  HT  +P+KC + GC K F+    L RH + H
Sbjct: 20  YKCGICSRGFHRLEHKKRHLRTHTGEKPHKCVFPGCTKGFSRGDELKRHLRTH 72

>YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON}
           MSN2Transcriptional activator related to Msn4p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 704

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 36/63 (57%), Gaps = 3/63 (4%)

Query: 451 KEKKQVSYQCPVCGKSVSRASSLHSHMF-IHTNARPYKCQWEGCNKTFNVKSNLNRHTKL 509
           KE ++  + C +C KS  R+  L  H+  +H+N RP+ C    C+K F+   NL++H K 
Sbjct: 640 KELEEKPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHI--CDKKFSRSDNLSQHIKT 697

Query: 510 HIK 512
           H K
Sbjct: 698 HKK 700

>Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar to
           Ashbya gossypii ADL198W
          Length = 560

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 2/64 (3%)

Query: 452 EKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHI 511
           +K    Y C +C K  +R  +L SH+  HT+ RP+ C    C K F  + +  RH  LH 
Sbjct: 432 QKNPAIYSCDLCNKKFTRPYNLKSHLRTHTDERPFACNM--CGKAFARQHDRKRHEDLHS 489

Query: 512 KKQQ 515
            K++
Sbjct: 490 GKKR 493

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 25/59 (42%), Gaps = 9/59 (15%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKC--------QWEGCNKTFNVKSNLNRHTK 508
           + C +CGK+ +R      H  +H+  + Y C         W GC K F     L RH K
Sbjct: 466 FACNMCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKDGTSW-GCGKKFARSDALGRHFK 523

>Kwal_14.2543 s14 (807668..809803) [2136 bp, 711 aa] {ON} YJL056C
           (ZAP1) - Metalloregulatory protein involved in
           zinc-responsive transcriptional regulation [contig 224]
           FULL
          Length = 711

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 6/75 (8%)

Query: 439 DIDQKNMFQYPNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFN 498
           DI Q++M  +  ++     Y+C  CGK  + +SSL  H+  HT  +P +C+   C K FN
Sbjct: 619 DILQQHMRTHSGEK----PYKCSHCGKGFATSSSLRIHIRTHTGEKPLECKV--CGKRFN 672

Query: 499 VKSNLNRHTKLHIKK 513
             SNL++H + H +K
Sbjct: 673 ESSNLSKHMRTHERK 687

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 2/52 (3%)

Query: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           +C  C K+ S    L  HM  H+  +PYKC    C K F   S+L  H + H
Sbjct: 607 KCVHCLKTFSTQDILQQHMRTHSGEKPYKCS--HCGKGFATSSSLRIHIRTH 656

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 457 SYQCPV--CGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           SY C    CG+ +++   L  H+ +HT  +P KC    C KTF+ +  L +H + H
Sbjct: 575 SYVCGWENCGRVITQRQKLLRHLRVHTRYKPCKCV--HCLKTFSTQDILQQHMRTH 628

>KNAG0G02470 Chr7 complement(562235..564445) [2211 bp, 736 aa] {ON}
           Anc_8.326 YLR131C
          Length = 736

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 31/65 (47%), Gaps = 2/65 (3%)

Query: 451 KEKKQVSYQC--PVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTK 508
           KE     + C  P C K+  R  ++ SH+  H   RPY C + GC K F    +L RH K
Sbjct: 552 KELPDRMFACLYPNCDKTFKRRYNVRSHIQTHLQDRPYTCDYPGCEKAFVRNHDLVRHKK 611

Query: 509 LHIKK 513
            H  K
Sbjct: 612 GHTGK 616

>KAFR0I02370 Chr9 (480591..481766) [1176 bp, 391 aa] {ON} Anc_3.518
           YGL209W
          Length = 391

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%)

Query: 455 QVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQ 514
           Q  ++C +C +   R      H+  HT  +P+ C + GC K F+    L RH++ H    
Sbjct: 14  QRPFRCELCQRGFHRLEHKKRHVRTHTGEKPHACTFPGCEKHFSRSDELKRHSRTHATGL 73

Query: 515 QKK 517
           Q+K
Sbjct: 74  QRK 76

>TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.533
           YMR070W
          Length = 417

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 36/67 (53%), Gaps = 3/67 (4%)

Query: 442 QKNMFQYPNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKS 501
           QK +F+Y  + KK   Y+C VC K+  R S L  H F H+  + + C W  C+  +  K 
Sbjct: 309 QKKLFRY-KRAKKIKFYECKVCHKTFKRNSWLKRHFFSHSKLKNFSCNW--CSGKYKRKD 365

Query: 502 NLNRHTK 508
           NL +H +
Sbjct: 366 NLVQHIR 372

>KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly
           similar to uniprot|P47043 Saccharomyces cerevisiae
           YJL056C ZAP1 Zinc-regulated transcription factor binds
           to zinc-responsive promoter elements to induce
           transcription of certain genes in the presence of zinc
           regulates its own transcription contains seven zinc-
           finger domains
          Length = 682

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKK 513
           Y+C  CGK  + +SSL  H+  HT  +P +C+   C K FN  SNL++H + H +K
Sbjct: 605 YKCVHCGKGFATSSSLRIHIRTHTGEKPLECKV--CGKRFNESSNLSKHMRTHERK 658

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           +CP C K+ S    L  H+  H+  +PYKC    C K F   S+L  H + H
Sbjct: 578 KCPHCAKTFSTQDILQQHIRTHSGEKPYKCV--HCGKGFATSSSLRIHIRTH 627

 Score = 38.1 bits (87), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 457 SYQCPV--CGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           SY C    CGK +++   L  H+ +HT  +P KC    C KTF+ +  L +H + H
Sbjct: 546 SYVCGWENCGKVITQRQKLLRHLRVHTRYKPCKC--PHCAKTFSTQDILQQHIRTH 599

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 480 HTNARPYKCQWEGCNKTFNVKSNLNRHT-KLHIKK 513
           H + + + C+WEGC + FN    LN H  K+HI +
Sbjct: 508 HNDEQDHTCRWEGCMQVFNSCEELNGHIEKVHIPR 542

>ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL027W (CRZ1)
          Length = 547

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 2/64 (3%)

Query: 452 EKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHI 511
           +K    Y C +C K  +R  +L SH+  HT+ RP+ C    C K F  + +  RH  LH 
Sbjct: 420 QKNPAIYSCNLCDKKFTRPYNLKSHLRTHTDERPFSCSV--CGKAFARQHDRKRHEDLHS 477

Query: 512 KKQQ 515
            K++
Sbjct: 478 GKKR 481

 Score = 37.4 bits (85), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 25/59 (42%), Gaps = 9/59 (15%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKC--------QWEGCNKTFNVKSNLNRHTK 508
           + C VCGK+ +R      H  +H+  + Y C         W GC K F     L RH K
Sbjct: 454 FSCSVCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKGGATW-GCGKKFARSDALGRHFK 511

>Kpol_423.15 s423 (33422..34600) [1179 bp, 392 aa] {ON}
           (33422..34600) [1179 nt, 393 aa]
          Length = 392

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           Y C +C K   R      H+  HT  +P+ C ++GC K+F+    L RH  +H
Sbjct: 27  YICEICTKGFRRLEHKKRHIRTHTGEKPHVCTFQGCPKSFSRSDELKRHMNIH 79

>KLLA0D16456g Chr4 complement(1387846..1390410) [2565 bp, 854 aa]
           {ON} weakly similar to uniprot|P21192 Saccharomyces
           cerevisiae YLR131C ACE2 Transcription factor that
           activates expression of early G1-specific genes
           localizes to daughter cell nuclei after cytokinesis and
           delays G1 progression in daughters localization is
           regulated by phosphorylation potential Cdc28p substrate
          Length = 854

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 458 YQCPV--CGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKK 513
           +QC    C K  +R  +  +H+  H   RPYKC + GC K F    +L RH K H++K
Sbjct: 693 FQCKFKDCQKRFNRRYNARTHIQTHLCDRPYKCDFPGCQKAFVRNHDLLRHKKSHLEK 750

>TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 36/74 (48%), Gaps = 3/74 (4%)

Query: 444 NMFQYPNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNL 503
           N F   N+E+    ++C +C +   R      H+  HT  +P++C +  C K+F+    L
Sbjct: 6   NTFPADNEERP---FKCELCSRGFHRLEHKKRHIRTHTGEKPHRCTFGSCGKSFSRSDEL 62

Query: 504 NRHTKLHIKKQQKK 517
            RH + H    Q++
Sbjct: 63  KRHLRTHAGSSQRR 76

>Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {ON}
           YMR037C (REAL)
          Length = 703

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 3/63 (4%)

Query: 451 KEKKQVSYQCPVCGKSVSRASSLHSHMF-IHTNARPYKCQWEGCNKTFNVKSNLNRHTKL 509
           KE ++  + C +C KS  R+  L  H+  +H+N RP+ C    C K F+   NL++H K 
Sbjct: 639 KELEEKPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHI--CEKKFSRSDNLSQHIKT 696

Query: 510 HIK 512
           H K
Sbjct: 697 HKK 699

>Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON}
           YER028C (REAL)
          Length = 388

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 455 QVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH---I 511
           Q  ++C +C +   R      H+  HT  +P+KC ++ C K+F+    L RH + H   +
Sbjct: 14  QRPFRCEICSRGFHRLEHKKRHVRTHTGEKPHKCSFQSCPKSFSRGDELKRHLRTHTNTV 73

Query: 512 KKQQKK 517
           KK+ ++
Sbjct: 74  KKRSRR 79

>KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]
           {ON} some similarities with uniprot|Q03125 Saccharomyces
           cerevisiae YDR043C NRG1 Transcriptional repressor that
           recruits the Cyc8p-Tup1p complex to promoters
          Length = 357

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 37/71 (52%), Gaps = 2/71 (2%)

Query: 442 QKNMFQYPNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKS 501
           Q N    P  E+++  Y C +C +  + +  L  H  IHT  + ++CQ+ GCN+ F+   
Sbjct: 270 QSNTKDLPLAERRK--YICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHD 327

Query: 502 NLNRHTKLHIK 512
           N  +H + H K
Sbjct: 328 NYIQHYRTHFK 338

>KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]
           {ON} some similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 431

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 457 SYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKL 509
           SYQC +C K   R S L  H+  H+N + + C W  C+ T   K NL +H KL
Sbjct: 305 SYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLKL 355

>KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {ON}
           Anc_1.326 YJL056C
          Length = 746

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQ 515
           Y C +CGK  + +SSL  H+  HT  +P +C    C K F   SNLN+H K H K  Q
Sbjct: 669 YHCDICGKRFAISSSLKIHVRTHTGEKPLQC--AVCGKRFIESSNLNKHMKTHEKGFQ 724

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           Y+CP C K  S   +L  H+ IH+  +PY C  + C K F + S+L  H + H
Sbjct: 641 YKCPQCQKCFSSDETLKQHLRIHSGEKPYHC--DICGKRFAISSSLKIHVRTH 691

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 4/60 (6%)

Query: 453 KKQVSYQCPV--CGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           + Q  Y C    CGK+ ++   +  H+ +HT  +PYKC    C K F+    L +H ++H
Sbjct: 606 RGQSQYTCSWAGCGKTFTQRQKIARHLKVHTRYKPYKC--PQCQKCFSSDETLKQHLRIH 663

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 18/32 (56%)

Query: 486 YKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK 517
           Y C W GC KTF  +  + RH K+H + +  K
Sbjct: 611 YTCSWAGCGKTFTQRQKIARHLKVHTRYKPYK 642

>Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)
          Length = 400

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 30/60 (50%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK 517
           ++C  C +   R      H+  HT  +P+ C + GC K+F+    L RH + H  + Q++
Sbjct: 17  FRCDTCNRGFHRLEHKKRHLRTHTGEKPHHCGFPGCGKSFSRSDELKRHMRTHTGQSQRR 76

>NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80
          Length = 493

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%)

Query: 460 CPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           CPVC ++  R      H+  HT  +P  C + GC K F+    L RH ++H
Sbjct: 45  CPVCQRAFHRLEHQTRHLRTHTGEKPNVCDFPGCIKRFSRSDELTRHKRIH 95

>YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc finger
           transcriptional repressor; cooperates with Mig1p in
           glucose-induced repression of many genes including SUC2
           (invertase); binds to Mig1p-binding sites in SUC2
           promoter; under low glucose conditions Mig2p relocalizes
           to mitochondrion, where it regulates morphology,
           interacts with Ups1p and antagonizes mitochondrial
           fission factor, Dnm1p, indicative of a role in promoting
           mitochondrial fusion or regulating morphology
          Length = 382

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 30/60 (50%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK 517
           ++C  C +   R      H+  HT  +P+ C + GC K+F+    L RH + H  + Q++
Sbjct: 17  FRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTHTGQSQRR 76

>Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W
           (REAL)
          Length = 383

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 30/60 (50%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK 517
           ++C  C +   R      H+  HT  +P+ C + GC K+F+    L RH + H  + Q++
Sbjct: 17  FRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTHTGQSQRR 76

>KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some
           similarities with uniprot|P47043 Saccharomyces
           cerevisiae YJL056C ZAP1 Zinc-regulated transcription
           factor binds to zinc-responsive promoter elements to
           induce transcription of certain genes in the presence of
           zinc regulates its own transcription contains seven
           zinc- finger domains
          Length = 781

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 463 CGKSVSRASSLHSHM---FIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           C K    A SL+ H+    + +    YKC+WEGCNK F  K  L RH K+H K
Sbjct: 636 CNKEFDSAKSLNEHIENFHVPSGLSSYKCEWEGCNKVFVQKQKLIRHLKVHSK 688

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKK 513
           ++C +C KS S +SSL  H+  HT  +P  C    CNK FN  SNL +H + H ++
Sbjct: 720 FKCHLCPKSYSTSSSLRIHIRTHTGEKPLSCPI--CNKRFNESSNLAKHIRTHKRE 773

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 36/71 (50%), Gaps = 2/71 (2%)

Query: 440 IDQKNMFQYPNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNV 499
           + ++ + ++     K   ++C  CGK  +    L  H+ +H+  RP+KC    C K+++ 
Sbjct: 674 VQKQKLIRHLKVHSKYKPFRCAECGKCFNTQDILTQHLRVHSGERPFKCHL--CPKSYST 731

Query: 500 KSNLNRHTKLH 510
            S+L  H + H
Sbjct: 732 SSSLRIHIRTH 742

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 4/56 (7%)

Query: 457 SYQCPV--CGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           SY+C    C K   +   L  H+ +H+  +P++C    C K FN +  L +H ++H
Sbjct: 661 SYKCEWEGCNKVFVQKQKLIRHLKVHSKYKPFRCA--ECGKCFNTQDILTQHLRVH 714

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 22/41 (53%)

Query: 468 SRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTK 508
           + A  + +H  +H   +   C+W GCNK F+   +LN H +
Sbjct: 611 TMAKQVTAHKQLHEEPQSCICKWAGCNKEFDSAKSLNEHIE 651

>Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)
          Length = 382

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 30/60 (50%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK 517
           ++C  C +   R      H+  HT  +P+ C + GC K+F+    L RH + H  + Q++
Sbjct: 17  FRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTHTGQSQRR 76

>NCAS0E00170 Chr5 (20556..21539) [984 bp, 327 aa] {ON} 
          Length = 327

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 30/64 (46%), Gaps = 2/64 (3%)

Query: 451 KEKKQVSYQCPV--CGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTK 508
           K  K+  Y+C    C +  +R   L  H + HTN RPY C  EGC K F    +L  H  
Sbjct: 6   KRSKKKVYKCQFEGCHREFTRPCLLQQHRYSHTNERPYICDVEGCGKRFMRPCHLKVHKW 65

Query: 509 LHIK 512
            H K
Sbjct: 66  THSK 69

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 28/61 (45%), Gaps = 4/61 (6%)

Query: 458 YQCPV--CGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQ 515
           Y C V  CGK   R   L  H + H+  +P KC +  C K F     L RH   H KK +
Sbjct: 43  YICDVEGCGKRFMRPCHLKVHKWTHSKVKPLKCAF--CEKGFITNQQLKRHLNTHAKKSR 100

Query: 516 K 516
           K
Sbjct: 101 K 101

>SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly
           similar to uniprot|P47043 Saccharomyces cerevisiae
           YJL056C ZAP1 Zinc-regulated transcription factor binds
           to zinc-responsive promoter elements to induce
           transcription of certain genes in the presence of zinc
           regulates its own transcription contains seven zinc-
           finger domains
          Length = 767

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKK 513
           ++C  C K  + +SSL  H+  HT  +P KC+   C K FN  SNL++H K H +K
Sbjct: 686 FKCTYCTKQFATSSSLRIHIRTHTGEKPLKCKI--CGKRFNESSNLSKHMKTHERK 739

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           ++CP C K  S    L  H+  H+  RP+KC +  C K F   S+L  H + H
Sbjct: 658 FKCPHCTKKFSTEDILQQHIRTHSGERPFKCTY--CTKQFATSSSLRIHIRTH 708

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 4/60 (6%)

Query: 453 KKQVSYQCP--VCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           + Q SYQC    C KS ++   L  H+ +H+  +P+KC    C K F+ +  L +H + H
Sbjct: 623 RGQSSYQCSWDTCSKSFTQRQKLLRHLKVHSGYKPFKC--PHCTKKFSTEDILQQHIRTH 680

>Kpol_489.4 s489 (17106..18125) [1020 bp, 339 aa] {ON}
           (17106..18125) [1020 nt, 340 aa]
          Length = 339

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 29/62 (46%), Gaps = 2/62 (3%)

Query: 451 KEKKQVSYQCPV--CGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTK 508
           K K+   Y+C    C K   R S L  H + HTN RPY C +E C K F    +L  H  
Sbjct: 7   KGKRDKRYKCTYEGCTKVYDRPSLLQQHRYSHTNERPYFCDYENCGKRFMRPCHLRVHQW 66

Query: 509 LH 510
            H
Sbjct: 67  TH 68

>NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa]
           {ON} Anc_2.598
          Length = 822

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 34/58 (58%), Gaps = 3/58 (5%)

Query: 457 SYQCPVCGKSVSRASSLHSHM-FIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKK 513
           +++C  CGK+  R+  L  H+  +H++ RP+ C    C+K F+   NL +H K H K+
Sbjct: 764 TFKCETCGKAFRRSEHLKRHIRSVHSSERPFAC--PTCDKKFSRSDNLAQHIKTHKKR 819

>ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa]
           {ON} weakly similar to uniprot|P38082 Saccharomyces
           cerevisiae YBR066C
          Length = 189

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 38/67 (56%), Gaps = 3/67 (4%)

Query: 450 NKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKL 509
           N E++ V   C +C K  + +  L  H  IHT  + ++C +EGC++ F+   N  +H + 
Sbjct: 105 NSERRHV---CRICYKGFTTSGHLARHNRIHTGEKNHECPYEGCDQKFSRHDNCIQHYRA 161

Query: 510 HIKKQQK 516
           H+K++ +
Sbjct: 162 HVKRELR 168

>TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {ON}
           Anc_3.281 YBR066C
          Length = 350

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 45/84 (53%), Gaps = 5/84 (5%)

Query: 439 DIDQKNMFQYPNKEK-----KQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGC 493
           +I +KN+ +   +E+     ++  +QC +C K  + A  L  H  IHT  + +KC   GC
Sbjct: 244 EILKKNIKEMTKEERLLTIERRRKHQCKICMKKFTTAGHLTRHHKIHTGEKNHKCPHRGC 303

Query: 494 NKTFNVKSNLNRHTKLHIKKQQKK 517
           N  F+   N  +H + H+K++ KK
Sbjct: 304 NLWFSRNDNSLQHYQTHLKRKTKK 327

>TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.533
           YMR070W
          Length = 387

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQ 514
           ++C VCGK   R S L  H+  H++ R Y C W  C      K NL +H KL  K+Q
Sbjct: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHKQQ 308

>CAGL0K09372g Chr11 complement(925647..926837) [1191 bp, 396 aa]
           {ON} similar to uniprot|P53035 Saccharomyces cerevisiae
           YGL209w MIG2 C2H2 zinc-finger protein
          Length = 396

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 29/62 (46%)

Query: 454 KQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKK 513
           K+  ++C  C +   R      HM  HT  +P+ C + GC K+F+    L RH + H   
Sbjct: 13  KERPFKCEHCSRGFHRLEHKKRHMRTHTGEKPHGCSFPGCGKSFSRSDELKRHNRTHTGV 72

Query: 514 QQ 515
            Q
Sbjct: 73  SQ 74

>KAFR0H02240 Chr8 (426388..428259) [1872 bp, 623 aa] {ON} Anc_8.326
           YLR131C
          Length = 623

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 26/51 (50%)

Query: 463 CGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKK 513
           C K   R  ++ SH+  H   RPY C +E CNK F    +L RH K H  K
Sbjct: 466 CHKLFKRRYNIRSHIQTHLEDRPYICDYENCNKAFVRNHDLVRHKKSHAAK 516

>NCAS0C03240 Chr3 (636172..638034) [1863 bp, 620 aa] {ON} Anc_8.326
          Length = 620

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (50%)

Query: 463 CGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKK 513
           CGK   R  ++ SH+  H   +PY C + GC K F    +L RH K H  +
Sbjct: 487 CGKIFKRRYNVRSHIQTHLEDKPYACDFPGCEKAFVRNHDLVRHKKSHANR 537

>SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]
           {ON} similar to uniprot|P39933 Saccharomyces cerevisiae
           YPR186C PZF1 Transcription factor IIIA (TFIIIA) with
           putative Zn-fingers
          Length = 437

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHT-KLHIKK 513
           + C  CGK V+    L  H   HT  + +KC++EGCN+ F   S L  HT  +H++K
Sbjct: 114 FHCSYCGKGVTTKQQLKRHEITHT--KSFKCEYEGCNECFYKHSQLRSHTLSVHLQK 168

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           ++C  C ++ ++ S L  HMF H++ +P+ C +  C K    K  L RH   H K
Sbjct: 86  FKCDHCERTFAKKSHLERHMFTHSDNKPFHCSY--CGKGVTTKQQLKRHEITHTK 138

 Score = 34.3 bits (77), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 3/52 (5%)

Query: 460 CPVCGKSVSRASSLHSHMFIHTNA---RPYKCQWEGCNKTFNVKSNLNRHTK 508
           C  CGK   R   L +H+  H N      Y+C +  C +TF   + L +H K
Sbjct: 171 CEHCGKMFQRPYRLQNHLAKHHNVDVENKYQCTYTACTETFKTWTALQQHIK 222

>AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR043C (NRG1) and
           YBR066C (NRG2)
          Length = 140

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 18/61 (29%), Positives = 32/61 (52%)

Query: 453 KKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           +K+  + C  CGK  + +  L  H  IHT  + + C + GC + F+   N  +H + H+K
Sbjct: 75  EKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLK 134

Query: 513 K 513
           +
Sbjct: 135 R 135

>KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON}
           Anc_8.425 YDR216W
          Length = 627

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 457 SYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHT-KLH 510
           ++ C VC K+ +R   L  H+  HTN +P+KC    C+K F  +  L RH+ KLH
Sbjct: 48  TFLCFVCQKAFARQEHLDRHLRSHTNEKPFKCA--VCDKDFTRRDLLIRHSNKLH 100

>YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON}
           PZF1Transcription factor IIIA (TFIIIA); essential DNA
           binding protein required for transcription of 5S rRNA by
           RNA polymerase III; not involved in transcription of
           other RNAP III genes; nine conserved zinc fingers; may
           also bind 5S rRNA
          Length = 429

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 457 SYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           ++QC  C KS  + S L  H++ H++ +P++C +  C K    +  L RH   H K
Sbjct: 79  AFQCDKCAKSFVKKSHLERHLYTHSDTKPFQCSY--CGKGVTTRQQLKRHEVTHTK 132

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 460 CPVCGKSVSRASSLHSHMFIHTNAR---PYKCQWEGCNKTFNVKSNLNRHTK 508
           CP C KS  R   L +H+  H +     PY+C + GC K F + S L  H K
Sbjct: 165 CPHCNKSFQRPYRLRNHISKHHDPEVENPYQCTFAGCCKEFRIWSQLQSHIK 216

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 22/49 (44%), Gaps = 2/49 (4%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRH 506
           +QC  CGK V+    L  H   HT +  + C  EGCN  F     L  H
Sbjct: 108 FQCSYCGKGVTTRQQLKRHEVTHTKS--FICPEEGCNLRFYKHPQLRAH 154

>Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {ON}
           YMR037C (REAL)
          Length = 704

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 458 YQCPVCGKSVSRASSLHSHMF-IHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIK 512
           + C +C KS  R+  L  H+  +H+N RP+ C    C+K F+   NL++H K H K
Sbjct: 647 FHCHICPKSFKRSEHLKRHVRSVHSNERPFACHI--CDKKFSRSDNLSQHIKTHKK 700

>TBLA0C04880 Chr3 complement(1187913..1188932) [1020 bp, 339 aa]
           {ON} Anc_3.518 YGL209W
          Length = 339

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 30/64 (46%)

Query: 449 PNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTK 508
           P   K    + C +C +   R      H+  HT  +P+KC + GC K+F+    L RH +
Sbjct: 11  PQPIKDDRPFICEICHRGFHRLEHKKRHIRTHTGEKPHKCVFPGCIKSFSRSDELKRHLR 70

Query: 509 LHIK 512
            H +
Sbjct: 71  THTR 74

>KAFR0J02980 Chr10 complement(567857..568816) [960 bp, 319 aa] {ON} 
           YGL254W
          Length = 319

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 29/62 (46%), Gaps = 2/62 (3%)

Query: 458 YQCPV--CGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQ 515
           Y+C    CGK   R   L  H   HTN RPY C+  GC K F    +L  H   H + + 
Sbjct: 10  YKCQYEGCGKEYDRPCLLQQHRCSHTNERPYVCEEPGCGKRFMRPCHLRVHLWTHAQVKP 69

Query: 516 KK 517
           +K
Sbjct: 70  RK 71

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 28/62 (45%), Gaps = 4/62 (6%)

Query: 458 YQC--PVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQ 515
           Y C  P CGK   R   L  H++ H   +P KC    C K F     L RH   H K+ +
Sbjct: 40  YVCEEPGCGKRFMRPCHLRVHLWTHAQVKPRKCML--CGKGFITNQQLTRHLATHEKRAK 97

Query: 516 KK 517
           ++
Sbjct: 98  RQ 99

>KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weakly
           similar to uniprot|P33748 Saccharomyces cerevisiae
           YMR037C MSN2 Transcriptional activator related to Msn4p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 694

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 37/62 (59%), Gaps = 3/62 (4%)

Query: 452 EKKQVSYQCPVCGKSVSRASSLHSHMF-IHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           ++++  ++C  C K+  R+  L  H+  +H+  RP+ CQ+  C+K F+   NL++H K H
Sbjct: 615 DEEEKPFKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQF--CDKKFSRSDNLSQHLKTH 672

Query: 511 IK 512
            K
Sbjct: 673 KK 674

>AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL056C (ZAP1)
          Length = 661

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK 517
           + C  C K  S +SSL  H+  HT  +P  C    C K FN  SNL++H K+H +K   K
Sbjct: 572 FHCHYCRKQFSTSSSLRVHIRTHTGEKPLSCTV--CGKRFNESSNLSKHMKIHERKYMCK 629

 Score = 37.7 bits (86), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 460 CPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQ 514
           CP C K+ S    L  H+  H+  RP+ C +  C K F+  S+L  H + H  ++
Sbjct: 546 CPHCPKTFSTDDILAQHIRTHSGERPFHCHY--CRKQFSTSSSLRVHIRTHTGEK 598

>Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}
           YDR043C (REAL)
          Length = 232

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 36/73 (49%)

Query: 441 DQKNMFQYPNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVK 500
           D KN        +++  Y C +C +  + +  L  H  IHT  + + C ++GC + F+  
Sbjct: 158 DPKNTLSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRH 217

Query: 501 SNLNRHTKLHIKK 513
            N  +H + H+KK
Sbjct: 218 DNCLQHYRTHLKK 230

>KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {ON}
           Anc_1.326 YJL056C
          Length = 753

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           Y+C VC K  S   +L  H  +H+  +P+KC    C+K+F+V ++L  H + H
Sbjct: 640 YKCEVCSKCFSSDETLKQHSRVHSGEKPFKCHL--CDKSFSVSTSLKIHIRTH 690

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 33/53 (62%), Gaps = 2/53 (3%)

Query: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           ++C +C KS S ++SL  H+  HT  +P +C+   C + FN  SNL++H K H
Sbjct: 668 FKCHLCDKSFSVSTSLKIHIRTHTGEKPLECK--VCGRRFNESSNLSKHMKTH 718

 Score = 38.1 bits (87), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 463 CGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLH 510
           C K  S+   +  H+ +H+  +PYKC  E C+K F+    L +H+++H
Sbjct: 617 CNKEFSQRQKIVRHLKVHSGFKPYKC--EVCSKCFSSDETLKQHSRVH 662

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 449 PNKEKKQVSYQCPVCGKSVSRASSLHSHM--FIHTNAR-PYKCQWEGCNKTFNVKSNLNR 505
            N +++Q + +   C  + + +  L++H+  F  T  +  Y C W GCNK F+ +  + R
Sbjct: 570 ANSKEQQATCRWNNCNLTFNSSEELNAHLESFHLTKGKSKYTCFWHGCNKEFSQRQKIVR 629

Query: 506 HTKLH 510
           H K+H
Sbjct: 630 HLKVH 634

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.127    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,384,965
Number of extensions: 2580259
Number of successful extensions: 20401
Number of sequences better than 10.0: 1075
Number of HSP's gapped: 18680
Number of HSP's successfully gapped: 1382
Length of query: 517
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 403
Effective length of database: 40,409,475
Effective search space: 16285018425
Effective search space used: 16285018425
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 68 (30.8 bits)