Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1018.342.532ON29229212771e-179
NDAI0I022702.532ON2772063202e-34
TPHA0C041802.532ON2642883122e-33
NCAS0D026402.532ON2602033061e-32
SAKL0A09460g2.532ON2402652604e-26
CAGL0K02981g2.532ON2781562407e-23
KNAG0C058202.532ON2711652283e-21
KLTH0D06820g2.532ON2601502107e-19
YMR069W (NAT4)2.532ON2852382101e-18
KAFR0A018502.532ON2562032029e-18
Smik_13.2482.532ON2552301922e-16
TDEL0A030602.532ON2442091861e-15
Skud_13.2252.532ON2542141835e-15
TBLA0G022202.532ON2782941721e-13
ZYRO0B01980g2.532ON1881501443e-10
Kwal_26.80162.532ON2402041412e-09
Suva_13.2442.532ON257621342e-08
Ecym_25286.369ON48773740.73
KLLA0C16577g7.335ON50454711.7
NOTE: 3 genes in the same pillar as Kpol_1018.34 were not hit in these BLAST results
LIST: Agos_YGOB_Anc_2.532 Ecym_7256 KLLA0E18569g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1018.34
         (292 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {...   496   e-179
NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.53...   127   2e-34
TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.53...   124   2e-33
NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON...   122   1e-32
SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly ...   104   4e-26
CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly...    97   7e-23
KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {...    92   3e-21
KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some si...    86   7e-19
YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N alph...    86   1e-18
KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.53...    82   9e-18
Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W...    79   2e-16
TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.53...    76   1e-15
Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W...    75   5e-15
TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.53...    71   1e-13
ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some si...    60   3e-10
Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W ...    59   2e-09
Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)...    56   2e-08
Ecym_2528 Chr2 (1027884..1029347) [1464 bp, 487 aa] {ON} similar...    33   0.73 
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    32   1.7  

>Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {ON}
           complement(109063..109941) [879 nt, 293 aa]
          Length = 292

 Score =  496 bits (1277), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 255/292 (87%), Positives = 255/292 (87%)

Query: 1   MSELLHLVDVAENIFPETLELLNDNSSTSNQKKVLHRQLIAIDSKNNQIDVRNNVLSYYK 60
           MSELLHLVDVAENIFPETLELLNDNSSTSNQKKVLHRQLIAIDSKNNQIDVRNNVLSYYK
Sbjct: 1   MSELLHLVDVAENIFPETLELLNDNSSTSNQKKVLHRQLIAIDSKNNQIDVRNNVLSYYK 60

Query: 61  DNVKCXXXXXXXXXXXXXXXGPIYLEKSSKIYCNEKPWKENKIVEMKSEGLLYVIYNDDI 120
           DNVKC               GPIYLEKSSKIYCNEKPWKENKIVEMKSEGLLYVIYNDDI
Sbjct: 61  DNVKCDVVLNKLLDILDNNLGPIYLEKSSKIYCNEKPWKENKIVEMKSEGLLYVIYNDDI 120

Query: 121 TKEPLLFMSFMITDDPSLVVPTDNDSNELSNSTAAVXXXXXXXXXXXXRNQKLGTILITN 180
           TKEPLLFMSFMITDDPSLVVPTDNDSNELSNSTAAV            RNQKLGTILITN
Sbjct: 121 TKEPLLFMSFMITDDPSLVVPTDNDSNELSNSTAAVIYLYEIQLLELIRNQKLGTILITN 180

Query: 181 YLKKTIEILNKDYQKNIIALELTVFSNNINAINFYKKIGMLYTPDSPRDKIILPQKRRTR 240
           YLKKTIEILNKDYQKNIIALELTVFSNNINAINFYKKIGMLYTPDSPRDKIILPQKRRTR
Sbjct: 181 YLKKTIEILNKDYQKNIIALELTVFSNNINAINFYKKIGMLYTPDSPRDKIILPQKRRTR 240

Query: 241 STTIALESKNNEPSSRLTTSXXXXXXXXXXDYYLLFLPIPESNKIQLNCQCK 292
           STTIALESKNNEPSSRLTTS          DYYLLFLPIPESNKIQLNCQCK
Sbjct: 241 STTIALESKNNEPSSRLTTSKPIKKIIKKPDYYLLFLPIPESNKIQLNCQCK 292

>NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.532
           YMR069W
          Length = 277

 Score =  127 bits (320), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 80/206 (38%), Positives = 112/206 (54%), Gaps = 16/206 (7%)

Query: 81  GPIYLEKSSKIYCNEKPWKENKIVEMKSEGLLYVIYNDDITKEPLLFMSFMITDDPSLVV 140
           G  Y + S  IY N+K WK NK+ EM S GL+YV Y D+  +EPLLF+SFM+T+    + 
Sbjct: 79  GAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYVSYWDEKYQEPLLFLSFMLTEGDGFIG 138

Query: 141 --PTDNDSNELSNSTAAVXXXXXXXXXXXXRNQKLGTILITNYLKKTIEILNKDYQKN-- 196
               D+D NE ++   +V            R Q +GT L++ +L +    L   Y K+  
Sbjct: 139 THSNDDDENEHNDQLMSVIYLYEIQILPQLRGQGIGTKLLSVHLHQCCSSLVTKYGKDFL 198

Query: 197 ---IIALELTVFSNNINAINFYKKIGMLYTPDSPRDKIILPQKRRTRSTTIALESKNNEP 253
              ++ +ELTVFS+NI AINFYK IGM  TPDSP D++   +KR+TR+    L   NN  
Sbjct: 199 PYPLVGIELTVFSDNIKAINFYKSIGMKLTPDSPTDEVYQIEKRQTRN----LRRINNAG 254

Query: 254 SSRLTTSXXXXXXXXXXDYYLLFLPI 279
           +  +T             YYL +LPI
Sbjct: 255 TREVTKQIIKKPV-----YYLYYLPI 275

>TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.532
           YMR069W
          Length = 264

 Score =  124 bits (312), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 92/288 (31%), Positives = 148/288 (51%), Gaps = 33/288 (11%)

Query: 1   MSELLHLVDVAENIFPETLELLNDNSSTSNQKKVLHRQLIAIDSKNNQIDVRNNV----- 55
           M +++  V + ++ +P+ +  +N N +       L +++I +DS+    D++N+      
Sbjct: 1   MDDIVKFVKIVDSHYPDEI-YVNKNLTK------LVKKIIVVDSETE--DIKNSAELYNG 51

Query: 56  --LSYYKDNVKCXXXXXXXXXXXXXXXGPIYLEKSSKIYCNEKPWKENKIVEMKSEGLLY 113
             L+Y ++  +C               G IY  K+ K+Y N KPWKENKI EMK+EGL+Y
Sbjct: 52  RYLTYSQNKEECEIEFSKILTILDNNLGDIYTIKNKKLYGNSKPWKENKIQEMKTEGLIY 111

Query: 114 VIYN-DDITKEPLLFMSFMITDDPSLVVPTDNDSNELSNSTAAVXXXXXXXXXXXXRNQK 172
           V+Y+ +D  K   L++SF +T +   +   D          + V            RN  
Sbjct: 112 VVYHLEDEKKTVSLYLSFTLTKESGFLPDID--------VFSPVIYLYEIQLTPEVRNNG 163

Query: 173 LGTILITNYLKKTIEILNKDYQKNIIALELTVFSNNINAINFYKKIGMLYTPDSPRDKII 232
           LGT LI  YLK  +  ++++  K+II +ELTVFS+N NAI FY+ IGM  TPDSP DK I
Sbjct: 164 LGTKLIAGYLKDCLVDVHENIHKDIIGIELTVFSDNTNAIRFYETIGMKLTPDSPNDKTI 223

Query: 233 -LPQKRRTRSTTIALESKNNEPSSRLTTSXXXXXXXXXXDYYLLFLPI 279
               + +TRS   + +  +++  + L+            DYYL +LP+
Sbjct: 224 NYGHRIKTRSQNSSKKGSSSDKPTSLSV-------VKKPDYYLYYLPL 264

>NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON}
           Anc_2.532 YMR069W
          Length = 260

 Score =  122 bits (306), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 109/203 (53%), Gaps = 25/203 (12%)

Query: 81  GPIYLEKSSKIYCNEKPWKENKIVEMKSEGLLYVIYNDDITKEPLLFMSFMITDDPSLVV 140
           G  Y + S KIY N +PWK NK+ EM+S GL+YV Y D+ + EP+LF+SFM+T++     
Sbjct: 77  GEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDEESDEPMLFLSFMLTEEDGF-- 134

Query: 141 PTDNDSNELSNSTAAVXXXXXXXXXXXXRNQKLGTILITNYLKKTIEILNKD----YQKN 196
            T++D         +V            RN+KLGT L+  +L+     L  +     +  
Sbjct: 135 -TEDD------KLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRLRSENGELLEYP 187

Query: 197 IIALELTVFSNNINAINFYKKIGMLYTPDSPRDKIILPQKRRTRSTTIALESKNNEPSSR 256
           +I +ELTVFS+N NAI FYK IGM  TPDSPRD++   ++RRTR             +  
Sbjct: 188 LIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRTRGM-----------AQN 236

Query: 257 LTTSXXXXXXXXXXDYYLLFLPI 279
           ++TS           YYL +LP+
Sbjct: 237 ISTSVGRTIVQKPI-YYLFYLPL 258

>SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069W NAT4 N alpha-acetyl-transferase involved in
           acetylation of the N-terminal residues of histones H4
           and H2A
          Length = 240

 Score =  104 bits (260), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 75/265 (28%), Positives = 121/265 (45%), Gaps = 41/265 (15%)

Query: 15  FPETLELLNDNSSTSNQKKVLHRQLIAIDSKNNQIDVRNNVLSYYKDNVKCXXXXXXXXX 74
           FP ++ L + + +T        R+++ ID  ++ I     V ++  D             
Sbjct: 17  FPTSITLKDGSLAT--------RKVLVIDEPSSGIAPSGQVCTWSGDRQSSNSLLIQFLK 68

Query: 75  XXXXXXGPIYLEKSSKIYCNEKPWKENKIVEMKSEGLLYVIYNDDITKEPLLFMSFMITD 134
                 G  Y   S+ +Y N + W ENK+ EM++ GL+YV Y   ++  PL+F+SF++TD
Sbjct: 69  VLDLNLGSKYRSVSATLYGNTRSWTENKLEEMQTIGLVYVGYFQGVS--PLMFLSFLLTD 126

Query: 135 DPSLVVPTDNDSNELSNSTAAVXXXXXXXXXXXXRNQKLGTILITNYLKKTIEILNKDYQ 194
           +P  +                V            + Q+LGT ++  YLK T+  L++   
Sbjct: 127 EPDFL-----------PDPVKVVYLYEIQLLPEVQGQRLGTQMLQVYLKNTVHSLSR-LD 174

Query: 195 KNIIALELTVFSNNINAINFYKKIGMLYTPDSPRDKIILPQKRRTRSTTIALESKNNEPS 254
             +  +ELTVFS+N  A++ Y  IGM   P SP D+I   Q RRTR +T  L++ +    
Sbjct: 175 PLLKGIELTVFSDNDAALHLYYSIGMALAPGSPTDEIATSQ-RRTRHSTTDLQTVSRP-- 231

Query: 255 SRLTTSXXXXXXXXXXDYYLLFLPI 279
                           DYYL+FLP+
Sbjct: 232 ----------------DYYLMFLPV 240

>CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069w
          Length = 278

 Score = 97.1 bits (240), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 89/156 (57%), Gaps = 16/156 (10%)

Query: 81  GPIYLEKSSKIYCNEKPWKENKIVEMKSEGLLYVIYN---DDITKEPLLFMSFMITDDPS 137
           G  Y   S ++Y N+KPWKENKI EM +EG++YV Y    DD    PLLF+SFM+T++ +
Sbjct: 91  GQKYEISSKEMYGNKKPWKENKIEEMNTEGMIYVSYWTKVDDEHTVPLLFLSFMLTEEEN 150

Query: 138 LVVPTDNDSNELSNSTAAVXXXXXXXXXXXXRNQKLGTILITNYLKKTIEILNKDYQKNI 197
           L   T ND        ++V            R Q LG   ++N L +  + L  +   N+
Sbjct: 151 L---THNDP------VSSVIFLYEIQISKELRKQGLGQYFLSNCLFQCAKRLLDNDSLNL 201

Query: 198 ----IALELTVFSNNINAINFYKKIGMLYTPDSPRD 229
                 +ELTVF++N+ AIN Y+K+GM +TP+SP+D
Sbjct: 202 EFPFAGIELTVFADNLPAINLYQKLGMTHTPESPKD 237

>KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {ON}
           Anc_2.532 YMR069W
          Length = 271

 Score = 92.4 bits (228), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 59/165 (35%), Positives = 86/165 (52%), Gaps = 20/165 (12%)

Query: 81  GPIYLEKSSKIYCNEKPWKENKIVEMKSEGLLYVIYNDDITKEPLLFMSFMITDDPSLVV 140
           GP+Y   S KIY N K W+ENK +EM S  L+YV Y      EP+L+ SFM+T++     
Sbjct: 95  GPVYARLSRKIYGNSKHWRENKWLEMLSAQLVYVSYWVS-DSEPVLYTSFMLTEE----- 148

Query: 141 PTDNDSNELSN--STAAVXXXXXXXXXXXXRNQKLGTILITNYLKKTIEILNKDYQKNII 198
                 N +S+  ST  V            R QKLG  +++   +  +E         + 
Sbjct: 149 ------NGISSIESTDRVVYLYEIQLIEAIRRQKLGQAIVSYLTECALE------SPEVA 196

Query: 199 ALELTVFSNNINAINFYKKIGMLYTPDSPRDKIILPQKRRTRSTT 243
           A+ LTVFS+N  A+ FY+++   YT DSPRD++    +RRT + T
Sbjct: 197 AVALTVFSDNEKALKFYERLNFTYTIDSPRDEVTEKPRRRTAART 241

>KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl- transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 260

 Score = 85.5 bits (210), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 76/150 (50%), Gaps = 13/150 (8%)

Query: 81  GPIYLEKSSKIY-CNEKPWKENKIVEMKSEGLLYVIYNDDITKEPLLFMSFMITDDPSLV 139
           GP+Y   +  IY    + W   K  EM++ GL+YV+Y+D    +PL+FMS ++TD+P L 
Sbjct: 90  GPMYTRHARAIYGAGRQSWPARKRAEMETPGLVYVVYSDS-HSQPLVFMSLLLTDEPEL- 147

Query: 140 VPTDNDSNELSNSTAAVXXXXXXXXXXXXRNQKLGTILITNYLKKTIEILNKDYQKNIIA 199
                   EL+   A V            R Q LGT L+ + L  T+  L++    +++ 
Sbjct: 148 ------GQELA---ARVLYLFEIHVSDIIRGQGLGTHLLRDCLGGTLASLSRA-SPSVLG 197

Query: 200 LELTVFSNNINAINFYKKIGMLYTPDSPRD 229
            ELTVFS N  A+  Y  +GM     SP+D
Sbjct: 198 AELTVFSENQRALRLYLALGMHVAAWSPQD 227

>YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N
           alpha-acetyl-transferase, involved in acetylation of the
           N-terminal residues of histones H4 and H2A
          Length = 285

 Score = 85.5 bits (210), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 102/238 (42%), Gaps = 12/238 (5%)

Query: 6   HLVDVAENIFPETLELLNDNSSTSNQKKVLHRQLIAI-DSKNNQIDVRNNV--LSYYKDN 62
           H +++    FPE++E  + + + +    +L R++I I +   + ID  +++  ++Y    
Sbjct: 35  HFLNLCVEKFPESIEHKDTDGNGNFTTAILEREIIYIPEDDTDSIDSVDSLKCINYKLHK 94

Query: 63  VKCXXXXXXXXXXXXXXXGPIYLEKSSKIYCNEKPWKENKIVEMKSEGLLYVIYNDDITK 122
            +                G  Y   S  +Y N KPWK NK+ EMKS GL+YV Y D+   
Sbjct: 95  SRGDQVLDACVQLIDKHLGAKYRRASRIMYGNRKPWKANKLAEMKSAGLVYVCYWDNGVL 154

Query: 123 EPLLFMSFMITDDPSLVVPTDNDSNELSNSTAAVXXXXXXXXXXXXRNQKLGTILITNYL 182
               F SFM+T++  LV     + + L   +  V            R   +G  L+ + L
Sbjct: 155 GA--FTSFMLTEETGLV-----EGDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLEHAL 207

Query: 183 KKTIEILNKDYQKNIIALELTVFSNNINAINFYKKIGMLYTPDSPRDKIILPQKRRTR 240
              +    +    N   + LTVFS+N  A   Y+ +G    P SP      P  R TR
Sbjct: 208 CDGVARHTRRMCDNFFGVALTVFSDNTRARRLYEALGFYRAPGSPAPAS--PTIRHTR 263

>KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.532
           YMR069W
          Length = 256

 Score = 82.4 bits (202), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 102/203 (50%), Gaps = 30/203 (14%)

Query: 81  GPIYLEKSSKIYCNEKPWKENKIVEMKSEGLLYVIY--NDDITKEPLLFMSFMITDDPSL 138
           G  Y + S +IY N   WK+NK+VEMKS GL+YV Y   +   K   LF+SFM+T++  +
Sbjct: 80  GNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEAEKKTCALFLSFMLTEEDFV 139

Query: 139 VVPTDNDSNELSNSTAAVXXXXXXXXXXXXRNQKLGTILITNYLKKTIEILNKDYQKN-- 196
           V    +D  + S     V            R  +LGT LI   L    +I     +    
Sbjct: 140 V----DDIRKFS-----VIYLYEIQLIEKYRGCQLGTRLIKG-LSNVCQIAQVKIRPAFP 189

Query: 197 IIALELTVFSNNINAINFYKKIGMLYTPDSPRDKIILPQKRRTRSTTIALESKNNEPSSR 256
           +I ++LTVFS+N  AI FY++IGM +T  SP+D++   + R+TR++        N  + +
Sbjct: 190 LIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESRKTRTSV-------NRKTLK 242

Query: 257 LTTSXXXXXXXXXXDYYLLFLPI 279
           +              YYLL+LP+
Sbjct: 243 VVRKPI---------YYLLYLPV 256

>Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W
           (REAL)
          Length = 255

 Score = 78.6 bits (192), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 98/230 (42%), Gaps = 13/230 (5%)

Query: 15  FPETLELLN-DNSSTSNQKKVLHRQLIAI--DSKNNQIDVR-NNVLSYYKDNVKCXXXXX 70
           FPETLE  N D ++ +    VL R+++ I     N+Q ++     ++Y     +      
Sbjct: 13  FPETLEYTNTDGNNGTATTTVLKREMLFIPEGDSNSQDNIEIPTCVNYRLHKSRGNHILD 72

Query: 71  XXXXXXXXXXGPIYLEKSSKIYCNEKPWKENKIVEMKSEGLLYVIYNDDITKEPLLFMSF 130
                     G  Y   S  +Y N KPWK NK+ EMKS  L+YV Y D+       F SF
Sbjct: 73  SCVQLIDEHLGAKYRRASRTMYGNRKPWKANKLAEMKSPNLVYVSYWDNGALAA--FASF 130

Query: 131 MITDDPSLVVPTDNDSNELSNSTAAVXXXXXXXXXXXXRNQKLGTILITNYLKKTIEILN 190
           M+T++  LV    + ++E+S     V            R   +G  L+   L + +    
Sbjct: 131 MLTEETGLV--EGDAAHEVS---VPVIYLYEVHVACVHRGHGIGRRLLERALCEGVARHV 185

Query: 191 KDYQKNIIALELTVFSNNINAINFYKKIGMLYTPDSPRDKIILPQKRRTR 240
           +   +    + LTVFS+N  A   Y+ +G    P SP      P  R TR
Sbjct: 186 RCLYEEFFGVALTVFSDNTRARRLYEALGFYRAPGSPAAGA--PTTRPTR 233

>TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.532
           YMR069W
          Length = 244

 Score = 76.3 bits (186), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 90/209 (43%), Gaps = 24/209 (11%)

Query: 35  LHRQLIAIDSKNNQIDVRNNVLSYYKDNVKCXXXXXXXXXXXXXXXGPIYLEKSSKIYCN 94
           L R+L+AID++   ++  +  +SY     +                G  Y   S  +Y N
Sbjct: 28  LTRKLLAIDTEEYPVET-DQCISYVHSPREAEKLLWQLLEILDENLGQKYAGSSRALYHN 86

Query: 95  EKPWKENKIVEMKSEGLLYVIYNDDITK----------EPLLFMSFMITDDPSLVVPTDN 144
            +PW+ NK  EM + GL+YVIY+   T            PLLF+SFM+T++  LV    +
Sbjct: 87  TRPWRVNKWREMLTPGLVYVIYSTAATTTATQRRNAPFSPLLFLSFMLTEEDGLVA---D 143

Query: 145 DSNELSNSTAAVXXXXXXXXXXXXRNQKLGTILITNYLKKTIEIL------NKDYQKNII 198
           D  E+      V            R   L   L+ ++L +    L       +  +    
Sbjct: 144 DPTEVWT----VLYLYELQLLPRVRRLGLAARLLGDHLAQCGRQLCTRSRAGRFSKTRFF 199

Query: 199 ALELTVFSNNINAINFYKKIGMLYTPDSP 227
            LELTVF++N  AI  Y+ +GM    DSP
Sbjct: 200 GLELTVFADNAPAIRLYESLGMQLAADSP 228

>Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W
           (REAL)
          Length = 254

 Score = 75.1 bits (183), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 61/214 (28%), Positives = 90/214 (42%), Gaps = 20/214 (9%)

Query: 15  FPETLELLNDNS-STSNQKKVLHRQLIAIDSKNNQID-------VRNNVLSYYKDNVKCX 66
           FPETLE    N  +T     VL R+++ I  +N ++D          N+   + D+V   
Sbjct: 13  FPETLEYTESNENATVVTTTVLKREIMYIPEENGEVDSIDGPQCTNYNLHKSHGDHV--- 69

Query: 67  XXXXXXXXXXXXXXGPIYLEKSSKIYCNEKPWKENKIVEMKSEGLLYVIYNDDITKEPLL 126
                         G  Y   S  +Y N  PWK NK+ EMKS GLLYV Y  +       
Sbjct: 70  --LDSCVQLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYWGNGALGA-- 125

Query: 127 FMSFMITDDPSLVVPTDNDSNELSNSTAAVXXXXXXXXXXXXRNQKLGTILITNYLKKTI 186
           F SFM+T++  LV    + ++E+S     V            R   LG  L+   L + +
Sbjct: 126 FASFMLTEETGLV--EGDAAHEVS---VPVIYLYEIHVAHAHRGHGLGRRLLERALCEGV 180

Query: 187 EILNKDYQKNIIALELTVFSNNINAINFYKKIGM 220
               +  + +   + LTVF +N  A   Y+ IG 
Sbjct: 181 ARRVRRVRCDFFGVALTVFGDNTRARRLYEAIGF 214

>TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.532
           YMR069W
          Length = 278

 Score = 70.9 bits (172), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 90/294 (30%), Positives = 130/294 (44%), Gaps = 34/294 (11%)

Query: 3   ELLHLVDVAENIFPETLELLNDNSSTSNQKKVLHRQLIAI-DSKNNQI--DVRNN----- 54
           ++  LV + +N FP+++        ++ Q   L R++  I DS+NN +  D  NN     
Sbjct: 2   DVRRLVQLVDNAFPKSI--------STKQGITLERKIYIIGDSENNSLLSDQNNNSNDDE 53

Query: 55  VLSYYKDNVKCXXX---XXXXXXXXXXXXGPIYLEKSSKIYCNEKPWKENKIVEMKSEGL 111
           +  Y+KD                      G +Y +KS KIY N+  W  NK  EM +  +
Sbjct: 54  IYWYFKDRKNPTVENIIKTQIFQLIDENLGKLYKKKSKKIYENDLDWSINKREEMFTSNM 113

Query: 112 LYVIYNDDITKEPLLFMSFMITDDPSLVVPTDNDSNELSNSTAAVXXXXXXXXXXXXRNQ 171
           +Y+ Y D       LF+S +  ++  ++   +ND  E       V            + Q
Sbjct: 114 IYITYWDCKQNSVALFLSILSCEETYIL--ENNDQGE-------VLYLYEIHITKEYQRQ 164

Query: 172 KLGTILITNYL-KKTIEILNKDYQK-NIIALELTVFSNNINAINFY-KKIGMLYTPDSPR 228
            +G  LI +YL +K I+ L  + Q  N I LELTVFS N +A NFY  KI M YT  SPR
Sbjct: 165 GIGERLIKDYLIEKLIKPLKIERQDNNFIGLELTVFSENNDAQNFYFNKIQMQYTFGSPR 224

Query: 229 DKIILPQKRRTRSTTIALESK---NNEPSSRLTTSXXXXXXXXXXDYYLLFLPI 279
           D+II   KR TRS    L      N  PS                +YY+L  P+
Sbjct: 225 DEIINVMKRITRSFDEKLGEHCEDNKLPSLNDKKKQLYRKSIRKPEYYILVFPV 278

>ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl-transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 188

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 74/150 (49%), Gaps = 17/150 (11%)

Query: 81  GPIYLEKSSKIYCNEKPWKENKIVEMKSEGLLYVIYNDDITKEPLLFMSFMITDDPSLVV 140
           G  Y + +  IY N K W+ NK  EM SE L +V Y +  + E + F S M  ++ S+V 
Sbjct: 33  GSYYNKYNKTIYKNNKRWQSNKWQEMCSENLFHVSYWNVESNELVCFCSIMPCEE-SIV- 90

Query: 141 PTDNDSNELSNSTAAVXXXXXXXXXXXXRNQKLGTILITNYLKKTIEILNKDYQKNIIAL 200
                  E+SN    +            RNQK G  ++ N LK+ +       + ++  +
Sbjct: 91  -----EGEMSN----IIYLYEIHVAPEWRNQKFGKSIL-NALKEKLCP-----KAHLSGI 135

Query: 201 ELTVFSNNINAINFYKKIGMLYTPDSPRDK 230
           ELTVFS+N  AINFY+  G   + DSP DK
Sbjct: 136 ELTVFSSNERAINFYRNNGFTLSYDSPSDK 165

>Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W -
           Hypothetical ORF [contig 55] FULL
          Length = 240

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/204 (29%), Positives = 90/204 (44%), Gaps = 37/204 (18%)

Query: 81  GPIYLEKSSKIYCNE-KPWKENKIVEMKSEGLLYVIY---NDDITKEPLLFMSFMI--TD 134
           GP+Y + +  +Y ++   WKE K  EM + GL+YV+Y   +++  KE L      +  TD
Sbjct: 65  GPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVYRAVDEETGKEGLPLAFLSLLLTD 124

Query: 135 DPSLVVPTDNDSNELSNSTAAVXXXXXXXXXXXXRNQKLGTILITNYLKKTIEILNKDYQ 194
           +P           EL  + AAV            R   LG  L+   +  T+    + + 
Sbjct: 125 EP-----------ELGPAPAAVVYLMEIHVADIIRGLGLGGTLLREGVAGTVRGARRAH- 172

Query: 195 KNIIALELTVFSNNINAINFYKKIGMLYTPDSPRDKIILPQKRRTRSTTIALESKNNEPS 254
             I   ELTVF++N  A+  Y ++GM     SP+D  I    RRTR+T    ES+     
Sbjct: 173 PFIQGTELTVFTDNEGALRLYLRLGMQIAAWSPQDTCI-EVHRRTRATR--YESRK---V 226

Query: 255 SRLTTSXXXXXXXXXXDYYLLFLP 278
           +R T             YYLLF P
Sbjct: 227 TRPT-------------YYLLFWP 237

>Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)
           [771 bp, 257 aa] {ON} YMR069W (REAL)
          Length = 257

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 36/62 (58%), Gaps = 3/62 (4%)

Query: 81  GPIYLEKSSKIYCNEKPWKENKIVEMKSEGLLYVIY-NDDITKEPLL--FMSFMITDDPS 137
           G  Y   S  +Y N  PWK NK+ EMKS GL+YV Y  +D   E  L  F SFM+T++  
Sbjct: 82  GAKYRRASRTMYGNRLPWKANKLAEMKSAGLVYVCYWGNDAQGERALGAFASFMLTEETG 141

Query: 138 LV 139
           LV
Sbjct: 142 LV 143

>Ecym_2528 Chr2 (1027884..1029347) [1464 bp, 487 aa] {ON} similar to
           Ashbya gossypii AGL239C
          Length = 487

 Score = 33.1 bits (74), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 33/73 (45%)

Query: 176 ILITNYLKKTIEILNKDYQKNIIALELTVFSNNINAINFYKKIGMLYTPDSPRDKIILPQ 235
           IL++++       L+K    N   L  T+F  N N  +F K   +++ PD P  K+    
Sbjct: 311 ILLSSWFFDYGHHLSKSNCVNTEKLYCTLFDKNFNDEDFEKYASIIFRPDDPHRKLFFGS 370

Query: 236 KRRTRSTTIALES 248
           K      T +LES
Sbjct: 371 KPYFGLQTASLES 383

>KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]
           {ON} similar to uniprot|P06784 Saccharomyces cerevisiae
           YDL159W STE7 Signal transducing MAP kinase kinase
           involved in pheromone response where it phosphorylates
           Fus3p and in the pseudohyphal/invasive growth pathway
           through phosphorylation of Kss1p phosphorylated by
           Ste11p degraded by ubiquitin pathway
          Length = 504

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 6/54 (11%)

Query: 183 KKTIEILNKDYQKNIIALELTVFSN---NINAINFYKKIGMLYTPDSPRDKIIL 233
           KKTI + NK+  KN +  ELT+  N   + N + FY   G  Y P +  + +IL
Sbjct: 194 KKTIPVENKEVLKNQLVRELTIMKNVSAHDNIVGFY---GAFYNPSTTNEIVIL 244

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,725,167
Number of extensions: 1279392
Number of successful extensions: 3586
Number of sequences better than 10.0: 25
Number of HSP's gapped: 3662
Number of HSP's successfully gapped: 25
Length of query: 292
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 183
Effective length of database: 40,982,805
Effective search space: 7499853315
Effective search space used: 7499853315
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)