Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1017.73.491ON37837814990.0
TPHA0D032703.491ON3883968761e-115
Skud_16.4433.491ON4204207971e-103
KLTH0F14806g3.491ON3583927153e-91
ZYRO0D10010g3.491ON3823917043e-89
SAKL0F02794g3.491ON3974026871e-86
Kwal_55.212273.491ON3763846809e-86
KLLA0E04621g3.491ON3894095931e-72
TDEL0D055903.491ON3442735631e-68
Suva_16.4773.491ON4232795663e-68
Ecym_12383.491ON3934035643e-68
NDAI0B058503.491ON4732985493e-65
Smik_16.4013.491ON4272815447e-65
YPR148C3.491ON4352945404e-64
AFR309C3.491ON3643885302e-63
NCAS0F035403.491ON4442605318e-63
KAFR0G036803.491ON4152774862e-56
TBLA0D029803.491ON4432704785e-55
CAGL0L08492g3.491ON3852484161e-46
KNAG0A079303.491ON4521562738e-26
KAFR0I019507.221ON3302101876e-15
NDAI0A026607.221ON3642201852e-14
TDEL0H022407.221ON3382391814e-14
Kpol_478.227.221ON3501991762e-13
Ecym_43777.221ON3332091743e-13
ZYRO0D16522g7.221ON3582071728e-13
KLTH0A03894g7.221ON3232361709e-13
SAKL0F08162g7.221ON3302561621e-11
ADL115W7.221ON3332091611e-11
Kwal_47.181487.221ON3232101611e-11
Suva_9.1597.221ON3252451611e-11
Skud_9.1287.221ON3292451602e-11
Kpol_1070.197.221ON3113671584e-11
Smik_9.1507.221ON3262101559e-11
YIL041W (GVP36)7.221ON3262101531e-10
CAGL0L00891g7.221ON3412031541e-10
NCAS0A133807.221ON3292401522e-10
KLLA0E04511g7.221ON3022661485e-10
TPHA0B027507.221ON3631951442e-09
TBLA0B015807.221ON3862201443e-09
TBLA0D042007.221ON3312081362e-08
KNAG0D017607.221ON3422031353e-08
TPHA0C012307.221ON3052091343e-08
KAFR0B041105.119ON47459685.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1017.7
         (378 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137...   582   0.0  
TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {O...   342   e-115
Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {...   311   e-103
KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]...   280   3e-91
ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} simila...   275   3e-89
SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} simila...   269   1e-86
Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {...   266   9e-86
KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some s...   233   1e-72
TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa] ...   221   1e-68
Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {...   222   3e-68
Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar t...   221   3e-68
NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa] ...   216   3e-65
Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {...   214   7e-65
YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON} ...   212   4e-64
AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}...   208   2e-63
NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {O...   209   8e-63
KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {O...   191   2e-56
TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.4...   188   5e-55
CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} simil...   164   1e-46
KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa] ...   109   8e-26
KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.22...    77   6e-15
NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221     76   2e-14
TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.2...    74   4e-14
Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON} (67833..6...    72   2e-13
Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}...    72   3e-13
ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]...    71   8e-13
KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {O...    70   9e-13
SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {O...    67   1e-11
ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic ho...    67   1e-11
Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {O...    67   1e-11
Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W (...    67   1e-11
Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W (...    66   2e-11
Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON} (45405.....    65   4e-11
Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W (...    64   9e-11
YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR do...    64   1e-10
CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} simil...    64   1e-10
NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {...    63   2e-10
KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {O...    62   5e-10
TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.2...    60   2e-09
TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.2...    60   3e-09
TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7....    57   2e-08
KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.2...    57   3e-08
TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.22...    56   3e-08
KAFR0B04110 Chr2 (850702..852126) [1425 bp, 474 aa] {ON} Anc_5.1...    31   5.8  

>Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137
           bp, 378 aa] {ON}
           (27496..28272,28322..28330,28419..28769) [1137 nt, 379
           aa]
          Length = 378

 Score =  582 bits (1499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/378 (80%), Positives = 306/378 (80%)

Query: 1   MFSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKL 60
           MFSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKL
Sbjct: 1   MFSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKL 60

Query: 61  GTINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSXXXXXX 120
           GTINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLS      
Sbjct: 61  GTINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSDWWTND 120

Query: 121 XXXXXXXXXXXXIQSNKSFLPRSFAQAISNASFDAASNVNSVTNTIKLNHKXXXXXXXXX 180
                       IQSNKSFLPRSFAQAISNASFDAASNVNSVTNTIKLNHK         
Sbjct: 121 DNVTNTDENDENIQSNKSFLPRSFAQAISNASFDAASNVNSVTNTIKLNHKDDEEEEEDD 180

Query: 181 XXWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNVHQLRKSVENS 240
             WSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNVHQLRKSVENS
Sbjct: 181 EEWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNVHQLRKSVENS 240

Query: 241 RLKFDTMRYELKIKEWKRTXXXMEAEDKSDVXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
           RLKFDTMRYELKIKEWKRT   MEAEDKSDV                             
Sbjct: 241 RLKFDTMRYELKIKEWKRTXXXMEAEDKSDVSKKGTSKKETPKKEASKKETPKKEINKKE 300

Query: 301 XXXXXXXXXXXXXXKLLEKLEDEFVSNTQNAVEKMEELTDNSKIINLVKLYQNFQLVYYK 360
                         KLLEKLEDEFVSNTQNAVEKMEELTDNSKIINLVKLYQNFQLVYYK
Sbjct: 301 DITNEGNTENDNDNKLLEKLEDEFVSNTQNAVEKMEELTDNSKIINLVKLYQNFQLVYYK 360

Query: 361 QCIQEIESNLKILNGLEE 378
           QCIQEIESNLKILNGLEE
Sbjct: 361 QCIQEIESNLKILNGLEE 378

>TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {ON}
           Anc_3.491 YPR148C
          Length = 388

 Score =  342 bits (876), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 192/396 (48%), Positives = 244/396 (61%), Gaps = 30/396 (7%)

Query: 1   MFSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKL 60
           MFS FS+DKLTDSISNVALKTQEN TNA++++N N+E  LNDPNTKLSI++++R+IQE+L
Sbjct: 1   MFSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQL 60

Query: 61  GTINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSXXXXXX 120
           GT++D+ SKLP  Y +LE+KTD++EK LKRLL VT T+ TEGYDYPPNLTES+S      
Sbjct: 61  GTLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAED 120

Query: 121 XXXXXXXXXXXXIQSNKSFLPRSFAQAISNASFDAASNVNSVTNTIKLNHKXXXXXXXXX 180
                          NK+FLPRSFAQA++ A  D+    +     IKL            
Sbjct: 121 ETT-----------ENKNFLPRSFAQALAKAYSDSKLITDKAERNIKLQTSPKNTGTKDE 169

Query: 181 XXWSD------------------LHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDL 222
              +                   L K F++L N + NIDNGK EMD +IVNEFN KL+ L
Sbjct: 170 NPEAGAEEEVEADDDEEDEDLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNEFNKKLEHL 229

Query: 223 INTEFKNVHQLRKSVENSRLKFDTMRYELKIKEWK-RTXXXMEAEDKSDVXXXXXXXXXX 281
           +  EFK V QLR++VENSRLKFDTMRY++K+KE K       E     ++          
Sbjct: 230 LEVEFKEVAQLRRNVENSRLKFDTMRYDVKLKEAKAEQEEAKEVSTDKEIEKKESETKEP 289

Query: 282 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLLEKLEDEFVSNTQNAVEKMEELTDN 341
                                            KLLE+LEDEFVSNT +AVEKMEELTD+
Sbjct: 290 ETKGTEEKEPETKDTEEKDPVKENEGENEDEDYKLLEQLEDEFVSNTSSAVEKMEELTDS 349

Query: 342 SKIINLVKLYQNFQLVYYKQCIQEIESNLKILNGLE 377
           +KI++LVKL+QNFQLVYY+QC+QEIE+NLK ++ LE
Sbjct: 350 AKILDLVKLFQNFQLVYYRQCVQEIENNLKTISDLE 385

>Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {ON}
           YPR148C (REAL)
          Length = 420

 Score =  311 bits (797), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 184/420 (43%), Positives = 230/420 (54%), Gaps = 49/420 (11%)

Query: 2   FSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKLG 61
           FSGFS++K+TDSI+  A KTQ+ L NAL++ N NL    NDP T+LSIKS+ RF+QE LG
Sbjct: 5   FSGFSLNKITDSIATAAHKTQDTLNNALASANVNL----NDPETRLSIKSRTRFVQESLG 60

Query: 62  TINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSXXXXXXX 121
           T++D  SKLPP Y  LE K+D++EK  +R+L V+KT+E EGYDYPPNLTES+S       
Sbjct: 61  TVSD-ISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNK 119

Query: 122 XXXXXXXXXXXIQSNK------SFLPRSFAQAISNASFDAASNVNSVTNTIKLNHKXXXX 175
                          K      +FLPRSFAQAIS A+ D      S+    K   K    
Sbjct: 120 DGWFGSRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQDEKAGLKKKSE 179

Query: 176 XXXX---------------XXXWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLK 220
                                  S+L K+F+S   CY+NID GK EMD  ++ EFN KL+
Sbjct: 180 SNETAQDAEAQEEDEEDEEDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSTMIKEFNKKLE 239

Query: 221 DLINTEFKNVHQLRKSVENSRLKFDTMRYELKIKEWKRTXXXME---------------- 264
            LIN +FK VH+LRK VE+SRLKFDTMRYE+K KE K      E                
Sbjct: 240 KLINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAETSKEVDDKAVSANAPI 299

Query: 265 -------AEDKSDVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLL 317
                   ED+S +                                           KLL
Sbjct: 300 SPDENPTTEDESPISKDLEGDSKKETSGSAADDAAVVKEDSKANQGDEPTIEDLEENKLL 359

Query: 318 EKLEDEFVSNTQNAVEKMEELTDNSKIINLVKLYQNFQLVYYKQCIQEIESNLKILNGLE 377
           EKLEDEFVSNT  AVE MEE+TD+S I+ LVKL+QNFQLVY++QC+QE+E+NLK+LN LE
Sbjct: 360 EKLEDEFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQEVEANLKVLNSLE 419

>KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score =  280 bits (715), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 164/392 (41%), Positives = 218/392 (55%), Gaps = 58/392 (14%)

Query: 2   FSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKLG 61
           F GFS++KLT+SI+NVA KTQ+ L+ A++N+       L+DP  KLS+K++  ++QE LG
Sbjct: 5   FGGFSLNKLTNSITNVAHKTQDTLSTAIANIQ------LDDPQAKLSLKARKHYLQETLG 58

Query: 62  TINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSXXXXX-- 119
           TI D  SKLPP Y  LE K D++EK  +R+L VTKTYE EGYDYPPNL+ESLS       
Sbjct: 59  TIED-ISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNK 117

Query: 120 ------XXXXXXXXXXXXXIQSNKSFLPRSFAQAISNASFDAASNVNSVTNTIKLNHKXX 173
                                S ++ +PRSFAQAIS A+ D+   + ++        K  
Sbjct: 118 EGLFGFVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTE---EQKAS 174

Query: 174 XXXXXXXXXWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNVHQL 233
                     + L K+FE+   C  N+D  K EMD L+V EFN+KL   +  +FKN   L
Sbjct: 175 AEEDEEDEDITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTL 234

Query: 234 RKSVENSRLKFDTMRYELKIKE--------WKRTXXXMEAEDKSDVXXXXXXXXXXXXXX 285
           RK VE+SRLKFDTMRYELK+ E         ++T      ED+++               
Sbjct: 235 RKKVEDSRLKFDTMRYELKMAEEQGKTEEAAQQTESQKPQEDEAEA-------------- 280

Query: 286 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLLEKLEDEFVSNTQNAVEKMEELTDNSKII 345
                                        KLLEKLEDEFVSNT  AVE M E+TD+++II
Sbjct: 281 ------------------SKDSDSSDEAQKLLEKLEDEFVSNTTEAVETMGEITDSAEII 322

Query: 346 NLVKLYQNFQLVYYKQCIQEIESNLKILNGLE 377
           NLVKL+ NFQL+YYKQC+Q +E+++  LN LE
Sbjct: 323 NLVKLFHNFQLIYYKQCVQNLETSINSLNELE 354

>ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 382

 Score =  275 bits (704), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 166/391 (42%), Positives = 219/391 (56%), Gaps = 29/391 (7%)

Query: 2   FSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKLG 61
           FS FS   L DSI+N A +TQ+ L+NA++NVN      LNDP T+LSIK++ R+++E LG
Sbjct: 5   FSSFSFKNLGDSIANAAHRTQDKLSNAVANVN------LNDPQTRLSIKTRTRYLKETLG 58

Query: 62  TINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLS-----XX 116
            + D+ SKLPP Y  LE K+DA+EKA KR+L VT+T+E EGYDYPPNL ES S       
Sbjct: 59  AV-DEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSK 117

Query: 117 XXXXXXXXXXXXXXXXIQSNKS----FLPRSFAQAISNASFDAASNVNSVTNTIKLNHKX 172
                           IQ++ S     +PRSFAQAI+ AS +      +  N+ K   K 
Sbjct: 118 EGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGE---AYQNSQKSEKKQ 174

Query: 173 XXXXXXXXXXWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNVHQ 232
                       +L ++F +L  CYRNID GK EMDK I  EFN+KL+ L+N +FK +H 
Sbjct: 175 IDEDEDDV----NLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHV 230

Query: 233 LRKSVENSRLKFDTMRYELKI------KEWKRTXXXMEAEDKSDVXXXXXXXXXXXXXXX 286
           LR  VENSRLKFDTMRYE+++      +E + T    E     +                
Sbjct: 231 LRNKVENSRLKFDTMRYEMRLKEKEEKEENENTANADEGPSNKNQQEPTNEPAKEEEKPT 290

Query: 287 XXXXXXXXXXXXXXXXXXXXXXXXXXXXKLLEKLEDEFVSNTQNAVEKMEELTDNSKIIN 346
                                       KLLE+LEDEFVSNT  AVE M  + + S+I+ 
Sbjct: 291 PAEPAEAQHTTKTENSNKEPMVEKPEDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILR 350

Query: 347 LVKLYQNFQLVYYKQCIQEIESNLKILNGLE 377
           L+KL+QN QLVYY+QC+QE+E++LK LN LE
Sbjct: 351 LMKLFQNLQLVYYRQCVQEMEASLKGLNDLE 381

>SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 397

 Score =  269 bits (687), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 165/402 (41%), Positives = 217/402 (53%), Gaps = 37/402 (9%)

Query: 2   FSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKLG 61
           FS FS+DKLT+SIS+ A KTQ+ L+ A++N+       L+DP  KLS+K +  ++QE LG
Sbjct: 5   FSSFSLDKLTNSISSAAHKTQDKLSTAIANIQ------LDDPQAKLSLKVRKHYLQETLG 58

Query: 62  TINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSX------ 115
            I+D  SKLPP Y  LE K D++EK  +R+L VTKT+E EGYDYPPNL+ES+S       
Sbjct: 59  AIDD-ISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANR 117

Query: 116 ----XXXXXXXXXXXXXXXXXIQSNKSFLPRSFAQAISNASFDAASNVNSVTNTIKLNHK 171
                                   N+ FLPRSFAQA+S A+ D+      V  T+K   K
Sbjct: 118 SGLLSFMDGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSG----DVLRTLKDEQK 173

Query: 172 X--XXXXXXXXXXWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKN 229
                         + L  +FE+   C + ID  K EMD L+  EFN KL  LIN +FK 
Sbjct: 174 EPPQDEDEDEDEDINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFKK 233

Query: 230 VHQLRKSVENSRLKFDTMRYE--LKIKEWKRTXXXMEAEDKSDVXXXXXXXXXXXXXXXX 287
           VH LRK VE SRLKFDT+RYE  LK KE ++     E  +K DV                
Sbjct: 234 VHSLRKKVEESRLKFDTLRYELNLKEKEQQKAKAKEEENEKVDVVEQNAPEEKAKTEGQE 293

Query: 288 XXXXXXXXXXXXXXXXXXXXXX------------XXXXXKLLEKLEDEFVSNTQNAVEKM 335
                                                  KLLEKLEDEFVS+T  AVE M
Sbjct: 294 TSEGKEHDLKADEKLSEDTASKIPESVENEEVDNEDPEHKLLEKLEDEFVSSTTEAVEIM 353

Query: 336 EELTDNSKIINLVKLYQNFQLVYYKQCIQEIESNLKILNGLE 377
            E+TD+S+I++LVKL+  FQL+Y++QC+QE+E++ KIL+GL+
Sbjct: 354 GEITDSSEILSLVKLFHKFQLIYHRQCVQELEASTKILDGLD 395

>Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {ON}
           YPR148C - Hypothetical ORF [contig 130] FULL
          Length = 376

 Score =  266 bits (680), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 154/384 (40%), Positives = 213/384 (55%), Gaps = 24/384 (6%)

Query: 2   FSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKLG 61
           F GFS +KLTD+++N A KTQ+ L+ A++N+       L+DP   LS+K++  ++QE LG
Sbjct: 5   FGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQ------LDDPQAILSLKARKHYLQETLG 58

Query: 62  TINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSXXXXX-- 119
           TI D  SKLPP Y  LE K D++EKA +R+L VTKT+E EGYDYPPNL+ESLS       
Sbjct: 59  TIED-ISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNK 117

Query: 120 ------XXXXXXXXXXXXXIQSNKSFLPRSFAQAISNASFDAASNVNSVTNTIKLNHKXX 173
                                +  + +PRSFAQAI+ A+ D+   + ++ +      +  
Sbjct: 118 EGLFGLMSSSKKDKGAESAAAAKSALMPRSFAQAIAKAAKDSGDVLAALKDQ---EQQAS 174

Query: 174 XXXXXXXXXWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNVHQL 233
                     + L K+F +   C   ID GK EMD L+  EFN KL  LI  +FKN   L
Sbjct: 175 ADEEDEDEDITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVL 234

Query: 234 RKSVENSRLKFDTMRYELKIKEWKRTXXXMEAEDKSDVXXXXXXXXXXXXXXXXXXXXXX 293
           R+ VE+SRLKFDTMRYE+K+ E +++   ME E                           
Sbjct: 235 RRKVEDSRLKFDTMRYEVKLTE-QQSKQAMENE-----KAQFKESDLSSKEEGADANETS 288

Query: 294 XXXXXXXXXXXXXXXXXXXXXKLLEKLEDEFVSNTQNAVEKMEELTDNSKIINLVKLYQN 353
                                +LLEKLEDEFVSNT  AVE M E+TD+++++NLVKL+ N
Sbjct: 289 NEVGKSVTKTKEEQATNDAAQELLEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHN 348

Query: 354 FQLVYYKQCIQEIESNLKILNGLE 377
           FQLVY++QC+Q++E++L  LN LE
Sbjct: 349 FQLVYHRQCVQDLEASLSTLNELE 372

>KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some
           similarites with uniprot|Q06523 Saccharomyces cerevisiae
           YPR148C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 389

 Score =  233 bits (593), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 152/409 (37%), Positives = 208/409 (50%), Gaps = 56/409 (13%)

Query: 1   MFSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKL 60
           MFS  S++ +TDSISN A +TQE  ++A+  +      +L+DP T+LSI  +   +QE L
Sbjct: 1   MFSKLSLNNITDSISNAAQRTQEQFSSAIEKI------HLDDPETRLSILKRRHQLQETL 54

Query: 61  GTINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLS------ 114
           GT++D  S+LP  Y  LE K+DA+EK  KRLL VTKT+E EGYDYPPNLTES +      
Sbjct: 55  GTVHD-ISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGN 113

Query: 115 -XXXXXXXXXXXXXXXXXXIQSNKSFLPRSFAQAISNASFDAA----------SNVNSVT 163
                                +    LPRSFAQA+S A+ D+A          +  N   
Sbjct: 114 KDSIFSFSKKKAEVSPEVKETAENGLLPRSFAQALSKAATDSALILKQLKAEETRTNQEE 173

Query: 164 NTIKLNHKXXXXXXXXXX-------------XWSDLHKIFESLGNCYRNIDNGKTEMDKL 210
           +    + K                          +L K FES   C  +ID  K EMD L
Sbjct: 174 SQEGADQKPAEETKAEPELEAEADEDEDEDEDVDNLIKAFESWTKCQLSIDQSKAEMDSL 233

Query: 211 IVNEFNNKLKDLINTEFKNVHQLRKSVENSRLKFDTMRYELKIK--EWKRTXXXMEAEDK 268
           +V EFN KL  LI T+FK  H+LR  V+++RL FDT+R+E+K+K  E +      EAE K
Sbjct: 234 MVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLKLQEKEVVASSEEAEKK 293

Query: 269 SDVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLLEKLEDEFVSNT 328
                                                         KL E+LED+FVS T
Sbjct: 294 -----------------VATETPETPEKKTNEEPVDMAKTEEDPDSKLFERLEDQFVSAT 336

Query: 329 QNAVEKMEELTDNSKIINLVKLYQNFQLVYYKQCIQEIESNLKILNGLE 377
              VE + ELTD+S+II+LVKL+ NFQL++YKQC++ +E +L++LN L+
Sbjct: 337 SETVEFLGELTDSSEIISLVKLFHNFQLIHYKQCVKSLEEDLEVLNSLD 385

>TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa]
           {ON} Anc_3.491 YPR148C
          Length = 344

 Score =  221 bits (563), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 122/273 (44%), Positives = 169/273 (61%), Gaps = 22/273 (8%)

Query: 2   FSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKLG 61
            S FS++K+TD+++N A KTQ+ L +A++NV+        DP  KLS+K++ R++QE LG
Sbjct: 5   LSNFSLNKITDTLANAAHKTQDTLNSAIANVS--------DPQAKLSLKARTRYLQETLG 56

Query: 62  TINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSXXXXXXX 121
           TI+D+ SKLPP Y  LE K+DA+EK  KR+L VT+T+E EGYDYPPNLTES+S       
Sbjct: 57  TIDDK-SKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNK 115

Query: 122 XXXXXXXXXXXIQSNKS-----FLPRSFAQAISNASFDAASNVNSVTNTIKLNHKXXXXX 176
                       +++ S     FLPRSF+QAIS A+ D         N++  N +     
Sbjct: 116 DGWFGTKKPEKTKNDSSDGSDAFLPRSFSQAISKAANDC--------NSVFTNLQEHGDE 167

Query: 177 XXXXXXWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNVHQLRKS 236
                  S++ K+F+S   CY+NID GK EMD +I  EFN KL+ +IN +FK VH  RK 
Sbjct: 168 DEEDEDVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKKVHASRKK 227

Query: 237 VENSRLKFDTMRYELKIKEWKRTXXXMEAEDKS 269
           VE SRLKFDT+RYE+K+KE +      E ++ S
Sbjct: 228 VEESRLKFDTVRYEIKLKETENAKKSTETDEAS 260

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 46/54 (85%)

Query: 324 FVSNTQNAVEKMEELTDNSKIINLVKLYQNFQLVYYKQCIQEIESNLKILNGLE 377
           FVSNT  AVE M E+T++++I+ L KL+QNFQLVY++QC+QE+E++LKIL  LE
Sbjct: 287 FVSNTTAAVEIMGEVTESAEILGLAKLFQNFQLVYFRQCVQEVEASLKILGALE 340

>Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {ON}
           YPR148C (REAL)
          Length = 423

 Score =  222 bits (566), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 130/279 (46%), Positives = 164/279 (58%), Gaps = 31/279 (11%)

Query: 2   FSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKLG 61
            SG+  +K+TDSI+  A KTQ+ L +AL+N N NL    NDP T+LSIKS+ RF+QE LG
Sbjct: 1   MSGY-WNKITDSIATAAHKTQDTLNSALANANVNL----NDPQTRLSIKSRTRFVQESLG 55

Query: 62  TINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSXXXXXXX 121
           T++D  SKLPP Y  LE K+D++EK  KR+L V+KT+E EGYDYPPNLTES+S       
Sbjct: 56  TVSD-ISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNK 114

Query: 122 XXXXXXXXXXXIQSNK------SFLPRSFAQAISNASFDAASNVNSVTNTIKLNHKXXXX 175
                          K      +FLPRSFAQAIS A+ D  S   ++    K + K    
Sbjct: 115 DGWFGSKKTEHASKKKDSNHDDTFLPRSFAQAISKAAVDCESEFKNLEQNEKEDLKQKKE 174

Query: 176 XXX-------------------XXXXWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFN 216
                                      S+L K+F+S   CY+NID GK EMD ++V EFN
Sbjct: 175 AKKTTQETAEQEEEEEEEEEEEDDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEFN 234

Query: 217 NKLKDLINTEFKNVHQLRKSVENSRLKFDTMRYELKIKE 255
            KL+ LIN +FK VH+LR+ VE SRLKFDTMRYE K KE
Sbjct: 235 KKLEKLINEDFKKVHELRRKVEESRLKFDTMRYEGKSKE 273

 Score =  104 bits (259), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 47/63 (74%), Positives = 59/63 (93%)

Query: 315 KLLEKLEDEFVSNTQNAVEKMEELTDNSKIINLVKLYQNFQLVYYKQCIQEIESNLKILN 374
           KLLEKLEDEFVSNT  AVE MEE+TD+S+I++LVKL+QNFQLVY++QC QE+E+NLK+LN
Sbjct: 360 KLLEKLEDEFVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEANLKVLN 419

Query: 375 GLE 377
           G+E
Sbjct: 420 GME 422

>Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar to
           Ashbya gossypii AFR309C
          Length = 393

 Score =  221 bits (564), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 144/403 (35%), Positives = 205/403 (50%), Gaps = 50/403 (12%)

Query: 2   FSGFSIDKLTDSISNVALKTQ-------ENLTNALSNVNENLENYLNDPNTKLSIKSKAR 54
           FS FS+DK+  +I+  A KTQ       E LT+A+ ++N      L+DP T LS++++  
Sbjct: 5   FSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSIN------LDDPQTMLSLRTRKH 58

Query: 55  FIQEKLGTINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLS 114
            +QE LGTI D  SKLPP Y  LE K DA EK   R+L V+KT+E +GYDYPPNL ES+S
Sbjct: 59  QLQETLGTIKD-ISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESIS 117

Query: 115 ----------------XXXXXXXXXXXXXXXXXXIQSNKSFLPRSFAQAISNASFDAASN 158
                                              +SN+ ++P SFAQAIS A+ D+ + 
Sbjct: 118 DWWGSSSKKDGVFWGFGKKSKNDKNKAEQKSSAEKKSNEGYIPPSFAQAISKAADDSITI 177

Query: 159 VNSVTNTIKLNHKXXXXXXXXXXXWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNK 218
           +  +     +N                L  I E+      NID  K +MD+ ++NEFN K
Sbjct: 178 LKELNEEQLVNPSNGAETEDEDV--DSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKK 235

Query: 219 LKDLINTEFKNVHQLRKSVENSRLKFDTMRYELKIK-----EWKRTXXXMEAEDKSDVXX 273
           L  L+N +F  V  LRK VE SRLKFDT+RYEL+++     + K T   +E++  +D   
Sbjct: 236 LDSLVNNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVNDKDK 295

Query: 274 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLLEKLEDEFVSNTQNAVE 333
                                                     LLEK EDEFVSNT +AV 
Sbjct: 296 ENEDNLKPTIHNNTGIGSSSDEEDQKFRL-------------LLEKAEDEFVSNTTDAVA 342

Query: 334 KMEELTDNSKIINLVKLYQNFQLVYYKQCIQEIESNLKILNGL 376
            M ++TD+  +  LVKL+ NFQL+Y+K+C+QE++++L ++N L
Sbjct: 343 YMTQITDSVNLSTLVKLFHNFQLIYHKKCVQELQASLNVINTL 385

>NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa]
           {ON} Anc_3.491 YPR148C
          Length = 473

 Score =  216 bits (549), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 130/298 (43%), Positives = 164/298 (55%), Gaps = 52/298 (17%)

Query: 1   MFSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKL 60
           MFS FS+DK+T+SI N A K    L NA+        N   DP TKLSIKS+ R  QE+L
Sbjct: 1   MFSSFSLDKITNSIGNAAQKATNTLNNAI--------NTATDPQTKLSIKSQTRLFQEQL 52

Query: 61  GTINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSXXXXXX 120
           GTI+D  SKLP  Y  LELKTD++EK++KR+L V+KT+E EGYDYPPNLTES S      
Sbjct: 53  GTIHD-ISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNIT 111

Query: 121 XXXXXXXXXXXXIQ------------------------SNKSFLPRSFAQAISNASFDAA 156
                       +                         ++ SFLPRSFAQAIS ++ D  
Sbjct: 112 KKSSSHRKKQISVNNKKKNNTDNDHDNATNVEPIENDITSSSFLPRSFAQAISKSAMDCT 171

Query: 157 SNVNSVT--------NTIKLNHKXXXXXXXXXXXW-----------SDLHKIFESLGNCY 197
                ++         TIK  ++                        +L K FES  NCY
Sbjct: 172 DIYQQLSIQETATKETTIKDENEAQEEDDEDAGEEEEEDDDDDEDIQNLIKAFESWSNCY 231

Query: 198 RNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNVHQLRKSVENSRLKFDTMRYELKIKE 255
           +NID GK+EMD ++  EFNNKL+DLIN EFK V+ LRK V +SRLKFDT+R+E+KIKE
Sbjct: 232 KNIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEIKIKE 289

 Score = 95.5 bits (236), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 44/63 (69%), Positives = 56/63 (88%)

Query: 315 KLLEKLEDEFVSNTQNAVEKMEELTDNSKIINLVKLYQNFQLVYYKQCIQEIESNLKILN 374
           KLLE+LEDEFVS+T +AVE M E+T++S II L+KL+QNFQLVYY+QC+QEIE+NLK LN
Sbjct: 409 KLLEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLN 468

Query: 375 GLE 377
            L+
Sbjct: 469 ELD 471

>Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {ON}
           YPR148C (REAL)
          Length = 427

 Score =  214 bits (544), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 134/281 (47%), Positives = 165/281 (58%), Gaps = 32/281 (11%)

Query: 2   FSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKLG 61
           FS FS++K+TDSI+  A KT + L NAL+N N      LNDP T+LSIKS+ RF+QE LG
Sbjct: 5   FSSFSLNKITDSIATAAHKTHDTLNNALANAN----VNLNDPQTRLSIKSRTRFVQESLG 60

Query: 62  TINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSXXXXXXX 121
           TI+D  SKLPP Y  LE K+D++EK  KR+L V+KT+E EGYDYPPNLTES+S       
Sbjct: 61  TISD-ISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNK 119

Query: 122 XXXXXXXXXXXIQSNK------SFLPRSFAQAISNASFDAASNVNSVTNTIKLNHKXXXX 175
                          K      +FLPRSFAQAIS A+ D      ++ N  K   K    
Sbjct: 120 DGWFGSKKSEITNKKKGSNHDDAFLPRSFAQAISKAAVDCEFEFQNLENDEKAELKKKRE 179

Query: 176 XXXXXXX---------------------WSDLHKIFESLGNCYRNIDNGKTEMDKLIVNE 214
                                        S+L K+F+S   CY+NID GKTEMD ++V E
Sbjct: 180 STKNAQTTGAQDEENEEDEDEEEEEDEDLSNLIKVFDSWSTCYKNIDEGKTEMDSMMVKE 239

Query: 215 FNNKLKDLINTEFKNVHQLRKSVENSRLKFDTMRYELKIKE 255
           FN KL+ LIN +FK VH+LRK VE SRLKFDTMRYE+K KE
Sbjct: 240 FNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKE 280

 Score =  104 bits (260), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 58/63 (92%)

Query: 315 KLLEKLEDEFVSNTQNAVEKMEELTDNSKIINLVKLYQNFQLVYYKQCIQEIESNLKILN 374
           KLLEKLEDEFVSNT  AVE MEE+ D+S+I+ L+KL+QNFQLVY++QC+QE+E+NLK+LN
Sbjct: 364 KLLEKLEDEFVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLN 423

Query: 375 GLE 377
           GLE
Sbjct: 424 GLE 426

>YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON}
           Protein of unknown function that may interact with
           ribosomes, based on co-purification experiments; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 435

 Score =  212 bits (540), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 134/294 (45%), Positives = 169/294 (57%), Gaps = 35/294 (11%)

Query: 2   FSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKLG 61
           FSGFS++K+TDSI+  A KTQ+ L NAL+N N      LNDP T+LSIKS+ RF+QE LG
Sbjct: 5   FSGFSLNKITDSIATAAHKTQDTLNNALANAN----VNLNDPQTRLSIKSRTRFVQESLG 60

Query: 62  TINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLS------X 115
           T++D  SKLPP Y  LE K+D++EK  KR+L V+KT+E EGYDYPPNLTES+S       
Sbjct: 61  TVSD-ISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNK 119

Query: 116 XXXXXXXXXXXXXXXXXIQSNKSFLPRSFAQAISNASFDAASNVNSVTN----------- 164
                               + +FLPRSFAQAIS A+ D      ++ +           
Sbjct: 120 DGWFGSKKSESSTKKKGSNHDDAFLPRSFAQAISKAAVDCECEFQNLEHNEKAELKKKKE 179

Query: 165 TIKLNHKXXXXXXXX-------------XXXWSDLHKIFESLGNCYRNIDNGKTEMDKLI 211
           +IK                             S+L K+F+S   CY+NID GK EMD ++
Sbjct: 180 SIKTAQTTEAQGADHNEEDEEDEEDEEDDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSMM 239

Query: 212 VNEFNNKLKDLINTEFKNVHQLRKSVENSRLKFDTMRYELKIKEWKRTXXXMEA 265
           V EFN KL+ LIN +FK VH LRK VE SRLKFDTMRYE+K KE +      EA
Sbjct: 240 VKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRYEVKAKEAELEAKKAEA 293

 Score =  106 bits (264), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 47/63 (74%), Positives = 59/63 (93%)

Query: 315 KLLEKLEDEFVSNTQNAVEKMEELTDNSKIINLVKLYQNFQLVYYKQCIQEIESNLKILN 374
           KLLEKLEDEFVSNT  AVE MEE+TD+S+I+ L+KL+QNFQLVY++QC+QE+E+NLK+LN
Sbjct: 372 KLLEKLEDEFVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLN 431

Query: 375 GLE 377
           GLE
Sbjct: 432 GLE 434

>AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR148C
          Length = 364

 Score =  208 bits (530), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 135/388 (34%), Positives = 190/388 (48%), Gaps = 41/388 (10%)

Query: 2   FSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENY-LNDPNTKLSIKSKARFIQEKL 60
           F   S+DKL ++++N A KTQ+ L+    ++   ++N  ++DP T LS+K++ R +QE L
Sbjct: 5   FGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQLQETL 64

Query: 61  GTINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLS------ 114
           G+  D  S+LPP Y  LE K DAIE+  K++L V+KT+E EGYDYPPN TES+S      
Sbjct: 65  GSAKD-ISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWWNTS 123

Query: 115 ----XXXXXXXXXXXXXXXXXXIQSNKSFLPRSFAQAISNASFDAASNVNSVTNTIKLNH 170
                                  Q+  S  P SFA A+  A   A  +   +    +   
Sbjct: 124 TKETRFLKFGKGGTDKQKEDKQKQAAGSSDPPSFAHALHRA---AKGSQGIIQELKEQAE 180

Query: 171 KXXXXXXXXXXXWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNV 230
           +              L K+F +  +   N+D  K EMD+ +V EFN KLK L+  EFK  
Sbjct: 181 EEQEQEVEIDEDVESLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFKKG 240

Query: 231 HQLRKSVENSRLKFDTMRYELKIKEWKRTXXXMEAEDKSDVXXXXXXXXXXXXXXXXXXX 290
           H LR+ VE SRL FDT++YE   ++        EA+                        
Sbjct: 241 HTLRRKVEESRLTFDTLKYEQHERDAALAKKQDEAKQAEGATPSTGVTQSSTADLAFYAQ 300

Query: 291 XXXXXXXXXXXXXXXXXXXXXXXXKLLEKLEDEFVSNTQNAVEKMEELTDNSKIINLVKL 350
                                     LE  EDEFVSNT  AVE M  + D +K+I+LVKL
Sbjct: 301 --------------------------LEDAEDEFVSNTAEAVEFMTSIADATKLISLVKL 334

Query: 351 YQNFQLVYYKQCIQEIESNLKILNGLEE 378
           +QNFQLVY+++C+QE+E +L  L  LEE
Sbjct: 335 FQNFQLVYHRKCVQELEVSLNSLTSLEE 362

>NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {ON}
           Anc_3.491 YPR148C
          Length = 444

 Score =  209 bits (531), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 117/260 (45%), Positives = 156/260 (60%), Gaps = 20/260 (7%)

Query: 1   MFSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKL 60
           MFS FS+DK+T+S++  A KT + L+NA++           DP TKLS++S+ R  QE +
Sbjct: 1   MFSNFSLDKITNSLATAAQKTSDTLSNAITTAT--------DPATKLSLRSQKRLFQESI 52

Query: 61  GTINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSXXXXXX 120
           GT++D  S LP  YT LE +TDA+EK L+R+L V+KT+E EGYDYPPNL+ES S      
Sbjct: 53  GTVHD-ISTLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNLSESFSDWWSLS 111

Query: 121 XXXXXXXXXXXXIQSNKSFLPRSFAQAISNASFDAASNVNSVTN-------TIKLNHKXX 173
                        +  K FLPRSFAQAISN++ D       V +           N +  
Sbjct: 112 SKKKKEQEK----EDKKGFLPRSFAQAISNSAEDCVEIYQHVNDGDDEDKEENANNEEEN 167

Query: 174 XXXXXXXXXWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNVHQL 233
                      +L K F+S   CY+NID GK EMD +++ EFN KL+ L+N EFK VH L
Sbjct: 168 EEEDEEDEDVKNLIKTFDSWAKCYKNIDQGKAEMDSMMMKEFNAKLEKLLNEEFKKVHTL 227

Query: 234 RKSVENSRLKFDTMRYELKI 253
           RK V++SRLKFDT+RYELK+
Sbjct: 228 RKRVKDSRLKFDTVRYELKV 247

 Score =  100 bits (249), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 47/63 (74%), Positives = 57/63 (90%)

Query: 315 KLLEKLEDEFVSNTQNAVEKMEELTDNSKIINLVKLYQNFQLVYYKQCIQEIESNLKILN 374
           KLLE+LED FVS+T +AVE MEE+TD+S+II LVKL+QNFQLVYY+QC+QEIE+NLK LN
Sbjct: 381 KLLEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCVQEIEANLKTLN 440

Query: 375 GLE 377
            LE
Sbjct: 441 ELE 443

>KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {ON}
           Anc_3.491 YPR148C
          Length = 415

 Score =  191 bits (486), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 118/277 (42%), Positives = 156/277 (56%), Gaps = 21/277 (7%)

Query: 1   MFSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKL 60
           MFS F+ DK+T+SIS  A   Q+ + + +            D  TKL  K  ARF QEK+
Sbjct: 1   MFSNFNFDKITNSISTAAQSAQQKINDTI---------LTPDVQTKLHFKKTARFWQEKV 51

Query: 61  GTINDQP-SKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSXXXXX 119
           G I D+  SKLP  Y +LE K DA+EK LKRLL VTKTYE EGYDYPPNL+ESL+     
Sbjct: 52  GQIPDKEISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNDWWWS 111

Query: 120 XXXXXXXXXXXXXIQSNKSFLPRSFAQAISNASFDAASNVNSVTNTIK-----LNHKXXX 174
                         Q   SF+  SF  AIS A+FD+ S ++ +    +            
Sbjct: 112 DLKKSKKH------QEKSSFMNNSFPMAISKAAFDSKSILDDLKEKQQDLPKEGEEPEEE 165

Query: 175 XXXXXXXXWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNVHQLR 234
                   + +L ++F SL NCY+NID  K EMD +IV EFN KL+ LIN +FK V +LR
Sbjct: 166 VEEEDDDEFLNLLEVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLINNDFKKVSKLR 225

Query: 235 KSVENSRLKFDTMRYELKIKEWKRTXXXMEAEDKSDV 271
             V++SRL+FDT+R+E+K+KE  +     E   K+DV
Sbjct: 226 TKVQDSRLEFDTLRHEIKLKELAQESIRQENSQKTDV 262

 Score = 96.3 bits (238), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 56/63 (88%)

Query: 315 KLLEKLEDEFVSNTQNAVEKMEELTDNSKIINLVKLYQNFQLVYYKQCIQEIESNLKILN 374
           KLLEKLEDEFVSNT  AVE M ELT+ S++INLVKL+QNFQL++YKQC+QEIE+N+K L+
Sbjct: 353 KLLEKLEDEFVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQCVQEIENNMKFLD 412

Query: 375 GLE 377
            LE
Sbjct: 413 QLE 415

>TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.491
           YPR148C
          Length = 443

 Score =  188 bits (478), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 115/270 (42%), Positives = 155/270 (57%), Gaps = 25/270 (9%)

Query: 2   FSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKLG 61
           FS FS+DKL DS+ + A KTQ+ L+NA+ NVN +     NDP T+L++ SK  ++QE +G
Sbjct: 30  FSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNIDW----NDPQTRLTLLSKQHYLQESIG 85

Query: 62  TINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSX------ 115
            IN + SKLP  Y  LE KTDA+EK +KR+L VT T+E EGYDYPPNL+ES+S       
Sbjct: 86  QIN-EISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWWLNDP 144

Query: 116 -----------XXXXXXXXXXXXXXXXXIQSNKSFLPRSFAQAISNASFDAASNVNSVTN 164
                                         S  SFLPRSF  AIS AS D+++ + ++ N
Sbjct: 145 LAFLRDNDNTNDKNKSNSNPPDTKSKSDSDSESSFLPRSFPHAISKASSDSSAILTNLNN 204

Query: 165 TIKLNHKXXXXXXXXXXXWSDLH---KIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKD 221
             KL                D+    K+F+S   C +NID  K + D+LI+ +FN KL  
Sbjct: 205 NEKLEFAKTKTEDEEYEDDEDIQLLIKVFDSWSLCNKNIDKSKFQRDQLIIKQFNKKLTS 264

Query: 222 LINTEFKNVHQLRKSVENSRLKFDTMRYEL 251
           L++ EFKNV  LR  V+++RLKFDTMRYE+
Sbjct: 265 LLDVEFKNVKALRLKVQDARLKFDTMRYEI 294

 Score = 90.5 bits (223), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 40/62 (64%), Positives = 56/62 (90%)

Query: 315 KLLEKLEDEFVSNTQNAVEKMEELTDNSKIINLVKLYQNFQLVYYKQCIQEIESNLKILN 374
           KLLE LEDEFVS+T  AVE MEE+T++SKI++L+KL+QNFQL++Y+QCI+E+E+N+K+L 
Sbjct: 379 KLLEHLEDEFVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMKLLT 438

Query: 375 GL 376
            L
Sbjct: 439 DL 440

>CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148c
          Length = 385

 Score =  164 bits (416), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 99/248 (39%), Positives = 135/248 (54%), Gaps = 30/248 (12%)

Query: 23  ENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKLGTINDQPSKLPPTYTDLELKTD 82
           E++T ++S   ++L    NDP TKLSIK+K RF+QE +G   D  SKLPP Y  LE K D
Sbjct: 7   ESITQSISEGTQSLVQQFNDPKTKLSIKAKTRFLQEAIGNERD-ISKLPPQYVVLEKKCD 65

Query: 83  AIEKALKRLLTVTKTYETEGYDYPPNLTESLSXXXXXXXXXXXXXXXXXXI--------- 133
           +IEK LKR+L VTKTYE EGYDYPPN++ESLS                  I         
Sbjct: 66  SIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKNVIPKHGNVEKA 125

Query: 134 --QSNKSFL--------PRSFAQAISNASFDAASNVNSVTNTIKLNHKXXXXXXXXXXXW 183
             +++K+          P SFA AI+ A  D+     S+    +   +            
Sbjct: 126 GTEASKTLTDKEVSHEGPPSFASAIARAGKDSQLIFESIETKDEDEKEDI---------- 175

Query: 184 SDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNVHQLRKSVENSRLK 243
            +L KIF+   +C+  I + KTEMD++++ EFN KL+D +   F+ +H LR  VE SRL 
Sbjct: 176 DELVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLN 235

Query: 244 FDTMRYEL 251
           FDTMRYE+
Sbjct: 236 FDTMRYEV 243

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 52/63 (82%)

Query: 315 KLLEKLEDEFVSNTQNAVEKMEELTDNSKIINLVKLYQNFQLVYYKQCIQEIESNLKILN 374
           +LLE+LEDEFVSNT  AVE M E+++NS++++L+KL+Q FQL Y++ C++ +E +LK LN
Sbjct: 322 QLLEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVKSLEQSLKDLN 381

Query: 375 GLE 377
            ++
Sbjct: 382 AID 384

>KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa]
           {ON} Anc_3.491 YPR148C
          Length = 452

 Score =  109 bits (273), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 67/156 (42%), Positives = 88/156 (56%), Gaps = 14/156 (8%)

Query: 1   MFSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKL 60
           MFS FS+DKLT +I+N A   Q+ + N + +          D  TKL      R+ QEK+
Sbjct: 1   MFSNFSLDKLTSTITNAAQSAQDTIHNTILS---------PDAQTKLQFLKTTRYFQEKV 51

Query: 61  GTIN-DQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSXXXXX 119
           GTI+ D+ +KLP  Y  L+ K++A+EK LKRLL VTKT+E EGYDYPPN+TESL+     
Sbjct: 52  GTISEDEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWNE 111

Query: 120 XXXXXXXXXXXXXIQSNKSFLPRSFAQAISNASFDA 155
                           + S L RSFA AI  A  D+
Sbjct: 112 DENKKKKTQDF----GDSSILNRSFAIAIGKAVLDS 143

 Score = 80.5 bits (197), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 49/56 (87%)

Query: 322 DEFVSNTQNAVEKMEELTDNSKIINLVKLYQNFQLVYYKQCIQEIESNLKILNGLE 377
           DEFVSN   AVEKM ELTD+S++I+LVKL+QN QLV+Y+QC+QE+E+++K L+ LE
Sbjct: 391 DEFVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELE 446

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 43/60 (71%)

Query: 190 FESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNVHQLRKSVENSRLKFDTMRY 249
           F    NCY+NID  K EMD +IV EFN KL D++  +FK VH+L   V++SRL+FDT+R+
Sbjct: 205 FGLWSNCYKNIDQSKAEMDSMIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRH 264

>KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.221
           YIL041W
          Length = 330

 Score = 76.6 bits (187), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 58/210 (27%), Positives = 89/210 (42%), Gaps = 24/210 (11%)

Query: 50  KSKARFIQEKLGTINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNL 109
           +S  R +QEKLG + D  S+LP  Y +LE K D+I+   +  L VT  YE E YDYP  +
Sbjct: 38  QSTQRLVQEKLGQVTD-ISQLPQEYLELEKKVDSIKLIHEHFLQVTSIYENESYDYPKVI 96

Query: 110 TESLSXXXXXXXXXXXXXXXXXXIQSNKSFL--------PRSFAQAISNASFDAASNVNS 161
            +S++                      ++ L        P++   A+S  S  A+  +N 
Sbjct: 97  KDSVNDFSKTMAAKITDLSHASSASEAQNILISPGPIRDPKTLNYALSKVSLTASEVINQ 156

Query: 162 VTNTIKLNHKXXXXXXXXXXXWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKD 221
           V +T                  S L        N    I   + + D LI  +FN  L+D
Sbjct: 157 VGST---------------PNESALSSKLLEFSNVQSKIAQARLQQDTLIQTKFNKALRD 201

Query: 222 LINTEFKNVHQLRKSVENSRLKFDTMRYEL 251
            ++T     ++ RK V+N RL++D  R  L
Sbjct: 202 DLSTSLAKANKFRKEVQNKRLQYDVARTNL 231

 Score = 30.4 bits (67), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 3/56 (5%)

Query: 317 LEKLEDEFVSNTQNAVEKMEELTDNSKIINLVKLYQNFQLVYYK---QCIQEIESN 369
           +E LEDEF   T+NA   M+E+   S  +  +      QL Y++   Q +QE   N
Sbjct: 246 MESLEDEFAQATENATLVMQEVIAGSDFLTSLNQMVAAQLEYFQTSAQLLQEFTEN 301

>NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221
          Length = 364

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 97/220 (44%), Gaps = 18/220 (8%)

Query: 41  NDPNTKLSIKSKARFIQEKLGTINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYET 100
           N P+     +S  R +QE+LG + D  S+LP  Y  LE K D I+      L+VT T+E 
Sbjct: 32  NMPDINSLAQSTQRMVQERLGQVTD-ISQLPEEYLQLERKIDTIKSVYDNFLSVTNTFEH 90

Query: 101 EGYDYPPNLTESL---SXXXXXXXXXXXXXXXXXXIQ------SNKSFLPRSFAQAISNA 151
           + YDYP    ES+   S                   Q      SN+   P++   A+S A
Sbjct: 91  QSYDYPNVARESVIEFSKSAVSKVEELSHATSASEAQQILTNNSNQIKEPKTLNYALSKA 150

Query: 152 SFDAASNVNSVTNTIKLNHKXXXXXXXXXXXWSDLHKIFESLGNCYRNIDNGKTEMDKLI 211
           S  ++  +N   +T   N+            +  +  I     +    I   + + D LI
Sbjct: 151 SLISSEQLNKQFSTDDDNNS--------NSDFKLVSSILLKFSDIQAKIAQARLQQDLLI 202

Query: 212 VNEFNNKLKDLINTEFKNVHQLRKSVENSRLKFDTMRYEL 251
             +FNN L++ +NT F+   ++RK V+N RL++D  R  L
Sbjct: 203 KQKFNNNLRNDLNTSFERAQKVRKDVQNKRLQYDVARTNL 242

>TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.221
           YIL041W
          Length = 338

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 99/239 (41%), Gaps = 31/239 (12%)

Query: 24  NLTNALSNVNENLENYLNDPNTKLSI------KSKARFIQEKLGTINDQPSKLPPTYTDL 77
           N TN+L+   + L   ++    ++S       +S  R +QE+LG + D  S+LP  Y +L
Sbjct: 6   NFTNSLNQKFQELSTAVSQRTQEISTNLPSLTQSTQRLVQERLGQVTD-ISQLPREYLEL 64

Query: 78  ELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSXXXXXXXXXXXXXXXXXXIQSNK 137
           E K D I+   +  L VT  YE E YDYP  +TES++                      +
Sbjct: 65  ERKVDTIKLIYENFLHVTSIYENESYDYPKYVTESVNDFSKIVAHKVQELSHASSASEAQ 124

Query: 138 SFL--------PRSFAQAISNASFDAASNVNSVTNTIKLNHKXXXXXXXXXXXWSDLHKI 189
           + L        PR+   A+S  S  ++  +N + +                  +SDL   
Sbjct: 125 NILITPTPAKEPRTLNYALSKVSLISSEYLNHIGD------HDEAQVASVLLKYSDLQA- 177

Query: 190 FESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNVHQLRKSVENSRLKFDTMR 248
                     +   + + D +I   FN +LKD +   FK   + RK VE  RL++D  R
Sbjct: 178 ---------KVAQARLQQDTMIQTRFNKQLKDNLEHNFKKAQKARKDVEYKRLQYDVAR 227

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%)

Query: 317 LEKLEDEFVSNTQNAVEKMEELTDNSKIINLVKLYQNFQLVYYKQCIQEIE 367
           +E LED+F   T++A   M+E+  N+K    +K   N QL Y++     IE
Sbjct: 245 METLEDQFAQATEDATIIMQEVLSNAKFTEEIKEMANAQLTYHQTSASLIE 295

>Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON}
           (67833..68885) [1053 nt, 351 aa]
          Length = 350

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 84/199 (42%), Gaps = 17/199 (8%)

Query: 50  KSKARFIQEKLGTINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNL 109
           +S  R ++EKLG ++D  S LP  Y DLELK D  +   +  L +T  YE E YDYP   
Sbjct: 33  QSTHRMVKEKLGQVDDI-SPLPQEYLDLELKIDTYKSVYEHFLKITSIYERESYDYPKEF 91

Query: 110 TESLSXXXXXXXXXXXXXXXXXXIQSNKSFLPRSFAQAISNASFDAASNVNSVTNTIKLN 169
           +ES++                   + +    PR+   A+S  S  A+     + +T    
Sbjct: 92  SESVNEFTDSIGNKMYEFSNGVSTEGSSGKTPRTLNYAVSKVSMGASEQFQKLHDT---- 147

Query: 170 HKXXXXXXXXXXXWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKN 229
                           +  +  ++GN   +I   +   D  I  +FN +L++ I    + 
Sbjct: 148 ------------DDKRIANLLTNVGNAEASIAEARLLQDHSIQAKFNFQLREEIAQSIER 195

Query: 230 VHQLRKSVENSRLKFDTMR 248
             + RK V + RLK+D  R
Sbjct: 196 ASKYRKEVYHKRLKYDIAR 214

>Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ADL115W
          Length = 333

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 91/209 (43%), Gaps = 38/209 (18%)

Query: 54  RFIQEKLGTINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESL 113
           R +QEKLG I D  S++P  Y  +E + D I    +  L VT+ YE+E YDYP +++ES+
Sbjct: 61  RMVQEKLGQITD-ISQMPEEYVHMEKRVDKIRLIYENFLKVTQIYESETYDYPQHVSESV 119

Query: 114 SXXXXXXXXXXXXXXXXXXIQSNKSFL--------PRSFAQAISNASFDAASNV------ 159
           +                   +  ++ L        P++   A+S  S  ++  +      
Sbjct: 120 NEISKTVTGKIQELTKATSTEEAQNILISPGPAKDPKTLNYALSKVSLTSSEYLSKSGSD 179

Query: 160 NSVTNTIKLNHKXXXXXXXXXXXWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKL 219
           ++VT  I L              +SD+             I   + + D LI   FN +L
Sbjct: 180 SNVTADILLK-------------YSDIQA----------QIAQARLQQDMLIRTRFNKQL 216

Query: 220 KDLINTEFKNVHQLRKSVENSRLKFDTMR 248
           K+ +N EF    + RK V+N RL++D  R
Sbjct: 217 KEKLNNEFAAAARARKEVDNKRLQYDIAR 245

>ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 84/207 (40%), Gaps = 25/207 (12%)

Query: 54  RFIQEKLGTINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESL 113
           R++QEKLG   D  S++P  Y DL  K DAI+      L VT+ Y+ E YDYP  + ES+
Sbjct: 37  RYMQEKLGHATDI-SEMPQEYIDLTTKVDAIKLIYNHFLQVTQVYDNESYDYPKYINESI 95

Query: 114 SXXXXXXXXXXXXXXXXXXIQSNKSFL--------PRSFAQAISNASFDAASNVNSVTNT 165
           +                       S L        P++   A+S  S  ++  +      
Sbjct: 96  NEFSRTVGSKIQELSHASSAHEAHSILSAPGPSKDPKTLNYALSRVSLVSSECME----- 150

Query: 166 IKLNHKXXXXXXXXXXXWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINT 225
             L+             +SD+             +   +   D L+   FN KL++ I+ 
Sbjct: 151 -HLSTHDDALLASYLMKYSDIQS----------RVAQARLHQDSLVQTHFNAKLREEIDG 199

Query: 226 EFKNVHQLRKSVENSRLKFDTMRYELK 252
             K  H++R+ VEN RL +D  R  L+
Sbjct: 200 NLKRAHRVRRDVENKRLTYDASRTHLE 226

>KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 323

 Score = 70.1 bits (170), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 58/236 (24%), Positives = 100/236 (42%), Gaps = 30/236 (12%)

Query: 24  NLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKLGTINDQPSKLPPTYTDLELKTDA 83
           +L++A+S   ++L   L  P+     +S  R +QEKLG + D  S+LP  Y +LE K D 
Sbjct: 36  DLSSAVSQRTQDLTTQL--PSF---AQSTQRLVQEKLGQVTD-ISQLPQEYVELENKIDR 89

Query: 84  IEKALKRLLTVTKTYETEGYDYPPNLTESLSXXXXXXXXXXXXXXXXXXIQSNKSFL--- 140
           +    +  L VT+ YE E YDYP N+ +S++                      +S L   
Sbjct: 90  VRLVYENFLKVTQVYENESYDYPNNVRDSVNEFSSVVAGKLHDLSRATSTNEAQSVLIAP 149

Query: 141 -----PRSFAQAISNASFDAASNVNSVTNTIKLNHKXXXXXXXXXXXWSDLHKIFESLGN 195
                P++   A+S  +  ++  +N                       S++        +
Sbjct: 150 GPHKDPKTLNYALSKVALTSSEYLNKSVGG----------------DDSEVSNALLKYSD 193

Query: 196 CYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNVHQLRKSVENSRLKFDTMRYEL 251
               +   + + D LI   FN KL+D++  +     + RK+VE+ RL++D  R  L
Sbjct: 194 VQAKVAQARLQQDTLIQTRFNKKLRDILANDLNEAQKARKNVEHKRLQYDIARSNL 249

>SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {ON}
           highly similar to uniprot|Q75AN7 Ashbya gossypii ADL115W
           ADL115Wp and similar to YIL041W uniprot|P40531
           Saccharomyces cerevisiae YIL041W GVP36 Golgi-vesicle
           protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 330

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 64/256 (25%), Positives = 112/256 (43%), Gaps = 36/256 (14%)

Query: 9   KLTDSISNVALKTQ-----ENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKLGTI 63
           +L+ S+S  A + Q     ++L+ A+S   ++L   L  P+     +S  R +QE+LG +
Sbjct: 16  ELSTSVSQKAQEAQLDKKFKDLSQAVSQRTQDLTTSL--PSL---AQSTQRLVQERLGQV 70

Query: 64  NDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSXXXXXXXXX 123
            D  S+LP  Y +LE + D I    +  L VT+ YE E YDYP N+ +S++         
Sbjct: 71  TD-ISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVRDSVNEFSKTVSSK 129

Query: 124 XXXXXXXXXIQSNKSFL--------PRSFAQAISNASFDAASNVNSVTNTIKLNHKXXXX 175
                        ++ L        P++   A+S  +  ++  ++      K  H+    
Sbjct: 130 LHELSHASSTDEAQNILISPGPAKDPKTLNYALSKVALTSSEYLS------KSGHE-DET 182

Query: 176 XXXXXXXWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNVHQLRK 235
                  +SD+             I   + + D LI  +FN KL++ + ++     + RK
Sbjct: 183 IATALLKYSDVQA----------KIAQARLQQDTLIQTKFNKKLRETLASDLNKAVKARK 232

Query: 236 SVENSRLKFDTMRYEL 251
            VEN RL++D  R  L
Sbjct: 233 EVENKRLQYDIARANL 248

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 26/44 (59%)

Query: 317 LEKLEDEFVSNTQNAVEKMEELTDNSKIINLVKLYQNFQLVYYK 360
           +E LEDEF   T++A   M+++  +S+ +  +    + QL YYK
Sbjct: 263 MESLEDEFAQATEDATGVMQDVIASSEFLKDLSELVSAQLAYYK 306

>ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL041W
          Length = 333

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 90/209 (43%), Gaps = 38/209 (18%)

Query: 54  RFIQEKLGTINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESL 113
           R +QE+LG + D  S++P  Y +LE + D  +      L V++ YE+E YDYP ++++S+
Sbjct: 61  RRVQERLGQVTD-ISQMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSV 119

Query: 114 SXXXXXXXXXXXXXXXXXXIQSNKSFL--------PRSFAQAISNASFDAASNVNS---- 161
           +                   +  +S L        P++   A+S  +  ++  ++     
Sbjct: 120 NDFSKTVTGKVQELTKATTTEEAQSILISPGPARNPKTLNYALSKVALTSSEYLSKSGSD 179

Query: 162 --VTNTIKLNHKXXXXXXXXXXXWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKL 219
             VT  I L              +SD+             I   + + D LI   FN +L
Sbjct: 180 DVVTADILLK-------------YSDVQA----------KIAQARLQQDTLIQTRFNRRL 216

Query: 220 KDLINTEFKNVHQLRKSVENSRLKFDTMR 248
           ++ +NT+F    Q RK V+  RL++D  R
Sbjct: 217 REKLNTQFAEAMQSRKQVDQKRLQYDIAR 245

>Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {ON}
           YIL041W - Hypothetical ORF [contig 197] FULL
          Length = 323

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 87/210 (41%), Gaps = 25/210 (11%)

Query: 50  KSKARFIQEKLGTINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNL 109
           +S  R +QEKLG + D  S+LP  Y +LE K D ++   +  L VT+ YE E YDYP N+
Sbjct: 57  QSTQRLMQEKLGQVTD-ISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNV 115

Query: 110 TESLSXXXXXXXXXXXXXXXXXXIQSNKSFL--------PRSFAQAISNASFDAASNVNS 161
            +S++                      +S L        P++   A+S  +  ++  +N 
Sbjct: 116 RDSVNEFSSIVGTKLHELSRATSTNEAQSVLISPGPHKDPKTLNYALSKVALTSSEYLN- 174

Query: 162 VTNTIKLNHKXXXXXXXXXXXWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKD 221
                K               +SD+             I   +   D LI  +FN KL+ 
Sbjct: 175 -----KSPGAEDSEVSSSLLKYSDVQA----------KIAQARLHQDTLIQTKFNKKLRA 219

Query: 222 LINTEFKNVHQLRKSVENSRLKFDTMRYEL 251
            +  +     + RK+VEN RL++D  R  L
Sbjct: 220 ALADDLNRAQKARKNVENKRLQYDIARANL 249

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 29/48 (60%)

Query: 317 LEKLEDEFVSNTQNAVEKMEELTDNSKIINLVKLYQNFQLVYYKQCIQ 364
           +E LEDEF   T +AV  M+++ ++S+++  ++     Q  YYKQ  +
Sbjct: 264 MESLEDEFAQATDDAVVIMQKVAESSELLKDLRELVAAQAEYYKQSAE 311

>Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W
           (REAL)
          Length = 325

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 61/245 (24%), Positives = 103/245 (42%), Gaps = 35/245 (14%)

Query: 15  SNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKLGTINDQPSKLPPTY 74
           S+++ K QE L+ ++S   ++L N           +S  R +QE+LG + D  S+LP  Y
Sbjct: 8   SSLSKKLQE-LSTSVSERTQDLPNL---------AQSTQRMVQERLGQVTD-ISQLPREY 56

Query: 75  TDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSXXXXXXXXXXXXXXXXXXIQ 134
           T+LE K D I+      L VT  YE   YDYP  + ES++                    
Sbjct: 57  TELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSSSLASKLTELTHATSAS 116

Query: 135 SNKSFL--------PRSFAQAISNASFDAASNVNSVTNTIKLNHKXXXXXXXXXXXWSDL 186
             ++ L        P++   A+S  + +++  +N      K+              +SD+
Sbjct: 117 QAQNILVAPGPIKEPKTLNYALSKVALNSSECLN------KMFPTEEQPLASSLLQFSDV 170

Query: 187 HKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNVHQLRKSVENSRLKFDT 246
                        I   + + D LI  +FN KL++ ++ E     + RK V + RL++D 
Sbjct: 171 QA----------KIAQARIQQDTLIQTKFNKKLRERVSFEIGKADKCRKEVHSMRLRYDV 220

Query: 247 MRYEL 251
            R  L
Sbjct: 221 ARTNL 225

>Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W
           (REAL)
          Length = 329

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 61/245 (24%), Positives = 103/245 (42%), Gaps = 35/245 (14%)

Query: 15  SNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKLGTINDQPSKLPPTY 74
           S+++ K QE ++ ++S   + L N+          +S  R +QE+LG + D  S+LP  Y
Sbjct: 8   SSLSKKLQE-ISTSVSERTQELPNF---------AQSTQRMVQERLGQVTD-ISQLPREY 56

Query: 75  TDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSXXXXXXXXXXXXXXXXXXIQ 134
           T+LE K D I+      L VT  YE   YDYP  + ES++                    
Sbjct: 57  TELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSRSVASKLTELTHATSAS 116

Query: 135 SNKSFL--------PRSFAQAISNASFDAASNVNSVTNTIKLNHKXXXXXXXXXXXWSDL 186
             ++ L        P++   A+S  S +++  +N      K+              +SD+
Sbjct: 117 EAQNILVAPGPIKEPKTLNYALSKVSLNSSECLN------KMFPAEEQPLASALLQFSDV 170

Query: 187 HKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNVHQLRKSVENSRLKFDT 246
                        I   + + D LI  +FN KL++ ++ E     + RK V + RL++D 
Sbjct: 171 QA----------KIAQTRIQQDTLIQTKFNKKLRERLSFEIGKADKCRKDVHSMRLRYDV 220

Query: 247 MRYEL 251
            R  L
Sbjct: 221 ARTNL 225

>Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON}
           (45405..46340) [936 nt, 312 aa]
          Length = 311

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 77/367 (20%), Positives = 140/367 (38%), Gaps = 84/367 (22%)

Query: 24  NLTNALSNVNENLENYLNDPNTKLSI------KSKARFIQEKLGTINDQPSKLPPTYTDL 77
           + TN+LS   + L   +++   + S       +S  R +QEKLG + D  S+LP  Y +L
Sbjct: 5   SFTNSLSQKFQELSTAVSEKTQEFSTSIPTLAESTQRLVQEKLGNVTD-ISQLPQEYIEL 63

Query: 78  ELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSXXXXXXXXXXXXXXXXXXIQSNK 137
           E + D I+   +  L +T  YE E YDYP  +++S++                   Q  +
Sbjct: 64  ERQVDTIKLVYEHFLQITAIYENESYDYPKYVSDSVNDFSKVFANKVTELSHATSAQEAQ 123

Query: 138 SFL--------PRSFAQAISNASFDAASNVNSVTNTIKLNHKXXXXXXXXXXXWSDLHKI 189
           + L        PR+   A+S  +      +NS  +  +L              +SD+   
Sbjct: 124 NILVTPGPAKEPRTLNYALSKVA------LNSSESLAQLADPNEGPVADALLKFSDVQA- 176

Query: 190 FESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNVHQLRKSVENSRLKFDTMRY 249
                     I   +   D LI  +FN +L++ +  +     + RK V+  RL++D  R 
Sbjct: 177 ---------KIAQTRLHQDTLIQTKFNKQLREKLELDIGKASKARKDVQYKRLQYDVARS 227

Query: 250 EL-KIKEWKRTXXXMEAEDKSDVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 308
           +L + K  K     +E E                                          
Sbjct: 228 KLTQAKPEKEASLRVEMES----------------------------------------- 246

Query: 309 XXXXXXKLLEKLEDEFVSNTQNAVEKMEELTDNSKIINLVKLYQNFQLVYYKQCIQEIES 368
                      LE++F  +T++A   M+E+  +SK ++ +K     QL Y++   Q ++ 
Sbjct: 247 -----------LEEQFAQSTEDATIIMQEVIADSKFLSSLKELAEAQLSYFETSAQLLKE 295

Query: 369 NLKILNG 375
            + +L+ 
Sbjct: 296 FMPVLDS 302

>Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W
           (REAL)
          Length = 326

 Score = 64.3 bits (155), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 84/210 (40%), Gaps = 25/210 (11%)

Query: 50  KSKARFIQEKLGTINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNL 109
           +S  R +QE+LG + D  S+LP  YT+LE K D I+      L VT  YE   YDYP  +
Sbjct: 33  QSTQRMVQERLGQVTD-ISQLPREYTELEEKVDTIKLIYNHFLGVTAIYENGSYDYPKYI 91

Query: 110 TESLSXXXXXXXXXXXXXXXXXXIQSNKSFL--------PRSFAQAISNASFDAASNVNS 161
            ES++                      ++ L        P++   A+S  + +++  +N 
Sbjct: 92  NESVNEFSRSVASKLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVALNSSECLNK 151

Query: 162 VTNTIKLNHKXXXXXXXXXXXWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKD 221
           +  T                    L        +    I   + + D LI  +FN  L++
Sbjct: 152 MLPT----------------EEQPLASALLQFSDVQAKIAQARIQQDTLIQTKFNKNLRE 195

Query: 222 LINTEFKNVHQLRKSVENSRLKFDTMRYEL 251
            ++ E     + RK V + RL++D  R  L
Sbjct: 196 RLSFEIGKADKTRKDVHSMRLRYDVARTNL 225

>YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR
           domain-containing protein that localizes to both early
           and late Golgi vesicles; required for adaptation to
           varying nutrient concentrations, fluid-phase
           endocytosis, polarization of the actin cytoskeleton, and
           vacuole biogenesis
          Length = 326

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 86/210 (40%), Gaps = 25/210 (11%)

Query: 50  KSKARFIQEKLGTINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNL 109
           +S  R +QE+LG + D  S+LP  YT+LE K D I+      L VT  YE   YDYP  +
Sbjct: 33  QSTQRMVQERLGQVTD-ISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYI 91

Query: 110 TESLSXXXXXXXXXXXXXXXXXXIQSNKSFL--------PRSFAQAISNASFDAASNVNS 161
            ES++                      ++ L        P++   A+S  + +++  +N 
Sbjct: 92  NESVNEFSRSVASKLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVALNSSECLN- 150

Query: 162 VTNTIKLNHKXXXXXXXXXXXWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKD 221
                K+              +SD+             I   + + D LI  +FN  L++
Sbjct: 151 -----KMFPTEEQPLASALLQFSDVQA----------KIAQARIQQDTLIQTKFNKNLRE 195

Query: 222 LINTEFKNVHQLRKSVENSRLKFDTMRYEL 251
            ++ E     + RK V + RL++D  R  L
Sbjct: 196 RLSFEIGKADKCRKDVHSMRLRYDVARTNL 225

>CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} similar
           to uniprot|P40531 Saccharomyces cerevisiae YIL041w
          Length = 341

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 84/203 (41%), Gaps = 8/203 (3%)

Query: 50  KSKARFIQEKLGTINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNL 109
           +S  R +QEKLG + D  S+LP  Y +LE K D I+   +  L VT  YE E YDYP  +
Sbjct: 38  QSTQRMVQEKLGQVTD-ISQLPQEYLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYV 96

Query: 110 TESLSXXXXXXXXXXXXXXXXXXIQSNKSFLPRSFAQAISNASFDAASNVNSVTNTIKLN 169
           +ES++                      ++ L       ++         +N   + + LN
Sbjct: 97  SESVNEFSKNMAAKVQELSKATSATEAQNIL-------VAPGPVKEPKTLNYAMSKVALN 149

Query: 170 HKXXXXXXXXXXXWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKN 229
                         + L K+  +  +    +   + + D  I  +FN  +++ +      
Sbjct: 150 ASEYLNHSFDDPMDAKLSKVLLNYSDVQTKVAQARLQQDTQIQTKFNKVIRENLAESIAR 209

Query: 230 VHQLRKSVENSRLKFDTMRYELK 252
            ++ RK V++ RL++D  R  L+
Sbjct: 210 ANKARKDVQSKRLQYDVARTNLQ 232

>NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {ON}
           Anc_7.221
          Length = 329

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 96/240 (40%), Gaps = 12/240 (5%)

Query: 12  DSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKLGTINDQPSKLP 71
           +S +N   KT   L++ +S   + L   L  PN     +S  R +QE+LG + D  S+LP
Sbjct: 5   NSFTNSFSKTLSELSSTVSQKTQELSTNL--PNLA---QSTQRMVQERLGQVTD-ISQLP 58

Query: 72  PTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSXXXXXXXXXXXXXXXXX 131
             Y +LE+K D+I++     L V+  YE + YDYP    ESL                  
Sbjct: 59  EEYLELEMKLDSIKQIYDNFLAVSSVYEQQSYDYPYVAKESLIEFSKTAASKVEELSHAS 118

Query: 132 XIQSNKSFLPRSFAQAISNASFDAASNVNSVTNTIKLNHKXXXXXXXXXXXWSDLHKIFE 191
                ++ L  S  Q            +N   + + L              +        
Sbjct: 119 SAHEAQNILTTSSTQ------IKEPKTLNFALSKVALKSSEHLNQFNDNEAFKSSASALL 172

Query: 192 SLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNVHQLRKSVENSRLKFDTMRYEL 251
           +  N    I   + + D LI  +FN+ L+  + T      ++RK V++ RL++D  R  L
Sbjct: 173 NFSNIQAKIAQARLQQDLLIKQKFNDALRHDLATNIAKATKVRKEVQSKRLQYDIARTNL 232

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 27/44 (61%)

Query: 317 LEKLEDEFVSNTQNAVEKMEELTDNSKIINLVKLYQNFQLVYYK 360
           +E LED+F   T++A   M+++ DNS I++ V      QL Y++
Sbjct: 247 METLEDDFAQATEHATIVMQDVIDNSDIVSRVNELARAQLAYFE 290

>KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 302

 Score = 61.6 bits (148), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 64/266 (24%), Positives = 105/266 (39%), Gaps = 62/266 (23%)

Query: 2   FSGFS--IDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSI--KSKARFIQ 57
           F  FS  + +L+ S+S  A + Q             L+    D  T L +   S  R +Q
Sbjct: 5   FDSFSKKVQELSTSVSQKAQEAQ-------------LDQKFKDLKTNLPLLANSTQRMLQ 51

Query: 58  EKLGTINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSXXX 117
           EKLG + D  S+LP  Y  LE + + I+   +  L VTK YE E YDYP N+ ES+    
Sbjct: 52  EKLGQVTD-ISQLPDEYVQLEHRVETIKLIYENFLKVTKIYENESYDYPSNVKESVDEFS 110

Query: 118 XXXXXXXXXXXXXXXIQSNKSFL--------PRSFAQAISNASFDAASNVNSVTNTIKLN 169
                           +  ++ L        P++   A+S  +  ++ +V          
Sbjct: 111 KLVGGKLHDLSKVTNREQAQNVLLSSPQMKEPKTLNYALSKVALTSSEHVED-------- 162

Query: 170 HKXXXXXXXXXXXWSDLHKIFESLGNCYRNIDNGKTEM-------DKLIVNEFNNKLKDL 222
                                ESL N      + +T++       D +I  +FN  +K+ 
Sbjct: 163 ---------------------ESLANFLAKYSDSQTKIAQLRLQQDTMIQTKFNKAIKEK 201

Query: 223 INTEFKNVHQLRKSVENSRLKFDTMR 248
           +  + +   + RK VE  RL++D +R
Sbjct: 202 LEQDIETSTKARKLVEQKRLQYDVVR 227

>TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.221
           YIL041W
          Length = 363

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 80/195 (41%), Gaps = 19/195 (9%)

Query: 54  RFIQEKLGTINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESL 113
           R ++EKLG   D  S LP  Y +LE K D +++  +  L VT  YE E YDYP    ES 
Sbjct: 37  RLMKEKLGQAKD-ISTLPQEYVELETKIDTMKEIYEHFLKVTMVYEKESYDYPKEFGESF 95

Query: 114 SXXXXXXXXXXXXXXXXXXIQSNKSFLPRSFAQAISNASFDAASNVNSVTNTIKLNHKXX 173
                                +NK  +P++   A+ N    A   V       KL H+  
Sbjct: 96  WEFTDSVGEKFSALNISE--HNNKVKIPKTLNYALHNVFLTANEKV-------KLLHEPL 146

Query: 174 XXXXXXXXXWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNVHQL 233
                     + L +   SL     +I   +   D L+ +  N +LK+ ++  F+   + 
Sbjct: 147 D---------NSLSETLASLSETEADIAEARLHQDSLVKSRINYQLKEELSQNFERAAKY 197

Query: 234 RKSVENSRLKFDTMR 248
           RK+V + R  +D  +
Sbjct: 198 RKAVHHKRFNYDVAK 212

>TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.221
           YIL041W
          Length = 386

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 54/220 (24%), Positives = 87/220 (39%), Gaps = 46/220 (20%)

Query: 56  IQEKLGTINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSX 115
           +QEK G + D  S LP  Y DLE + D+I+      L +T  YE E YDYP ++ +S++ 
Sbjct: 1   MQEKFGQVTDI-SPLPQEYLDLEQQVDSIKLVYDHFLRITTVYENESYDYPKDVRDSITE 59

Query: 116 XXXXXXXXXXXXXX------------------XXXIQSNKSF------LPRSFAQAISNA 151
                                              + S  S        PR+   A+S A
Sbjct: 60  FQKTASSRVQELQTKISNSSDNSHSSGSVEPMRTSVSSVGSINNYNQNSPRTLNNALSKA 119

Query: 152 SFDAASNVNSVTNTIKLNHKXXXXXXXXXXXWSDLHKIFESLGNCYRNIDNGKTEMDKLI 211
           +  AA         +K++               D   +F S       I + + + DK+I
Sbjct: 120 ALFAAEQ-------LKMD--------------KDSSTVFHSFSEAESIISDERIKQDKII 158

Query: 212 VNEFNNKLKDLINTEFKNVHQLRKSVENSRLKFDTMRYEL 251
              FN +LK+++       ++ RK V+N RL++D  R +L
Sbjct: 159 QKSFNTELKNVLTNRIDVANKHRKDVQNKRLQYDISRTKL 198

>TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7.221
           YIL041W
          Length = 331

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 86/208 (41%), Gaps = 25/208 (12%)

Query: 54  RFIQEKLGTINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESL 113
           R  QEKLG I D  S++P  Y DLE + D ++ +++ LL VT+ YE   YD+P +  ES+
Sbjct: 41  RLAQEKLGQITD-ISQMPREYIDLEDRIDNLQNSIQVLLHVTRVYEEPAYDWPYSTQESV 99

Query: 114 SXXXXXXXXXXXXXXXXXXIQSNKSFL---------PRSFAQAISNASFDAASNVNSVTN 164
                                   + L         PR+   A+S AS  A S + S +N
Sbjct: 100 QDWSRAIGSRVQELSRASSASEAGNLLKSPVGPENGPRTLNYALSQASL-AVSTLTS-SN 157

Query: 165 TIKLNHKXXXXXXXXXXXWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLIN 224
               N +              L     +  +    +   +   D  +  +FN +L++++N
Sbjct: 158 MPGPNGE-------------GLSSGLIAYSDTQAKLAQIRIAQDTQVQTKFNKQLREILN 204

Query: 225 TEFKNVHQLRKSVENSRLKFDTMRYELK 252
                 ++ RK V+  R+ +D  R  L+
Sbjct: 205 NPIAKANKYRKDVQYKRVLYDIARTNLQ 232

>KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.221
           YIL041W
          Length = 342

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/203 (22%), Positives = 78/203 (38%), Gaps = 22/203 (10%)

Query: 54  RFIQEKLGTINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESL 113
           R +QEKLG + D  S+LP  Y +LE + DA++   +  L VT  YE E YDYP  + +S+
Sbjct: 42  RLVQEKLGQVTD-ISQLPQEYLELEKRVDALKLVHEHFLQVTAIYENESYDYPKYVRDSV 100

Query: 114 SXXXXXXXXXXXXXXXXXXIQSNKSFL--------PRSFAQAISNASFDAASNVNSVTNT 165
           +                      +  +        P++   A+S  + + +  V+++   
Sbjct: 101 NEWSRTVATRVSELRHVSSAAEAQHVIAAPTQETEPKTLHYALSKVALNGSQLVDNL--- 157

Query: 166 IKLNHKXXXXXXXXXXXWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINT 225
                             + L             +   + E D  +  +FN KL+  ++ 
Sbjct: 158 ----------DAPRTPRETQLSSGLLEFSGVEAELAQARLEQDAAVKAQFNEKLRGQLSG 207

Query: 226 EFKNVHQLRKSVENSRLKFDTMR 248
           E       RK V   RL++D  R
Sbjct: 208 EIARAAAARKEVFQKRLQYDVAR 230

>TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.221
           YIL041W
          Length = 305

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 89/209 (42%), Gaps = 25/209 (11%)

Query: 51  SKARFIQEKLGTINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLT 110
           S  R +QEKLG + D  S+LP  Y +LE + D I+   +  L +T  Y+ E YDYP  ++
Sbjct: 38  STQRLVQEKLGNVTD-ISQLPQEYLELEKEIDTIKLVYEHFLKITSIYDNESYDYPKYVS 96

Query: 111 ESLSXXXXXXXXXXXXXXXXXXIQSNKSFL--------PRSFAQAISNASFDAASNVNSV 162
           +S++                   +  ++ L        PR+   A+S  +  ++ ++N  
Sbjct: 97  DSVNDYSKLFQSKIEDLSRATSAEEAQNILVTPGPITEPRTLNYALSKVALTSSESLN-- 154

Query: 163 TNTIKLNHKXXXXXXXXXXXWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDL 222
               +L              +SD+             I   + + D LI  + N  +K+ 
Sbjct: 155 ----QLQDPNVSAVASTLLKFSDMQT----------KIAQQRLQQDTLIQTKVNKVIKEK 200

Query: 223 INTEFKNVHQLRKSVENSRLKFDTMRYEL 251
           +++  +   + R+ V+  RL++D  R +L
Sbjct: 201 LSSLIEKATKSRRDVQYKRLQYDVARSKL 229

>KAFR0B04110 Chr2 (850702..852126) [1425 bp, 474 aa] {ON} Anc_5.119
           YGR212W
          Length = 474

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 37/59 (62%), Gaps = 6/59 (10%)

Query: 13  SISNVALKTQENLTN-ALSNVNENLENYLNDPNTKLSIKSKARFIQEKLGTINDQPSKL 70
           +I NVA K QE +TN  L+N+ + + N +N     L++ ++ RF++E L +IN+ P  +
Sbjct: 344 TILNVASKVQEFITNETLNNIGDKI-NAMN----LLNVVNQRRFLEETLNSINEGPGSV 397

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.128    0.346 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,028,066
Number of extensions: 1402083
Number of successful extensions: 7189
Number of sequences better than 10.0: 108
Number of HSP's gapped: 7350
Number of HSP's successfully gapped: 165
Length of query: 378
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 267
Effective length of database: 40,753,473
Effective search space: 10881177291
Effective search space used: 10881177291
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 66 (30.0 bits)