Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1017.93.487ON31031016400.0
TPHA0D032603.487ON3143177761e-102
YGR127W3.487ON3123246731e-86
Suva_7.4153.487ON3133246713e-86
NDAI0G009703.487ON3323356621e-84
CAGL0I10582g3.487ON3193246592e-84
Smik_6.2233.487ON3133246565e-84
SAKL0F02882g3.487ON2983136442e-82
Skud_7.4383.487ON3133246401e-81
NCAS0E008403.487ON3363206308e-80
KAFR0C019303.487ON3133206219e-79
KLTH0F14718g3.487ON3003146061e-76
KLLA0E04687g3.487ON3063176042e-76
Kwal_55.212173.487ON3033145947e-75
TDEL0D055503.487ON3103185741e-71
KNAG0B008403.487ON3133235426e-67
Ecym_12423.487ON3113185252e-64
ZYRO0D10098g3.487ON2762824901e-59
AFR305W3.487ON3093174887e-59
TBLA0D029903.487ON3183154662e-55
TPHA0K019404.56ON87364721.5
Smik_8.2391.100ON122889669.2
Smik_11.641.184ON94573669.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1017.9
         (310 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}...   636   0.0  
TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.48...   303   e-102
YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative pro...   263   1e-86
Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W (...   263   3e-86
NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON...   259   1e-84
CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa] ...   258   2e-84
Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W (...   257   5e-84
SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {O...   252   2e-82
Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W (...   251   1e-81
NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {O...   247   8e-80
KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.48...   243   9e-79
KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} simil...   238   1e-76
KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {O...   237   2e-76
Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W...   233   7e-75
TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3....   225   1e-71
KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON...   213   6e-67
Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON} ...   206   2e-64
ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {O...   193   1e-59
AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic hom...   192   7e-59
TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON...   184   2e-55
TPHA0K01940 Chr11 (408375..410996) [2622 bp, 873 aa] {ON} Anc_4....    32   1.5  
Smik_8.239 Chr8 (384015..387701) [3687 bp, 1228 aa] {ON} YHR155W...    30   9.2  
Smik_11.64 Chr11 complement(123662..126499) [2838 bp, 945 aa] {O...    30   9.9  

>Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}
           complement(28899..29831) [933 nt, 311 aa]
          Length = 310

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/310 (100%), Positives = 310/310 (100%)

Query: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSKSNEKNVNKIG 60
           MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSKSNEKNVNKIG
Sbjct: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSKSNEKNVNKIG 60

Query: 61  TWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIKFLDNKETDSLLNWDSYEKFV 120
           TWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIKFLDNKETDSLLNWDSYEKFV
Sbjct: 61  TWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIKFLDNKETDSLLNWDSYEKFV 120

Query: 121 KEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTVDNPYLVISNDKFGKSNGKSTK 180
           KEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTVDNPYLVISNDKFGKSNGKSTK
Sbjct: 121 KEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTVDNPYLVISNDKFGKSNGKSTK 180

Query: 181 EWEKITLAKNLLKHLPLCETEDDLIHKCFDIASTNTLNEDLIKDVDVRELMTETILVPPL 240
           EWEKITLAKNLLKHLPLCETEDDLIHKCFDIASTNTLNEDLIKDVDVRELMTETILVPPL
Sbjct: 181 EWEKITLAKNLLKHLPLCETEDDLIHKCFDIASTNTLNEDLIKDVDVRELMTETILVPPL 240

Query: 241 NVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILYNSDDDVTTQKLSSP 300
           NVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILYNSDDDVTTQKLSSP
Sbjct: 241 NVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILYNSDDDVTTQKLSSP 300

Query: 301 IQDLTYNFTI 310
           IQDLTYNFTI
Sbjct: 301 IQDLTYNFTI 310

>TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.487
           YGR127W
          Length = 314

 Score =  303 bits (776), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 158/317 (49%), Positives = 217/317 (68%), Gaps = 11/317 (3%)

Query: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSKSNEKNVNKIG 60
           MCIL  +R HP+Y+LILISNRDEFLQR+T  +CWN+     +LCPYD+S+ NE + +K G
Sbjct: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSR-NETDPSKFG 59

Query: 61  TWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIKFLDNKETDSLLNWDSYEKFV 120
           TWCGINEFGRVS++LNLK D++        KKSRG LP+KFLDN++ +S  +W+SY KF+
Sbjct: 60  TWCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFLDNRKENSFNDWNSYSKFL 119

Query: 121 KEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTVDN----PYLVISNDKFGKSNG 176
           K+YP +++TG FN F GDV+  +Y +IDS G T  +L   +      +VISN +F  SN 
Sbjct: 120 KQYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVISNSEF-ISND 178

Query: 177 KSTKEWEKITLAKNLLKHLPLCETEDD--LIHKCFDIASTNTL-NEDLIKDVDVRELMTE 233
           K  + W KI+  + L+      +  D+  +I  CF IAST+ L NE L    D+ +LMTE
Sbjct: 179 K--ERWHKISNGEKLMDEFLSKDIRDENSVIESCFKIASTSELTNEYLHSHDDILDLMTE 236

Query: 234 TILVPPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILYNSDDDVT 293
           T+ VPP+ +    EK+ IGASLP+G++YGTRSQIVILVNK RT V+++ER+LY  DDDV+
Sbjct: 237 TVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLYECDDDVS 296

Query: 294 TQKLSSPIQDLTYNFTI 310
              +  PI +L + + I
Sbjct: 297 KAGIEKPINELNFEYNI 313

>YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative
           protein of unknown function; expression is regulated by
           Msn2p/Msn4p, indicating a possible role in stress
           response
          Length = 312

 Score =  263 bits (673), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 151/324 (46%), Positives = 215/324 (66%), Gaps = 26/324 (8%)

Query: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSK-SNEKNVNKI 59
           MCIL+A+R HP+Y+LILISNRDEFL R+TH TCW+  ++  IL PYD++K S EK +   
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDF--ILSPYDLAKTSAEKQI--F 56

Query: 60  GTWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIKFLDNKETDSLLNWDSYEKF 119
           GTW GIN+ G+++TILNLK D+  Q++  S  +SRG LP  FL   + D   +WD+Y+KF
Sbjct: 57  GTWSGINKEGKLATILNLKLDNE-QNNTKS--RSRGLLPFIFLSIHKAD-FEDWDNYKKF 112

Query: 120 VKEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTVD-----NPYLVISNDKFGKS 174
              Y  +K TGDFNFFYGDV   +Y VIDS+G T +VL+       + Y+V+SN KF  S
Sbjct: 113 EGHYDGLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDS 172

Query: 175 NGKSTKEWEKITLAKNLLKHLPLCETEDD---LIHKCFDIASTNTL-----NEDLIKDVD 226
           +    + WEK+ +A++ L++L L   E D   +I  CF +AS ++L     N D+++ VD
Sbjct: 173 SSIPGQAWEKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQMVD 232

Query: 227 VRELMTETILVPPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILY 286
               M  TI VPPL    +  ++ +GAS+P G YYGTRSQIV+LV+K+ T+V FIER+LY
Sbjct: 233 PNVTMN-TIYVPPLR---RPPRDDLGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLY 288

Query: 287 NSDDDVTTQKLSSPIQDLTYNFTI 310
           +SD+DV    ++SP ++  + F +
Sbjct: 289 SSDEDVRKYSVTSPKEEKRFKFKL 312

>Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  263 bits (671), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 151/324 (46%), Positives = 210/324 (64%), Gaps = 25/324 (7%)

Query: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSK-SNEKNVNKI 59
           MCIL+A+R HP Y+LILISNRDEFL+R+TH TCW+  ++  IL PYD++K S EK +   
Sbjct: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDF--ILSPYDVAKTSMEKQI--F 56

Query: 60  GTWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIKFLDNKETDSLLNWDSYEKF 119
           GTW GIN+ G+++TILNLK DD  Q S  +  KSRG LP  FL + +     +WD Y KF
Sbjct: 57  GTWSGINKEGKLATILNLKMDD--QRSC-TKSKSRGMLPFTFLTSHKA-RFQDWDDYNKF 112

Query: 120 VKEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTV-----DNPYLVISNDKFGKS 174
            K Y  ++ TGDFNFFYGDV   +Y VIDS+G T +VL        + Y+VISN K+  S
Sbjct: 113 EKHYDGLRTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYHNS 172

Query: 175 NGKSTKEWEKITLAKNLLKHLPLCETEDD---LIHKCFDIASTNTLNE-----DLIKDVD 226
           +  S + WEK+ +A++ L+ L L   E D   LI  CF +AS ++L +     DL++ + 
Sbjct: 173 SSISEQAWEKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKPDLLQMLV 232

Query: 227 VRELMTETILVPPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILY 286
              +   TI VPPL    +   + +GAS+P G YYGTRSQIV+LV+K+ +KV FIER+LY
Sbjct: 233 DPNVTMNTIYVPPLR---RPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLY 289

Query: 287 NSDDDVTTQKLSSPIQDLTYNFTI 310
           +SD+DV+    S+P ++  + F +
Sbjct: 290 SSDEDVSHYSASAPKEEKRFEFEL 313

>NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON}
           Anc_3.487 YGR127W
          Length = 332

 Score =  259 bits (662), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 146/335 (43%), Positives = 203/335 (60%), Gaps = 30/335 (8%)

Query: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSKSNEKNVNKI- 59
           MCILLA+  HP+Y+LILISNRDEFLQR+TH +CW+  ++  IL PYDM+K  + N  K+ 
Sbjct: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDF--ILSPYDMAKECKYNDKKVF 58

Query: 60  GTWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIKFLDNKETDSLLNWDSYEKF 119
           GTW GIN+ G+++T+LNLK + S         KSRG LP  +L +   DS   WD Y+ F
Sbjct: 59  GTWLGINKDGKIATVLNLKLNKSLSLKQLVAPKSRGMLPFVYLSDMTEDSFAEWDGYDNF 118

Query: 120 VKEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTVDNPYLVISNDKFG------- 172
            K+YP ++ TGDFN FYGDV+  +Y ++DSIG+T   L  +  YLV+SND F        
Sbjct: 119 TKKYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQYLVVSNDVFTCNGQLGE 178

Query: 173 -----KSNGKS------TKEWEKITLAKNLLKHL---PLCET--EDDLIHKCFDIASTNT 216
                K  GK        + W K+ L   LL+ L    + E   ED +I +CF ++ST +
Sbjct: 179 LQSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSSTCS 238

Query: 217 LN-EDLIKDVDVRELMTETILVPPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNR 275
           +  ED  K      L  ETILVPPL     ++   +G SLPIG+YYGTRSQIVIL+ +  
Sbjct: 239 VTVEDHCKFHQNSTLPNETILVPPLRCKITDD---VGTSLPIGEYYGTRSQIVILIKRGT 295

Query: 276 TKVKFIERILYNSDDDVTTQKLSSPIQDLTYNFTI 310
            +VKF E ++Y SD D+ T   ++P + + ++FT+
Sbjct: 296 YEVKFAEHVIYTSDSDIKTFSPANPKETVRFDFTL 330

>CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa]
           {ON} similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127w
          Length = 319

 Score =  258 bits (659), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 141/324 (43%), Positives = 208/324 (64%), Gaps = 20/324 (6%)

Query: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSKSNEKNVN-KI 59
           MCIL A+R+HP+Y+LI+ISNRDEFL+R+TH TCW+  ++  IL PYD+++      N   
Sbjct: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDF--ILSPYDLARIGAGQSNDTF 58

Query: 60  GTWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIKFLDNKETDSLLNWDSYEKF 119
           GTW G+N  GRV+T+LNL+  D         ++SRGALP  FL++++ +   +WD+Y KF
Sbjct: 59  GTWTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLNDRQGN-FEDWDTYAKF 117

Query: 120 VKEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLT-VDNPYLVISNDKFGKSNGKS 178
            K YP +K TGDFN FYGD + G+Y +IDS+G+T+ + +     YLVISN+   K + +S
Sbjct: 118 CKCYPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYLVISNNIHDKLHLQS 177

Query: 179 T------KEWEKITLAKNLLKHLPLCET---EDDLIHKCFDIASTNTLNEDLIKDVDVRE 229
                  +EW KI   K +++      T   ++D+I  CF +ASTN + + + ++ D+ +
Sbjct: 178 QDINSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFDLVK 237

Query: 230 ---LMTETILVPPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILY 286
              +  ETI V PL     EE   IG+ L  GQYYGTRSQIV+LV+K++TK  FIERI+Y
Sbjct: 238 SLGVTKETIYVQPLLTPPHEE---IGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERIIY 294

Query: 287 NSDDDVTTQKLSSPIQDLTYNFTI 310
           +SD D++    S+P ++L Y + I
Sbjct: 295 SSDQDISLYSTSNPKEELRYEYDI 318

>Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  257 bits (656), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 146/324 (45%), Positives = 212/324 (65%), Gaps = 25/324 (7%)

Query: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSKSNEKNVNKIG 60
           MCIL+A+R HP+Y+LILISNRDEFL R+TH TCW+  ++  IL PYD+++++ K   + G
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDF--ILSPYDLARTS-KEGQEFG 57

Query: 61  TWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIKFLDNKETDSLLNWDSYEKFV 120
           TW GIN+ G+++TILNLK   S +S++ S  KSRG LP  FL N E +   +WDSY KF 
Sbjct: 58  TWSGINKEGKLATILNLKLG-SERSTIKS--KSRGLLPYIFLSNHEAN-FKDWDSYSKFG 113

Query: 121 KEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTVD-----NPYLVISNDKFGKSN 175
             Y  +K TGDFNFFYGDV   +Y VIDS+G T +VL+       + Y+VISN +F  ++
Sbjct: 114 NHYDGLKATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNTS 173

Query: 176 GKSTKEWEKITLAKNLLKHLP---LCETEDDLIHKCFDIASTNTLNEDLIKDVDVRELMT 232
               K WEK+ LA++ L+ L    +   E+ +I  CF +AS ++L   + K  DV +++ 
Sbjct: 174 SIPEKAWEKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKP-DVLQMLV 232

Query: 233 E------TILVPPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILY 286
           +      TI VPPL    +   + +GAS+P G +YGTRSQIV+L++K+ TK  FIERI+Y
Sbjct: 233 DPNVTMSTIYVPPLR---RPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIY 289

Query: 287 NSDDDVTTQKLSSPIQDLTYNFTI 310
           +SD+DV    +S+P ++  + F +
Sbjct: 290 SSDEDVRQYSVSAPKEEKRFEFEL 313

>SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 298

 Score =  252 bits (644), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 137/313 (43%), Positives = 196/313 (62%), Gaps = 18/313 (5%)

Query: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSKSNEKNVNKIG 60
           MCILL +  HP Y LILISNRDEF +R TH TC +  ++  I+ P+DMS + +      G
Sbjct: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDF--IVSPFDMSITTKGR--NFG 56

Query: 61  TWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIKFLDNKETDSLLNWDSYEKFV 120
           TWCG+N+ G+V+ ILNL+             +SRG +P+KFL  K+ D   NWDSYEKF 
Sbjct: 57  TWCGVNKDGKVAVILNLRIASCGNPKNVECPQSRGIVPMKFLAGKDVD-FNNWDSYEKFS 115

Query: 121 KEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTVDNPYLVISNDKFGKSNGKSTK 180
             YP +++TG+FN FYGD   G+Y +I S+  T +    D+ Y+V+SND        S K
Sbjct: 116 HHYPGIEKTGNFNLFYGDCSKGEYKLISSLSETTDGFQNDDGYMVVSNDLIS-----SKK 170

Query: 181 EWEKITLAKNLLKHL---PLCETEDDLIHKCFDIASTNTLNEDLIKDVDVRELMTETILV 237
           +W KI+LAKNLL++L    + +T+D ++ KCF +AS +T +E ++  V    +  ETI V
Sbjct: 171 KWGKISLAKNLLRNLVESSVDDTKDSILDKCFKLASHSTCSEKIV--VKHESVTNETIYV 228

Query: 238 PPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILYNSDDDVTTQKL 297
           PPL V   E  + +  S+P G+YYGTRSQIVILV+K++ K+ F+ER+LY  D+DV     
Sbjct: 229 PPLLV---ENGQDLDVSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLKYGP 285

Query: 298 SSPIQDLTYNFTI 310
            +P + + + F I
Sbjct: 286 KNPKEQIEFEFDI 298

>Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  251 bits (640), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 145/324 (44%), Positives = 204/324 (62%), Gaps = 25/324 (7%)

Query: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSK-SNEKNVNKI 59
           MCIL+A+R HP+Y+LILISNRDEFL R+TH TCW+  ++  IL PYD++K S EK +   
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDF--ILSPYDLAKTSKEKQI--F 56

Query: 60  GTWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIKFLDNKETDSLLNWDSYEKF 119
           GTW GIN  G+++TILNLK D   + ++ S  KSRG LP  FL   + D   NWD+Y+KF
Sbjct: 57  GTWSGINREGKLATILNLKLDGQ-RDTIKS--KSRGLLPFTFLSTHKAD-FQNWDNYDKF 112

Query: 120 VKEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTVD-----NPYLVISNDKFGKS 174
              Y  +  TGDFNFFYGDV   +Y +IDS+G T  VL        N Y+ +SN +F  S
Sbjct: 113 EMNYDGLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFYNS 172

Query: 175 NGKSTKEWEKITLAKNLLKHLPLCETEDD---LIHKCFDIASTNTLNEDLIKDVDVREL- 230
              S + W+K+ +A++ L+ L L   + D   +I  CF +AS +++     K   ++ L 
Sbjct: 173 PSISEQAWKKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQMLA 232

Query: 231 ----MTETILVPPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILY 286
               +  TI VPPL    +   + +GAS+P G YYGTRSQIV+LV+KN +KV FIERILY
Sbjct: 233 DPNVIMNTIYVPPLR---RPPDDDLGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILY 289

Query: 287 NSDDDVTTQKLSSPIQDLTYNFTI 310
           +SD+DV    +++P ++  + F +
Sbjct: 290 SSDEDVNHYSVATPKEEKRFEFKL 313

>NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {ON}
           Anc_3.487 YGR127W
          Length = 336

 Score =  247 bits (630), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 143/320 (44%), Positives = 197/320 (61%), Gaps = 19/320 (5%)

Query: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSKSNEKNVNKI- 59
           MCILLA+  HP Y+LILISNRDEF +R+TH +CW+  ++  IL P+DM+KS E +  KI 
Sbjct: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDF--ILSPFDMAKSCELHEKKIF 74

Query: 60  GTWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIKFLDNKETDSLLNWDSYEKF 119
           GTW GIN   +++TILNLK +           +SRG +P  FL   ++D    WD+YEKF
Sbjct: 75  GTWIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFLSEHDSD-FNKWDTYEKF 133

Query: 120 VKEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTVDNPYLVISNDKFG------- 172
             +Y ++++TGDFNFFYGD    +Y +IDS G+T +VL+ D PYL +SND F        
Sbjct: 134 DGKYNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLSGD-PYLTVSNDMFATGGITVE 192

Query: 173 KSNGKSTKEWEKITLAKNLLKHL---PLCETEDDLIHKCFDIASTNTLN-EDLIKDVDVR 228
           +++     EW KI   K LL+ L        ED LI KCF +AST ++  ++  K     
Sbjct: 193 RASNNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSVQPKENTKFNQNS 252

Query: 229 ELMTETILVPPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILYNS 288
            L  ETI VPPL     E  + IG SL +G+YYGTRSQIVIL++KN  +VK +E ILY S
Sbjct: 253 TLPMETIFVPPLEC---EVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEHILYTS 309

Query: 289 DDDVTTQKLSSPIQDLTYNF 308
           D+D+     ++P +  ++ F
Sbjct: 310 DNDIQHYSSTNPKEVKSFEF 329

>KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.487
           YGR127W
          Length = 313

 Score =  243 bits (621), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 140/320 (43%), Positives = 205/320 (64%), Gaps = 18/320 (5%)

Query: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSKSNEKNVNKI- 59
           MCIL A+R H  Y+LILISNRDE+L R+THETCW+   +  IL PYDMS+  E + NKI 
Sbjct: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNF--ILSPYDMSRE-ENHGNKIF 57

Query: 60  GTWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIKFL--DNKETDSLLNWDSYE 117
           GTW G+N+ G+++TILNL+   S         +SRG +P  FL  D    DS   W+++E
Sbjct: 58  GTWLGMNKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETFE 117

Query: 118 KFVKEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTVDNPYLVISNDKFGKSN-- 175
           KF  +YPF++ +GDFNFFYGD++ G Y +IDS+G+T +VL  +N  ++ISND +   +  
Sbjct: 118 KFKSKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRNMIISNDLYQHKDEY 177

Query: 176 -GKSTKEWEKITL-AKNLLKHLPLCE--TEDDLIHKCFDIASTNTLNEDLIKDVDV-REL 230
            GK T  W KI + A+ L K L   E   ED+++ KCF++AS  +++  + ++ +  +EL
Sbjct: 178 EGKPT--WGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREENPNKEL 235

Query: 231 MTETILVPPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILYNSDD 290
             ETI VPPL V   E+   IG +   G+YYGTR+QIV+LV+K+R  V  +E  ++NSD+
Sbjct: 236 AAETIYVPPLKVCPDED---IGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHNSDE 292

Query: 291 DVTTQKLSSPIQDLTYNFTI 310
           ++      +P +    +FTI
Sbjct: 293 EIYKYSGLNPKEVQRLDFTI 312

>KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} similar
           to uniprot|P53275 Saccharomyces cerevisiae YGR127W
           Hypothetical ORF
          Length = 300

 Score =  238 bits (606), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 132/314 (42%), Positives = 190/314 (60%), Gaps = 21/314 (6%)

Query: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMS-KSNEKNVNKI 59
           MCIL+AS  HP Y LI ISNRDEF +R+T  TC N  +Y  IL P D + +SN K    +
Sbjct: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDY--ILSPLDTALRSNNKPA--L 56

Query: 60  GTWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIKFLDNKETDSLLNWDSYEKF 119
           GTWCG+N  GRV+ ILNL+N +  +     +  SRG++P+K+L ++   +  +W+S+EKF
Sbjct: 57  GTWCGVNRKGRVAVILNLRNKEPAKRIPVKSPISRGSVPMKYLMDRGPST--DWNSFEKF 114

Query: 120 VKEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTVDNPYLVISNDKFGKSNGKST 179
           V +YP + E  +FN FYGD   G+Y  IDS+G ++E LT + P LV+SND        S+
Sbjct: 115 VSKYPQITEC-EFNMFYGDCIAGEYTCIDSLGYSSEALTANKPNLVLSNDHID-----SS 168

Query: 180 KEWEKITLAKNLLKHLPLC---ETEDDLIHKCFDIASTNTLNEDLIKDVDVRELMTETIL 236
             W K+  A  LL+ L      ++E++LI KCF +AS     E  I + D  E    +I 
Sbjct: 169 SRWPKVQKADILLQELVQSSQHDSEEELIEKCFALASNTEPAE--IDNSDKEEFTCSSIF 226

Query: 237 VPPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILYNSDDDVTTQK 296
           +PP+ +    EK  +GASLP G++YGTRSQIVILV ++   + F ER+L++SD +V    
Sbjct: 227 IPPVEI---PEKVDVGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPLHS 283

Query: 297 LSSPIQDLTYNFTI 310
              P + L +N  +
Sbjct: 284 EKHPKEKLQFNLHV 297

>KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 306

 Score =  237 bits (604), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 136/317 (42%), Positives = 188/317 (59%), Gaps = 20/317 (6%)

Query: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSKSNEKNVNKIG 60
           MCIL A+R HP+Y LIL+SNRDEF +R+TH TCWN   +  IL PYDM+   EK     G
Sbjct: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGF--ILSPYDMAI--EKKGQGYG 56

Query: 61  TWCGINEFGRVSTILNLKNDDSFQSS---VPSTKKSRGALPIKFLDNKETDSLLNWDSYE 117
           TW GIN  GR++ ILNLK D    S    V    +SRG +P++FL  ++     NWDS+E
Sbjct: 57  TWLGINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSWE 116

Query: 118 KFVKEYPFVKETGDFNFFYGDVRIGKYNVIDSI-GSTNEVLTVDNPYLVISNDKFGKSNG 176
           KF  ++  ++ TG F  FYGD +  +YNVID +  STN    ++  ++VISND F  + G
Sbjct: 117 KFNGQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKME--HMVISNDIFHCAVG 174

Query: 177 KSTKEWEKITLAKNLLKHLPLCET---EDDLIHKCFDIASTNTLNEDLIKDVDVRELMTE 233
           + T  W K      LL  L    T   +++L+ KCF++ S +T NE      DV  + T 
Sbjct: 175 EHTSRWNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTFNE----GEDVDSVTTS 230

Query: 234 TILVPPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILYNSDDDVT 293
           +I VPPL +   +  + IG SLPIG YYGTRSQIVILV+K+  +V + E ++Y SD+D  
Sbjct: 231 SIYVPPLRIT--KGADAIGTSLPIGDYYGTRSQIVILVDKD-NRVTYEEHVIYESDEDCE 287

Query: 294 TQKLSSPIQDLTYNFTI 310
           T     P + + + F +
Sbjct: 288 TYSFMDPKEVIQFQFNM 304

>Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W -
           Hypothetical ORF [contig 131] FULL
          Length = 303

 Score =  233 bits (594), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 134/314 (42%), Positives = 199/314 (63%), Gaps = 30/314 (9%)

Query: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMS--KSNEKNVNK 58
           MCILLAS  HP Y LILISNRDEF++R+T  TC N  +Y  ++ P DM+   +NE N   
Sbjct: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDY--VVSPLDMTLKDNNEPN--- 55

Query: 59  IGTWCGINEFGRVSTILNLKNDDSFQSSVPSTKK--SRGALPIKFLDNKETDSLLNWDSY 116
           +GTWCG N  GR++ ILNL+  ++ Q+    TK+  SRG + +++L +K+  S  +W+SY
Sbjct: 56  LGTWCGANRNGRIAVILNLRTGNTNQTK---TKRIVSRGNVTMRYLTDKQPAS--DWNSY 110

Query: 117 EKFVKEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTVDNPYLVISNDKFGKSNG 176
            KF  + P +K + +FN FYGD + G Y  IDS G + EVL   NPYLVISND       
Sbjct: 111 AKFASKCPDIK-SCEFNMFYGDCKSGDYTAIDSSGHSFEVLRSQNPYLVISNDSI----- 164

Query: 177 KSTKEWEKITLAKNLLKHL---PLCETEDDLIHKCFDIASTNTLNEDL-IKDVDVRELMT 232
           +S  +W KI LA+ L++ L    + ++EDDL+ +CF +AS     +D  +  +D  ++ +
Sbjct: 165 ESATKWPKIELAEKLMRDLVRDSVNDSEDDLLARCFSLASHK---QDYNVDHMDKEKVTS 221

Query: 233 ETILVPPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILYNSDDDV 292
             I VPPL V    + E +GAS+P G++YGTRSQIV+LV+K    ++F+E +LY+SD + 
Sbjct: 222 SNIFVPPLEV---PKSEDLGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPET 278

Query: 293 TTQKLSSPIQDLTY 306
           T    ++P + ++Y
Sbjct: 279 THFCAANPKKCVSY 292

>TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3.487
           YGR127W
          Length = 310

 Score =  225 bits (574), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 128/318 (40%), Positives = 188/318 (59%), Gaps = 18/318 (5%)

Query: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSKSNEKNVNKIG 60
           MCIL+A+ DHP YDL+L+SNRDE+  R+     W +  +  +LCP D  K  + +   +G
Sbjct: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNF--MLCPLD--KGLDSSGEDLG 56

Query: 61  TWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIKFLDNKETDSLLNWDSYEKFV 120
           TW G N  G++ T+LNLK     +       +SRG +P+ FL ++  +   +WD+Y+KF 
Sbjct: 57  TWIGANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSSRGAN-FKDWDTYDKFC 115

Query: 121 KEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTVDN-PYLVISNDKF-GKSNGKS 178
            ++  ++ T DFNFFYGD  IG Y VIDS+G+T +VL   N  Y+V+SND F G+SN   
Sbjct: 116 HQFQGLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEKYIVVSNDIFQGESN--K 173

Query: 179 TKEWEKITLAKNLLKHL--PLCET-EDDLIHKCFDIASTNTLNEDLIKD---VDVRELMT 232
            + W+KI+LA   L HL     +T ED  I +CF IAS N  +         +   EL  
Sbjct: 174 NRVWDKISLADQALHHLVREFNDTDEDKFIQECFGIASINPFHSKHDHGNYYMKAVELSM 233

Query: 233 ETILVPPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILYNSDDDV 292
           +T+ VPPL        + +GAS+PIG+YYGTRSQ VILV+K+R+ + ++ERI+++SD D 
Sbjct: 234 QTVFVPPLKTSC---DDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLDA 290

Query: 293 TTQKLSSPIQDLTYNFTI 310
                    +   Y+F +
Sbjct: 291 LQYSRDHYKEQKRYDFDL 308

>KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON}
           Anc_3.487 YGR127W
          Length = 313

 Score =  213 bits (542), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 133/323 (41%), Positives = 187/323 (57%), Gaps = 25/323 (7%)

Query: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSKSNEKNVNKI- 59
           MCILL +R+HP+YDL+LISNRDEF +R TH T W+ G+Y  IL PYDM+K        + 
Sbjct: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDY--ILSPYDMTKGLYDPGKCVR 58

Query: 60  GTWCGINEFGRVSTILNLKNDDSF---QSSVPSTKKSRGALPIKFLDNKETDSLLNWDSY 116
           GTW G+N  GRVST+LNLK +       S  P  ++SRG +P  FL ++    +  WDS+
Sbjct: 59  GTWMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLSDR--GFIDQWDSF 116

Query: 117 EKFVKEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLT-VDNPYLVISNDKFGKSN 175
           EKF   YP ++++GDFN F GD+R   Y V+DS G+T  VL       +V+SND + + N
Sbjct: 117 EKFRDRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMNMVVSNDTYKEFN 176

Query: 176 GKSTKEWEKITLAKNLLKHLPLCETEDDL-----IHKCFDIASTNTL---NEDLIKDVDV 227
                EW K+ L K  LK   L  T  +L     I KCF  AS  ++   +ED+ K    
Sbjct: 177 ENDISEWNKVKLGK--LKLHELVNTAVNLDKSSFIDKCFHAASFCSIEKSHEDISK---T 231

Query: 228 RELMTETILVPPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILYN 287
            E+++ TI VPPL    +++   +G +   G Y+GTRSQ+V LV+K+R +V   ERIL+ 
Sbjct: 232 PEVISNTIFVPPLKCQPQQD---VGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHT 288

Query: 288 SDDDVTTQKLSSPIQDLTYNFTI 310
           SD D       +P +   + F +
Sbjct: 289 SDLDRDFNSPHNPKEVKQFTFDL 311

>Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON}
           similar to Ashbya gossypii AFR305W
          Length = 311

 Score =  206 bits (525), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 120/318 (37%), Positives = 175/318 (55%), Gaps = 16/318 (5%)

Query: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSKS-NEKNVNKI 59
           MCILLA+ DHP+Y LILISNRDEF +RRTH TCW+Q     IL PYD+S S N  + +K 
Sbjct: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQD--GVILAPYDISNSENASDASKA 58

Query: 60  ----GTWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIKFLDNKETDSLLNWDS 115
               GTW GIN  G VS +LNLK      +     +KSRG + + FL +    +   W++
Sbjct: 59  ELSYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNRKSRGNVTVAFLRDLSNGNWDKWNN 118

Query: 116 YEKFVKEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTVDNPYLVISNDKFGKSN 175
           YEKF + +  + +T  F  FYGD++ G + +IDS   +    +   PY+VISN +    +
Sbjct: 119 YEKFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSKQPYVVISNSRVNCED 178

Query: 176 GKSTKEWEKITLAKNLLKHLP---LCETEDDLIHKCFDIASTNTLNEDLIKDVDVRELMT 232
                 W+K+   + LLK L    L  +++ L+ KCF++A T+  + + +  V    L  
Sbjct: 179 --EGPRWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTSQFDVNGVIQVTDTSLPE 236

Query: 233 ETILVPPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILYNSDDDV 292
           +TI VP L          +G S  +G+YYGTR+ IVILV+ N   V   E ++++SD D+
Sbjct: 237 KTIFVPTLKAAG---NSSMGVSKIVGEYYGTRTTIVILVD-NFNHVTMHEHVIHDSDKDI 292

Query: 293 TTQKLSSPIQDLTYNFTI 310
                 +P   + Y F I
Sbjct: 293 GLSSAMNPKTKVAYEFDI 310

>ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 276

 Score =  193 bits (490), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 114/282 (40%), Positives = 165/282 (58%), Gaps = 23/282 (8%)

Query: 41  RILCPYDMSKSNEKNVNKIGTWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIK 100
           R + P  +  + E   +K GTWCGIN+ GRV T+LNLK D   Q   P    SRG +P  
Sbjct: 5   RWIYPLPLRCTPEHRAHKFGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLSSRGKVPTA 64

Query: 101 FLDNKETDSLLNWDSYEKFVKEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTV- 159
           FL   + D    W+SY KF  ++  +  TGDFNFFYGD + G+Y +IDS+  T++VLT  
Sbjct: 65  FLSQHDLD-WEQWNSYNKFANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNN 123

Query: 160 ----DNPYLVISNDKFGKSNGKSTKEWEKITLAKNLLKHL---PLCETEDDLIHKCFDIA 212
               D+ Y+V+SND + +  G+ T  W K+ LAK  L+ L    + E +D  I KCF +A
Sbjct: 124 ESQDDSSYMVVSNDVY-RYQGEET--WPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVA 180

Query: 213 STNT----LNEDLIKDVDVRELMTETILVPPLNVMTKEEKEKIGASLPIGQYYGTRSQIV 268
           ST+      +E+L+K  DV +   ++I VPPL          +G +   G +YGTRSQIV
Sbjct: 181 STSPGLDWQSEELLKSSDVTK---QSIFVPPLKF---PPDLNLGTTTHAG-FYGTRSQIV 233

Query: 269 ILVNKNRTKVKFIERILYNSDDDVTTQKLSSPIQDLTYNFTI 310
           +LV+K+R KV F+ER+L+NSD+ V+ +    P + L + F +
Sbjct: 234 LLVSKDRQKVTFVERVLHNSDEQVSQRSPDHPAEQLKFQFDL 275

>AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR127W
          Length = 309

 Score =  192 bits (488), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 111/317 (35%), Positives = 182/317 (57%), Gaps = 18/317 (5%)

Query: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSKSNEKNVNK-- 58
           MCIL A+  HP Y L+LISNRDE+  R+TH TCW+  +   IL PYDM+  +   ++   
Sbjct: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHND--SILAPYDMALQDADGLDHGS 58

Query: 59  -IGTWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIKFLDNKETDSLLNWDSYE 117
             GTW GIN  G VS +LNL   D+      S + SRGA+ +++L + + ++  +W++YE
Sbjct: 59  PCGTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEYLKDFDHNNWDSWNTYE 118

Query: 118 KFVKEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTVDNPYLVISNDKFGKSNG- 176
           KF   +P + +T  F  FYGDV   +++VI+S+G T +  +  +PY V+SN   G S+G 
Sbjct: 119 KFGAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPFS-QSPYYVVSN---GPSDGA 174

Query: 177 KSTKEWEKITLAKNLLKHL---PLCETEDDLIHKCFDIASTNTLNEDLIKDVDVRELMTE 233
           K+  +W K+     L K +    L  +E++L+ +CF++AS +    +    V    +   
Sbjct: 175 KALGQWPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSNQPIGVHDDSIPKR 234

Query: 234 TILVPPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILYNSDDDVT 293
           TI VP L  ++ +      A    G YYGTRS IV+LV+++   V   E ++++SD D+ 
Sbjct: 235 TIFVPALYNLSGQANLSFAA----GMYYGTRSTIVMLVSEDGNVVT-REHVIHDSDQDLD 289

Query: 294 TQKLSSPIQDLTYNFTI 310
           +  + +P + +T+ F++
Sbjct: 290 SYSILNPKEQVTHRFSL 306

>TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON}
           Anc_3.487 YGR127W
          Length = 318

 Score =  184 bits (466), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 115/315 (36%), Positives = 179/315 (56%), Gaps = 28/315 (8%)

Query: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSK-------SNE 53
           MCILL +  HP Y LILISNRDE  +R TH TCWN    + IL PYDMSK        +E
Sbjct: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHN--STILYPYDMSKDICHDGGGDE 58

Query: 54  KNVNKIGTWCGINEFGRVSTILNLKNDDSFQ--SSVPSTKKSRGALPIKFLDNKETDSLL 111
           +  ++ GTWCG+N+ G++ T+LNL  ++  +      ++ +SRG +PIK+L + +     
Sbjct: 59  RFKSEHGTWCGLNKDGKICTVLNLLKEEEARRDGDCNNSLQSRGLIPIKYLCDFD-HGFQ 117

Query: 112 NWDSYEKFVKEYPFV-KETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTVDNPYLVISNDK 170
           +W++Y+KF+++   +  + G FN F GD++  +Y++I+S+G +  VL  +NPY+V+SN  
Sbjct: 118 DWNTYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEENPYMVVSNIN 177

Query: 171 FGKSNGKSTKEWEKITLAKNLLKHL------PLCETEDDLIHKCFDIAST-NTLNEDLIK 223
           +G  + K   EW KI     LL+ L         + E +++  CF I+ST N   + +  
Sbjct: 178 WG--DPKKMGEWSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLSGKKIDG 235

Query: 224 DVDVRELMTETILVPPLNVMTKEEKEKIGASLPIG------QYYGTRSQIVILVNKNRTK 277
           +++  E   + I VPPL     E +   G            +YYGTRSQIV+L  +   K
Sbjct: 236 NIERLEQTKDLIFVPPLKRSEGEVRGDAGGDAGGDAGGESVKYYGTRSQIVVLCERKSNK 295

Query: 278 VKFIERILYNSDDDV 292
           V F+ERIL+  ++D 
Sbjct: 296 VTFVERILHCKNEDA 310

>TPHA0K01940 Chr11 (408375..410996) [2622 bp, 873 aa] {ON} Anc_4.56
           YGL049C
          Length = 873

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 5/64 (7%)

Query: 34  WNQGEYARILCPYDMSKSNEKNVNKIGTWCGIN---EFGRVSTILNLKNDDSFQSSVPST 90
           W Q   ++I+ P  MS+SN+    K G    I    +FG+  ++ N++     +S   S 
Sbjct: 395 WVQSTASKIVIPSGMSRSNKPRDGKFGMGSRIGSSRDFGKAGSLRNMEGRSGSRSG--SK 452

Query: 91  KKSR 94
           +KSR
Sbjct: 453 RKSR 456

>Smik_8.239 Chr8 (384015..387701) [3687 bp, 1228 aa] {ON} YHR155W
            (REAL)
          Length = 1228

 Score = 30.0 bits (66), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 45/89 (50%), Gaps = 12/89 (13%)

Query: 205  IHKCFDIASTNTLNEDLIKDVDV-RELMTETILVPPLNVMTKEEKEKIGASLPI------ 257
            IH  F + S  TL ++   +  +  ++M  ++ VP LN++TK+  +  G + P+      
Sbjct: 1083 IHSYFSVKSAETLFQNYANNDQLGLQIMHRSVSVPDLNLLTKDMMDS-GQANPVLKRFDE 1141

Query: 258  ----GQYYGTRSQIVILVNKNRTKVKFIE 282
                 +Y  TR +I I  N+  T++K ++
Sbjct: 1142 DKNAYRYKETRQEIAIKRNQVLTELKILQ 1170

>Smik_11.64 Chr11 complement(123662..126499) [2838 bp, 945 aa] {ON}
           YKL165C (REAL)
          Length = 945

 Score = 30.0 bits (66), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 34/73 (46%), Gaps = 12/73 (16%)

Query: 76  NLKNDDSFQSSVPST----------KKSRGALPIKFLDNKETDSLLNWDSYEKFVKEYPF 125
           N+K +D  Q+ + S           K S G LPI +LD KE+D L    +  + + E   
Sbjct: 347 NIKRNDVKQADIASLMSYLIGVNYPKNSVGELPIAYLDGKESDKLSALYNNARSILEQYL 406

Query: 126 VK--ETGDFNFFY 136
           VK  E  D  FFY
Sbjct: 407 VKQDEVIDSQFFY 419

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.135    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,626,433
Number of extensions: 1813983
Number of successful extensions: 6058
Number of sequences better than 10.0: 69
Number of HSP's gapped: 6197
Number of HSP's successfully gapped: 69
Length of query: 310
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 201
Effective length of database: 40,982,805
Effective search space: 8237543805
Effective search space used: 8237543805
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)