Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1017.63.493ON1871878101e-111
TPHA0D032803.493ON1841875394e-70
TDEL0D056103.493ON1751874518e-57
ZYRO0D09966g3.493ON1781784362e-54
YPR149W (NCE102)3.493ON1731874195e-52
Smik_16.4023.493ON1731874143e-51
CAGL0L08448g3.493ON1731874082e-50
Skud_16.4443.493ON1731874032e-49
CAGL0I10494g3.493ON1721883989e-49
KNAG0B008003.493ON1821873971e-48
TBLA0C044903.493ON1861513981e-48
KNAG0A079503.493ON1821893953e-48
NDAI0G009303.493ON1761753901e-47
TBLA0D029603.493ON1891543824e-46
NDAI0B058803.493ON1821873711e-44
KAFR0C019703.493ON1791913692e-44
YGR131W (FHN1)3.493ON1741873666e-44
SAKL0F02750g3.493ON1701753649e-44
Suva_16.4783.493ON1661873631e-43
KAFR0G037003.493ON1861903623e-43
NCAS0E008003.493ON1741873562e-42
Skud_7.4423.493ON1741873466e-41
Suva_7.4193.493ON1741873441e-40
NCAS0F035603.493ON1831663406e-40
KLLA0D16280g3.493ON1691873335e-39
Smik_6.2273.493ON1741873302e-38
Kwal_55.212383.493ON1701873171e-36
KLTH0F14850g3.493ON1711763152e-36
AFR312W3.493ON1681462995e-34
Ecym_12363.493ON1691872458e-26
Suva_13.1862.565ON89427691.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1017.6
         (187 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   316   e-111
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   212   4e-70
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   178   8e-57
ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   172   2e-54
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   166   5e-52
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   164   3e-51
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   161   2e-50
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   159   2e-49
CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   157   9e-49
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   157   1e-48
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....   157   1e-48
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   156   3e-48
NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   154   1e-47
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...   151   4e-46
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   147   1e-44
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   146   2e-44
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   145   6e-44
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   144   9e-44
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   144   1e-43
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...   144   3e-43
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   141   2e-42
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   137   6e-41
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...   137   1e-40
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...   135   6e-40
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   132   5e-39
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...   131   2e-38
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   126   1e-36
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   125   2e-36
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...   119   5e-34
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...    99   8e-26
Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019...    31   1.8  

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  316 bits (810), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 158/187 (84%)

Query: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60
           MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60

Query: 61  IWTTPFAWPIIXXXXXXXXXXXXXXXGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120
           IWTTPFAWPII               GTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK
Sbjct: 61  IWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120

Query: 121 AQXXXXXXXXXXXXXXVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180
           AQ              VKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG
Sbjct: 121 AQASIAFFYFSFFIFFVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180

Query: 181 VPNISQV 187
           VPNISQV
Sbjct: 181 VPNISQV 187

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  212 bits (539), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 131/187 (70%), Gaps = 3/187 (1%)

Query: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60
           ML LADNI+R +NFCFFVIC+GL+GSLLAT+  HSSRVNYC+FVPPFA+VTD+FYG LAN
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60

Query: 61  IWTTPFAWPIIXXXXXXXXXXXXXXXGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120
           IW+TP AWPII               GTVL+VG RTHSC N++Y+D+N I QGSTDRCRK
Sbjct: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120

Query: 121 AQXXXXXXXXXXXXXXVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180
           AQ               K++MS+INL +NGA+G  +    R         VPGA+SPQ+G
Sbjct: 121 AQAATAFFYFSFFIFLAKLIMSSINLFTNGALGSMSFGRRRGGAGVG---VPGAASPQIG 177

Query: 181 VPNISQV 187
           VPNISQV
Sbjct: 178 VPNISQV 184

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  178 bits (451), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 89/187 (47%), Positives = 111/187 (59%), Gaps = 12/187 (6%)

Query: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60
           ML++ DN +R +NF F VI +GL+G L+++E GHSSRVN+CMF   F +VTDSFYGILAN
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSEDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60

Query: 61  IWTTPFAWPIIXXXXXXXXXXXXXXXGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120
           IW   FAWP+I                T L+VGIRTHSCKN++Y+D+N I QGST RCR 
Sbjct: 61  IWEV-FAWPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSNNITQGSTQRCRL 119

Query: 121 AQXXXXXXXXXXXXXXVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180
           AQ               K++MS I +++NG     T    RRR            S QVG
Sbjct: 120 AQASVAFFYFSFFIFLAKMIMSLIGIITNGPFSSRTTLTSRRRK-----------SAQVG 168

Query: 181 VPNISQV 187
           VP ISQV
Sbjct: 169 VPTISQV 175

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  172 bits (436), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 94/178 (52%), Positives = 117/178 (65%), Gaps = 3/178 (1%)

Query: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEK-GHSSRVNYCMFVPPFAVVTDSFYGILA 59
           ML+L DNI+RA+NFCFFVI +GL+G L+ +EK GH+SRVN+CMF   F +V DSFYGILA
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60

Query: 60  NIWTTPFAWPIIXXXXXXXXXXXXXXXGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCR 119
           NI+  PFA+P+I                T L+VGIRTHSC NR+Y+D+NKI QGST RCR
Sbjct: 61  NIFV-PFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCR 119

Query: 120 KAQXXXXXXXXXXXXXXVKVVMSAINLLSNGAMGFSTPSIGRRRH-HTANIGVPGASS 176
           +AQ               K+VMS ++LLSNGA G S+    RRR    AN+GVP  S 
Sbjct: 120 EAQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQ 177

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  166 bits (419), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 109/187 (58%), Gaps = 14/187 (7%)

Query: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60
           ML+LADNI+R INF F VI +GLI SLL T+  HSSRVNYCMF   + + TDS YG+ AN
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  IWTTPFAWPIIXXXXXXXXXXXXXXXGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120
            +  P AWP++               GTVL+VGIR HSC N +Y+D+NKI QGS  RCR+
Sbjct: 61  -FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQ 119

Query: 121 AQXXXXXXXXXXXXXXVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180
           AQ               K +MS  N++SNGA G  + S  +RR            + QVG
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFG--SGSFSKRRR-----------TGQVG 166

Query: 181 VPNISQV 187
           VP ISQV
Sbjct: 167 VPTISQV 173

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  164 bits (414), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 87/187 (46%), Positives = 108/187 (57%), Gaps = 14/187 (7%)

Query: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60
           ML+LADNI+R INF F VI + LI SLL T+  HSSRVNYCMF   + + TDS YG+ AN
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQDKHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  IWTTPFAWPIIXXXXXXXXXXXXXXXGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120
            +  P AWP++               GTVL+VGIR HSC N +Y+D+NKI QGS  RCR+
Sbjct: 61  -FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQ 119

Query: 121 AQXXXXXXXXXXXXXXVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180
           AQ               K +MS  N++SNGA G  + S  +RR            + QVG
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLMSIFNMISNGAFG--SGSFSKRRR-----------TGQVG 166

Query: 181 VPNISQV 187
           VP ISQV
Sbjct: 167 VPTISQV 173

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  161 bits (408), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 109/187 (58%), Gaps = 14/187 (7%)

Query: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60
           ML++ DN++R +NF F VIC+GLI  L+AT   HSSRVNYCMF   + + TDS YG+ AN
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60

Query: 61  IWTTPFAWPIIXXXXXXXXXXXXXXXGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120
            +    AWP+I               G VL+VGIR HSC N +Y +NNKIIQGS  RCR+
Sbjct: 61  FFEI-LAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRE 119

Query: 121 AQXXXXXXXXXXXXXXVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180
           +Q               K++MS +N+ SNGA G  T  I RRR++            +VG
Sbjct: 120 SQAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFG--TKFIRRRRNN-----------AEVG 166

Query: 181 VPNISQV 187
           VP++SQV
Sbjct: 167 VPSVSQV 173

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  159 bits (403), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 108/187 (57%), Gaps = 14/187 (7%)

Query: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60
           ML+ ADNI+R INF F VI +GLI SLL T+  +SSRVN+CMF   + + TDS YG+ AN
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQDRNSSRVNFCMFAAAYGIFTDSLYGVFAN 60

Query: 61  IWTTPFAWPIIXXXXXXXXXXXXXXXGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120
            +  P AWP++               GTVL+VGIR HSC NR+Y+D+N I QGS  RCR+
Sbjct: 61  FFE-PLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQ 119

Query: 121 AQXXXXXXXXXXXXXXVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180
           AQ               K +MS  N++SNGA G  + S  +RR            + QVG
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFG--SGSFSKRRR-----------TGQVG 166

Query: 181 VPNISQV 187
           VP ISQV
Sbjct: 167 VPTISQV 173

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  157 bits (398), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 110/188 (58%), Gaps = 17/188 (9%)

Query: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60
           MLS+ADN++R +N  F +IC+GL  SL+ T K HSSRVN+C+F   + + TDS YGI AN
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60

Query: 61  IWTTPFAWPIIXXXXXXXXXXXXXXXGTVLSVGIRTHSCKNRNYID-NNKIIQGSTDRCR 119
            +  P AWP++               GTVL+VGIR HSC N+ Y++   KI+QGS  RCR
Sbjct: 61  FF-EPLAWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCR 119

Query: 120 KAQXXXXXXXXXXXXXXVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQV 179
           +AQ               K++MS ++++SNGA G       RR+HHT           +V
Sbjct: 120 QAQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKL----RRKHHT-----------EV 164

Query: 180 GVPNISQV 187
           GVP+ISQV
Sbjct: 165 GVPSISQV 172

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  157 bits (397), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 89/187 (47%), Positives = 110/187 (58%), Gaps = 5/187 (2%)

Query: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60
           ML +ADN++R +NFCF VIC+  I +L+ T+K H SRVNYCMF   + + TD  YG+LAN
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60

Query: 61  IWTTPFAWPIIXXXXXXXXXXXXXXXGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120
            W  P AWP+I               G VL+VGIR HSCKN  Y + N IIQGS +RCR 
Sbjct: 61  FW-EPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRI 119

Query: 121 AQXXXXXXXXXXXXXXVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180
           +Q               K+VMS INL SNGA   ++   GRRR H   +GVP  S    G
Sbjct: 120 SQAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFGRRRRHGGGVGVPETS----G 175

Query: 181 VPNISQV 187
           VP+ISQV
Sbjct: 176 VPSISQV 182

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  157 bits (398), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 78/151 (51%), Positives = 96/151 (63%), Gaps = 1/151 (0%)

Query: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKG-HSSRVNYCMFVPPFAVVTDSFYGILA 59
           MLS   N++R INFCF VI  G+IG L+ +EK  HS RVNYCMF  PFA+VTDSFY I A
Sbjct: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60

Query: 60  NIWTTPFAWPIIXXXXXXXXXXXXXXXGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCR 119
           N W +PFAWPI+               GTVLSVGIRTHSC N++Y+ +NKI QGST+RCR
Sbjct: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120

Query: 120 KAQXXXXXXXXXXXXXXVKVVMSAINLLSNG 150
            AQ              V++V S++ +  NG
Sbjct: 121 LAQASIAFYYFSFFIYLVQLVKSSLLMWENG 151

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  156 bits (395), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 85/189 (44%), Positives = 108/189 (57%), Gaps = 9/189 (4%)

Query: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60
           ML+LAD  +R +NF F VICMGLI +LL T+ GHSSR+NYCMF   + + TDSFYG++AN
Sbjct: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60

Query: 61  IWTTPFAWPIIXXXXXXXXXXXXXXXGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120
            W  P +WP++               G VL+VGIR HSCKN  Y + NKI+QGS +RCR+
Sbjct: 61  FW-EPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQ 119

Query: 121 AQXXXXXXXXXXXXXXVKVVMSAINLLSNGAMGF--STPSIGRRRHHTANIGVPGASSPQ 178
           AQ               K +MS +N+ +NG  G   S+P   R        GVP      
Sbjct: 120 AQAAVAFFFFSMAIFLAKFIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQ----- 174

Query: 179 VGVPNISQV 187
            GVPNIS V
Sbjct: 175 -GVPNISTV 182

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  154 bits (390), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 109/175 (62%), Gaps = 1/175 (0%)

Query: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60
           MLS+ADN++R +N  F VIC+GL  +LL T++GH+SR+NYCMF   + ++TDSF+GILAN
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60

Query: 61  IWTTPFAWPIIXXXXXXXXXXXXXXXGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120
            +    ++P I               GTVL+ GIR+HSC N++Y+D NKI QGS +RCR+
Sbjct: 61  FF-EFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRE 119

Query: 121 AQXXXXXXXXXXXXXXVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGAS 175
           +Q              +K+ MS I+++ NGA   +  S  RRR+  A +GVP  S
Sbjct: 120 SQALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSIS 174

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score =  151 bits (382), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 94/154 (61%), Gaps = 1/154 (0%)

Query: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGH-SSRVNYCMFVPPFAVVTDSFYGILA 59
           ML L DN+ R  NFCFFVI  G+IG+LL TE GH SSRVNYCMF P + +V+DSFYGILA
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 60  NIWTTPFAWPIIXXXXXXXXXXXXXXXGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCR 119
           N+   PFA+P I               GTVL+VGIRTHSC N+ Y   N IIQGS  RCR
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120

Query: 120 KAQXXXXXXXXXXXXXXVKVVMSAINLLSNGAMG 153
           +AQ              VKV+++ +   + G +G
Sbjct: 121 EAQACIAFFYFSMFLFLVKVLITLVTYFTGGELG 154

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  147 bits (371), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 76/187 (40%), Positives = 105/187 (56%), Gaps = 5/187 (2%)

Query: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60
           MLS  DNI+R IN  F V+ M  I +LL T++ +SSR+N+CMF   F ++TDSF+G+  N
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60

Query: 61  IWTTPFAWPIIXXXXXXXXXXXXXXXGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120
           ++    +WPI+               GTVL+V IR HSCKN  Y+++N I QGS +RCR 
Sbjct: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120

Query: 121 AQXXXXXXXXXXXXXXVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180
           +Q               K++MS IN+ SNG  G  T +  R +  T   G     + +VG
Sbjct: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSG-----ANEVG 175

Query: 181 VPNISQV 187
           VP ISQV
Sbjct: 176 VPTISQV 182

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  146 bits (369), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 82/191 (42%), Positives = 108/191 (56%), Gaps = 16/191 (8%)

Query: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGH-SSRVNYCMFVPPFAVVTDSFYGILA 59
           ML +ADNI+R IN  F +I + L  +L+ T+ GH +SRVNYCMF   F +  DS YGI A
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 60  NIWTTPFAWPIIXXXXXXXXXXXXXXXGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCR 119
           N +    AWP++                T L+VGIR HSC N++Y+D+NKI++GS  RCR
Sbjct: 61  NFFQV-LAWPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSNKIVRGSGQRCR 119

Query: 120 KAQXXXXXXXXXXXXXXVKVVMSAINLLSNGAMGFSTPS---IGRRRHHTANIGVPGASS 176
           +AQ               K++MS INL  NGA  FS+ S   I RR+ H  ++G      
Sbjct: 120 EAQALVAFLYFSTAIFIAKMIMSCINLFQNGA--FSSGSSRFISRRKKHATDVG------ 171

Query: 177 PQVGVPNISQV 187
              GVPNISQV
Sbjct: 172 ---GVPNISQV 179

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  145 bits (366), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 76/187 (40%), Positives = 103/187 (55%), Gaps = 13/187 (6%)

Query: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60
           MLS ADN++R IN  F +I +GLI  L+ T+  HSSRVN+CMF   + +VTDS YG LAN
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60

Query: 61  IWTTPFAWPIIXXXXXXXXXXXXXXXGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120
            WT+   +P I                T L+VGIR HSCKN+ Y++ NKIIQGS+ RC +
Sbjct: 61  FWTS-LTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQ 119

Query: 121 AQXXXXXXXXXXXXXXVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180
           +Q              +KV ++ + ++ NG  G S     RRR           +  Q+G
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVATMGMMQNGGFG-SNTGFSRRR-----------ARRQMG 167

Query: 181 VPNISQV 187
           +P ISQV
Sbjct: 168 IPTISQV 174

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  144 bits (364), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 105/175 (60%), Gaps = 7/175 (4%)

Query: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60
           MLS+ DN +R +NF F VI +GL GSL+AT+  HS RVN+ +F   FA+VTDSFY + AN
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60

Query: 61  IWTTPFAWPIIXXXXXXXXXXXXXXXGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120
           ++ + FAWPI+                T L+VGIRTHSC N +Y+ +N I QGSTDRCRK
Sbjct: 61  LF-SAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRK 119

Query: 121 AQXXXXXXXXXXXXXXVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGAS 175
           AQ               K+V+S IN+ S+GA    + S  RR    AN+GVP  S
Sbjct: 120 AQATVAFLYFSFFIFLTKLVLSVINVFSSGAF--GSGSGSRR----ANVGVPTIS 168

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  144 bits (363), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 80/187 (42%), Positives = 103/187 (55%), Gaps = 21/187 (11%)

Query: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60
           ML+  DNI+R INF F VI +GLI SLL T+ G+SSR+NYCMF   +A+VTDS YG+ AN
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60

Query: 61  IWTTPFAWPIIXXXXXXXXXXXXXXXGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120
            +  P AWP+I                      IR HSC+N+ Y+ +N I QGS +RCR+
Sbjct: 61  FFE-PLAWPLILFSLDFLNFVFTF-------TAIRAHSCRNQTYLASNSITQGSGNRCRE 112

Query: 121 AQXXXXXXXXXXXXXXVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180
           AQ               K +MS  N++SNGA G  + S  +RR            + QVG
Sbjct: 113 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFG--SGSFSKRRR-----------TGQVG 159

Query: 181 VPNISQV 187
           VP ISQV
Sbjct: 160 VPTISQV 166

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  144 bits (362), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 105/190 (55%), Gaps = 7/190 (3%)

Query: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGH-SSRVNYCMFVPPFAVVTDSFYGILA 59
           ML++ADN +R +NFCF VI M  I  LL T +GH S+RVNYCMF   F ++TDS YG+ A
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60

Query: 60  NIWTTPFAWPIIXXXXXXXXXXXXXXXGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCR 119
           N +    AWPII               GTVL+VGIR H+C N  Y ++NKI++GS  RCR
Sbjct: 61  NFFE-QLAWPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCR 119

Query: 120 KAQXXXXXXXXXXXXXXVKVVMSAINLLSNG--AMGFSTPSIGRRRHHTANIGVPGASSP 177
            AQ              VK V S +  +S G    G S     RR+  +A  GVP  S+ 
Sbjct: 120 VAQAAVAFFYFSMAIFLVKGVFSIMKAISEGPFGSGSSFGFGSRRKRRSAGTGVPTTST- 178

Query: 178 QVGVPNISQV 187
             GVP +S+V
Sbjct: 179 --GVPTVSEV 186

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  141 bits (356), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 76/187 (40%), Positives = 106/187 (56%), Gaps = 13/187 (6%)

Query: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60
           ML +ADN++R +N  F VIC+GL  +LL T+  ++SR+NYCMF   + + TDS YGI AN
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60

Query: 61  IWTTPFAWPIIXXXXXXXXXXXXXXXGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120
            +    A P +               GTVL+ GIR HSCK+ +Y+++NKI QG  +RCR+
Sbjct: 61  FFDI-LALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRE 119

Query: 121 AQXXXXXXXXXXXXXXVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180
           +Q               K++MS IN++ NGA    T  IGRRR   A          ++G
Sbjct: 120 SQALVAFFYFSMAIFLAKLIMSTINMIQNGAF---TQHIGRRRRRNA---------AEIG 167

Query: 181 VPNISQV 187
           VP+ISQV
Sbjct: 168 VPSISQV 174

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  137 bits (346), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 104/187 (55%), Gaps = 13/187 (6%)

Query: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60
           MLS ADN++R ++  F +I +GLIG L+ T+   SSRVN+CMF   + ++TDSFYG LAN
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60

Query: 61  IWTTPFAWPIIXXXXXXXXXXXXXXXGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120
            W++   +P I                T L+VGIR HSCKN+ Y++ N I QGS+ RC +
Sbjct: 61  FWSS-LTYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQNNITQGSSSRCHQ 119

Query: 121 AQXXXXXXXXXXXXXXVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180
           +Q              +KV +S   ++ NG  GF+T   GRRR           +  Q+G
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNT-GYGRRR-----------ARRQMG 167

Query: 181 VPNISQV 187
           VP ISQV
Sbjct: 168 VPTISQV 174

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  137 bits (344), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 76/187 (40%), Positives = 105/187 (56%), Gaps = 13/187 (6%)

Query: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60
           MLS+ADNI+R IN  F +I +GL+  L++++  HSSRVN+CMF   + ++TDSFYG LAN
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60

Query: 61  IWTTPFAWPIIXXXXXXXXXXXXXXXGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120
           +W++   +P+I               GT L+VGIR HSC N+ Y+DNNKI QGS  RC +
Sbjct: 61  LWSS-LTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQ 119

Query: 121 AQXXXXXXXXXXXXXXVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180
           A+              +KVV+S I  +          S GRRR           +  Q+G
Sbjct: 120 AKAAVVFFYFSCILFLIKVVVS-IAAMVQNGGFGFGNSFGRRR-----------ARRQMG 167

Query: 181 VPNISQV 187
           +P ISQV
Sbjct: 168 IPTISQV 174

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score =  135 bits (340), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 96/166 (57%), Gaps = 1/166 (0%)

Query: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60
           MLS  DN +R  N  F V+ +  I +LL+T+   SSRVNYCMF   F ++TDSF+G+ AN
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60

Query: 61  IWTTPFAWPIIXXXXXXXXXXXXXXXGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120
           +     +WPII               GTVL+VGIR HSC NR Y+++NKIIQGS  RCR 
Sbjct: 61  LIDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120

Query: 121 AQXXXXXXXXXXXXXXVKVVMSAINLLSNGAMGFSTPSIGRRRHHT 166
           +Q               K++MSAI++ SNGA G S   + RR+  +
Sbjct: 121 SQAAVAFFYFAAFVFLAKMIMSAISMASNGAFG-SGSFMSRRKRRS 165

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  132 bits (333), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 101/187 (54%), Gaps = 18/187 (9%)

Query: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60
           MLS+ DN +R +NF F +I +GL+G+L+AT+   SSRVN+ +F   F +V DS Y ++AN
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIATQDHSSSRVNFAIFAAVFGIVFDSLYALIAN 60

Query: 61  IWTTPFAWPIIXXXXXXXXXXXXXXXGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120
            + +  AWPII                T L+VGIR  SC N ++   NKI +GS DRCRK
Sbjct: 61  -FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRK 119

Query: 121 AQXXXXXXXXXXXXXXVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180
           AQ              VK ++S +N +++GA G S+     R+              QVG
Sbjct: 120 AQASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSS----NRK-------------TQVG 162

Query: 181 VPNISQV 187
           VP ISQV
Sbjct: 163 VPTISQV 169

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  131 bits (330), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 74/187 (39%), Positives = 102/187 (54%), Gaps = 13/187 (6%)

Query: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60
           MLS ADN++R IN  F +I +GLI  L++T+  HSSRVN+CMF   + +VTDS YG LAN
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLISTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60

Query: 61  IWTTPFAWPIIXXXXXXXXXXXXXXXGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120
            W++   +P I                T L+VGIR HSCKN+ Y++ NKI Q S+ RC +
Sbjct: 61  FWSS-LTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQ 119

Query: 121 AQXXXXXXXXXXXXXXVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180
           +Q              +KV ++A   + NG  GF++    RR            +  Q+G
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVTAAGTIQNGGFGFNSGFGRRR------------ARRQLG 167

Query: 181 VPNISQV 187
           VP ISQV
Sbjct: 168 VPTISQV 174

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  126 bits (317), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 76/187 (40%), Positives = 102/187 (54%), Gaps = 17/187 (9%)

Query: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60
           MLS+ DN +RA NF F +I +GL GSL AT   ++ +VN+ +F   F ++ D+ Y I AN
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDNNNPQVNFAVFAAAFGLLFDTLYAIPAN 60

Query: 61  IWTTPFAWPIIXXXXXXXXXXXXXXXGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120
            + +  AWP++                T L+V IR HSC N +Y+DNNK+ QGS+DRCRK
Sbjct: 61  -FISALAWPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNNKVTQGSSDRCRK 119

Query: 121 AQXXXXXXXXXXXXXXVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180
           AQ              VK+ +S +N+ S GA  FST S GR+             S  VG
Sbjct: 120 AQASVAFLYFAFFVFLVKLALSLVNVFSVGA--FSTSS-GRK-------------SANVG 163

Query: 181 VPNISQV 187
           VP ISQV
Sbjct: 164 VPTISQV 170

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  125 bits (315), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 100/176 (56%), Gaps = 8/176 (4%)

Query: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSS-RVNYCMFVPPFAVVTDSFYGILA 59
           MLS+ DN +RA+NF F VI +GL GSL AT K H++ +VN+ +F   F ++ DS Y I A
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60

Query: 60  NIWTTPFAWPIIXXXXXXXXXXXXXXXGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCR 119
           N + +  AWP++                T L+V IRTHSC N++Y+D+N + QGSTDRCR
Sbjct: 61  N-FVSALAWPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNTVTQGSTDRCR 119

Query: 120 KAQXXXXXXXXXXXXXXVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGAS 175
           KAQ               K+ +S +NL+S GA G      G  R  T N+GVP  S
Sbjct: 120 KAQASVAFLYFSFFIFLAKLGLSLVNLISVGAFG-----AGSSR-RTGNVGVPTIS 169

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score =  119 bits (299), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 61/146 (41%), Positives = 80/146 (54%), Gaps = 1/146 (0%)

Query: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60
           MLS+ DN +RA+NF F +I +GL GSL+  ++   SRVN+ +F   FA+VTDSFY I+AN
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60

Query: 61  IWTTPFAWPIIXXXXXXXXXXXXXXXGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120
            + + FAWPII                T L   I  HSC NR ++D N I + STDRCRK
Sbjct: 61  -FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRK 119

Query: 121 AQXXXXXXXXXXXXXXVKVVMSAINL 146
            Q               K V S +N+
Sbjct: 120 VQASSTFLFFSFFIFLAKAVFSGLNI 145

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score = 99.0 bits (245), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 89/187 (47%), Gaps = 18/187 (9%)

Query: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60
           MLS+ DN +RA NF F +I + L GSL+  +    SRVN+ +F   FA++ DS Y +LAN
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60

Query: 61  IWTTPFAWPIIXXXXXXXXXXXXXXXGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120
            + +  AWPI+                T L   I  HSC N  ++  N I +G   RCRK
Sbjct: 61  -FISALAWPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGNDISEGREGRCRK 119

Query: 121 AQXXXXXXXXXXXXXXVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180
            Q               K V+S +N++S GA  FS+ S GR+                 G
Sbjct: 120 VQASSVFLFFSFFIFLAKAVLSGLNIVSTGA--FSSGS-GRKTGG--------------G 162

Query: 181 VPNISQV 187
           VP ISQV
Sbjct: 163 VPTISQV 169

>Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019W
           (REAL)
          Length = 894

 Score = 31.2 bits (69), Expect = 1.8,   Method: Composition-based stats.
 Identities = 11/27 (40%), Positives = 16/27 (59%)

Query: 157 PSIGRRRHHTANIGVPGASSPQVGVPN 183
           P +  R H+T ++ VP   SP  G+PN
Sbjct: 827 PPLATRSHNTTHLNVPMGVSPASGIPN 853

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.137    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,648,493
Number of extensions: 468755
Number of successful extensions: 1434
Number of sequences better than 10.0: 33
Number of HSP's gapped: 1383
Number of HSP's successfully gapped: 33
Length of query: 187
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 84
Effective length of database: 41,670,801
Effective search space: 3500347284
Effective search space used: 3500347284
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 62 (28.5 bits)