Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1017.53.494ON28328314770.0
TPHA0D032903.494ON28528312701e-178
Smik_6.2283.494ON28728312421e-174
SAKL0F02728g3.494ON28228412311e-172
Suva_7.4203.494ON28728312251e-171
CAGL0I10472g3.494ON28827612251e-171
KLTH0F14872g3.494ON28028312231e-171
YGR132C (PHB1)3.494ON28728312151e-169
TDEL0D056203.494ON27928112111e-169
NCAS0E007903.494ON32728211971e-166
NDAI0G009203.494ON29628411901e-166
Skud_7.4433.494ON28728311891e-166
KAFR0C019803.494ON28328311811e-164
TBLA0D029503.494ON28228111731e-163
Kwal_55.212403.494ON28326611531e-160
ZYRO0D09900g3.494ON28328211441e-159
KNAG0B007903.494ON28428411331e-157
Ecym_12353.494ON28328611251e-156
AFR313C3.494ON28328610611e-146
KLLA0D16302g3.494ON2262149591e-131
YGR231C (PHB2)5.98ON3102407509e-99
ADL141W5.98ON3072377509e-99
Kwal_27.127475.98ON3072377491e-98
SAKL0G15510g5.98ON3082377482e-98
KLTH0C01672g5.98ON3072377456e-98
Smik_16.755.98ON3102407456e-98
TBLA0H022205.98ON3072377431e-97
KAFR0B042505.98ON3102407422e-97
NDAI0D025305.98ON3162377388e-97
KNAG0A015805.98ON2882377341e-96
CAGL0L06490g5.98ON3132377361e-96
Kpol_1050.615.98ON3102377352e-96
Suva_7.5235.98ON3102377343e-96
NCAS0F006005.98ON3132377343e-96
Skud_7.5655.98ON3102377325e-96
TPHA0A050905.98ON3102377301e-95
KLLA0E15731g5.98ON3082377273e-95
TDEL0G012105.98ON3092377264e-95
ZYRO0B15136g5.98ON3102377256e-95
Kwal_56.234948.238ON2130118750.79
KLTH0F18546g7.518ON277779740.86
TDEL0H005207.518ON258845702.7
TDEL0B032908.520ON1830250702.8
Kwal_33.131861.46ON41245666.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1017.5
         (283 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON} (19813..2...   573   0.0  
TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON...   493   e-178
Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}...   483   e-174
SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly ...   478   e-172
Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}...   476   e-171
CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highl...   476   e-171
KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa] ...   475   e-171
YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}  P...   472   e-169
TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {...   471   e-169
NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494     465   e-166
NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494     462   e-166
Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}...   462   e-166
KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON...   459   e-164
TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.49...   456   e-163
Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {O...   448   e-160
ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar...   445   e-159
KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.49...   441   e-157
Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to...   437   e-156
AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON} ...   413   e-146
KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa] ...   374   e-131
YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}  P...   293   9e-99
ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic hom...   293   9e-99
Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa] ...   293   1e-98
SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa] ...   292   2e-98
KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly ...   291   6e-98
Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C ...   291   6e-98
TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98...   290   1e-97
KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON...   290   2e-97
NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON...   288   8e-97
KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98 Y...   287   1e-96
CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly...   288   1e-96
Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {...   287   2e-96
Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}...   287   3e-96
NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98...   287   3e-96
Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}...   286   5e-96
TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {...   285   1e-95
KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} simil...   284   3e-95
TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98...   284   4e-95
ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} simil...   283   6e-95
Kwal_56.23494 s56 complement(568724..575116) [6393 bp, 2130 aa] ...    33   0.79 
KLTH0F18546g Chr6 (1498810..1507143) [8334 bp, 2777 aa] {ON} sim...    33   0.86 
TDEL0H00520 Chr8 complement(79507..87273) [7767 bp, 2588 aa] {ON...    32   2.7  
TDEL0B03290 Chr2 complement(581901..587393) [5493 bp, 1830 aa] {...    32   2.8  
Kwal_33.13186 s33 complement(111561..112799) [1239 bp, 412 aa] {...    30   6.8  

>Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON}
           (19813..20664) [852 nt, 284 aa]
          Length = 283

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/283 (100%), Positives = 283/283 (100%)

Query: 1   MSKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWL 60
           MSKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWL
Sbjct: 1   MSKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWL 60

Query: 61  QKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPS 120
           QKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPS
Sbjct: 61  QKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPS 120

Query: 121 ISNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTK 180
           ISNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTK
Sbjct: 121 ISNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTK 180

Query: 181 AVELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRL 240
           AVELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRL
Sbjct: 181 AVELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRL 240

Query: 241 EASKEIAATLSQSSNVTYLPNGHGNARGGSDGTPNTLLLNLGR 283
           EASKEIAATLSQSSNVTYLPNGHGNARGGSDGTPNTLLLNLGR
Sbjct: 241 EASKEIAATLSQSSNVTYLPNGHGNARGGSDGTPNTLLLNLGR 283

>TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON}
           Anc_3.494 YGR132C
          Length = 285

 Score =  493 bits (1270), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 241/283 (85%), Positives = 261/283 (92%), Gaps = 1/283 (0%)

Query: 2   SKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQ 61
           +K++D + K+A+P+GI VSGIQ++MYDVKGGSRAVIFDR+SGVKQ +IGEGTHFL PWLQ
Sbjct: 3   TKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQ 62

Query: 62  KAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSI 121
           KAI++DVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDV QLPTIYQNLGLDYDERVLPSI
Sbjct: 63  KAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSI 122

Query: 122 SNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKA 181
            NEVLKAIVAQFDAAELITQRE+VS++IR EL  RSNEFGI+LEDVSITHMTFG EFTKA
Sbjct: 123 GNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKA 182

Query: 182 VELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLE 241
           VE KQIAQQDAERAKFLVE+AEQERQAAVIRAEGEAESAEYISKAL KAGDGLLLIRRLE
Sbjct: 183 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISKALAKAGDGLLLIRRLE 242

Query: 242 ASKEIAATLSQSSNVTYLPNG-HGNARGGSDGTPNTLLLNLGR 283
           ASKEIA TLSQSSNVTYLP+G   N    S GTPN+LLLNLGR
Sbjct: 243 ASKEIAKTLSQSSNVTYLPSGSSSNGNNESAGTPNSLLLNLGR 285

>Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  483 bits (1242), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 233/283 (82%), Positives = 258/283 (91%), Gaps = 1/283 (0%)

Query: 2   SKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQ 61
           S++ID + KVALPIGIV SGIQ+SMYDVKGGSR VIFDRI+GVKQ ++GEGTHFL+PWLQ
Sbjct: 5   SRLIDIITKVALPIGIVASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  KAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSI 121
           KAIIYDVRTKPKSIATNTGT+DLQMVSLTLRVLHRP+V+QLP IYQNLGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSI 124

Query: 122 SNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKA 181
            NEVLK+IVAQFDAAELITQRE++S +IR EL  R+NEFGI+LEDVSITHMTFG EFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLE 241
           VE KQIAQQDAERAKFLVEKAEQERQA+VIRAEGEAESAE+ISKAL K GDGLLLIRRLE
Sbjct: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244

Query: 242 ASKEIAATLSQSSNVTYLPNGH-GNARGGSDGTPNTLLLNLGR 283
           ASK+IA TL+ SSNV YLP+ H GN    S G+PN+LLLN+GR
Sbjct: 245 ASKDIAQTLANSSNVVYLPSQHSGNGNSESSGSPNSLLLNIGR 287

>SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 282

 Score =  478 bits (1231), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 234/284 (82%), Positives = 258/284 (90%), Gaps = 3/284 (1%)

Query: 1   MSKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWL 60
           MSK+ D++A++ALPIGI  S +Q+SMYDVKGG+RAVIFDR+SGV+Q +IGEGTHFL+PWL
Sbjct: 1   MSKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWL 60

Query: 61  QKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPS 120
           Q+AI+YDVRTKPK+IATNTGTKDLQMVSLTLRVLHRP+V+QLP IYQNLGLDYDERVLPS
Sbjct: 61  QRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPS 120

Query: 121 ISNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTK 180
           I NEVLKAIVAQFDAAELITQRE+VS RIR EL  R+ EF IRLEDVSITHMTFG EFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTK 180

Query: 181 AVELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRL 240
           AVE KQIAQQDAERAKFLVE+AEQERQAAVIRAEGEAESA+YISKAL KAGDGLLLIRRL
Sbjct: 181 AVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRL 240

Query: 241 EASKEIAATLSQSSNVTYLP-NGHGNARGGSDGTPNTLLLNLGR 283
           EASKEIA TL+ SSNVTYLP NG G A     G+PN+LLLNLGR
Sbjct: 241 EASKEIAQTLANSSNVTYLPSNGAGGAE--QQGSPNSLLLNLGR 282

>Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  476 bits (1225), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 229/283 (80%), Positives = 257/283 (90%), Gaps = 1/283 (0%)

Query: 2   SKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQ 61
           S+ ID + KVALPIG+V SG+Q+SMYDVKGGSR VIFDRI+GVKQ ++GEGTHFL+PWLQ
Sbjct: 5   SRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  KAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSI 121
           KAIIYDVRTKPKSIATNTGT+DLQMVSLTLRVLHRP+V+QLP+IYQNLGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124

Query: 122 SNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKA 181
            NEVLK+IVAQFDAAELITQRE++S +IR EL  R+NEFGI+LEDVSITHMTFG EFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLE 241
           VE KQIAQQDAERAKF+VEKAEQERQA+VIRAEGEAESAEYISKAL K GDGLLLIRRLE
Sbjct: 185 VEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 244

Query: 242 ASKEIAATLSQSSNVTYLPNGH-GNARGGSDGTPNTLLLNLGR 283
           ASK+IA TL+ SSNV YLP+ H G+      G+PN+LLLN+GR
Sbjct: 245 ASKDIAQTLANSSNVIYLPSQHAGSGNSEYSGSPNSLLLNIGR 287

>CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132c prohibitin antiproliferative protein
          Length = 288

 Score =  476 bits (1225), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 227/276 (82%), Positives = 250/276 (90%)

Query: 8   VAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQKAIIYD 67
           + KVA+P+GI VSG+Q+SMYDV+GGSR VIFDR+ GVK +++GEGTHFL+PWLQKAIIYD
Sbjct: 12  ITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIYD 71

Query: 68  VRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSISNEVLK 127
           VRTKPKSIATNTGTKDLQMVSLTLRVLHRPDV+QLP IYQNLGLDYDERVLPSI NEVLK
Sbjct: 72  VRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVLK 131

Query: 128 AIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKAVELKQI 187
           +IVAQFDAAELITQRE+VS +IR EL  R+NEFGIRLEDVSITHMTFG EFTKAVE KQI
Sbjct: 132 SIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQI 191

Query: 188 AQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLEASKEIA 247
           AQQDAERA+FLVEKAEQERQA+VIRAEGEAESAEYISKAL K GDGLLLIRRLEASKEIA
Sbjct: 192 AQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKEIA 251

Query: 248 ATLSQSSNVTYLPNGHGNARGGSDGTPNTLLLNLGR 283
            TL+ S+N+TYLP+ H        G+PNTLLLNLGR
Sbjct: 252 QTLANSNNITYLPSNHAGGDKDDKGSPNTLLLNLGR 287

>KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa]
           {ON} highly similar to uniprot|P40961 Saccharomyces
           cerevisiae YGR132C
          Length = 280

 Score =  475 bits (1223), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 226/283 (79%), Positives = 256/283 (90%), Gaps = 3/283 (1%)

Query: 1   MSKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWL 60
           MS++ D++AK+ALP+G+  S +Q+SMYDVKGGSRAVIFDR+SGV+Q ++GEGTHFL+PWL
Sbjct: 1   MSRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWL 60

Query: 61  QKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPS 120
           QKA++YDVRTKPK+IATNTGTKDLQMVSLTLRVLHRPDV++LPTIYQNLGLDYDERVLPS
Sbjct: 61  QKAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPS 120

Query: 121 ISNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTK 180
           I NEVLKAIVAQFDAAELITQRE VS RIR EL  R++EF IRLEDVSITHMTFG EFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTK 180

Query: 181 AVELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRL 240
           AVE KQIAQQDAERA+++VE AEQERQA+VIRAEGEAESAEYISKAL KAGDGLLLIRR+
Sbjct: 181 AVEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRI 240

Query: 241 EASKEIAATLSQSSNVTYLPNGHGNARGGSDGTPNTLLLNLGR 283
           EASKEIA TL+ SSNVTYLP+ H        G+PN+LLLNLGR
Sbjct: 241 EASKEIAKTLANSSNVTYLPSSHS---ASEQGSPNSLLLNLGR 280

>YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}
           PHB1Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 287

 Score =  472 bits (1215), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 232/283 (81%), Positives = 257/283 (90%), Gaps = 1/283 (0%)

Query: 2   SKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQ 61
           +K+ID + KVALPIGI+ SGIQ+SMYDVKGGSR VIFDRI+GVKQ ++GEGTHFL+PWLQ
Sbjct: 5   AKLIDVITKVALPIGIIASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  KAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSI 121
           KAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRP+V+QLP IYQNLGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSI 124

Query: 122 SNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKA 181
            NEVLK+IVAQFDAAELITQRE++S +IR EL  R+NEFGI+LEDVSITHMTFG EFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLE 241
           VE KQIAQQDAERAKFLVEKAEQERQA+VIRAEGEAESAE+ISKAL K GDGLLLIRRLE
Sbjct: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244

Query: 242 ASKEIAATLSQSSNVTYLPNGH-GNARGGSDGTPNTLLLNLGR 283
           ASK+IA TL+ SSNV YLP+ H G     S G+PN+LLLN+GR
Sbjct: 245 ASKDIAQTLANSSNVVYLPSQHSGGGNSESSGSPNSLLLNIGR 287

>TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {ON}
           Anc_3.494 YGR132C
          Length = 279

 Score =  471 bits (1211), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 225/281 (80%), Positives = 259/281 (92%), Gaps = 3/281 (1%)

Query: 1   MSKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWL 60
           MS++++ +A+VA+P+GIVVSG+Q+SMYDV+GGSRAVIFDR+SGV++ ++GEGTHFL+PWL
Sbjct: 1   MSRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWL 60

Query: 61  QKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPS 120
           QKAI+YD+RTKPK IATNTGTKD+QMVSLTLRVLHRPDV+QLP IYQNLGLDYDERVLPS
Sbjct: 61  QKAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPS 120

Query: 121 ISNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTK 180
           I NEVLKAIVAQFDAAELITQRE+VS RIR EL  R++EFGIRLEDVSITHMTFG EFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTK 180

Query: 181 AVELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRL 240
           AVE KQIAQQDAERAKFLVEKAEQ R+A+VIRAEGEAESAEYISKAL +AGDGLLLIRRL
Sbjct: 181 AVEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRL 240

Query: 241 EASKEIAATLSQSSNVTYLPNGHGNARGGSDGTPNTLLLNL 281
           EASKEIA TL+ SSN+TYLP   G A G ++G+ N+LLLN+
Sbjct: 241 EASKEIAQTLAASSNITYLP---GKAHGNTEGSQNSLLLNI 278

>NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494
          Length = 327

 Score =  465 bits (1197), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 221/282 (78%), Positives = 256/282 (90%), Gaps = 1/282 (0%)

Query: 2   SKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQ 61
           +K+++ + +VALP+GI+ +G+++SMYDVKGGSR VIFDR+SGV++ +IGEGTHFL+PWLQ
Sbjct: 47  TKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQ 106

Query: 62  KAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSI 121
           KA+IYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRP++ +LP IYQNLGLDYDE+VLPSI
Sbjct: 107 KAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSI 166

Query: 122 SNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKA 181
            NEVLK+IVAQFDAAELITQRE+VS RI++EL  R++EFGIRLEDVSITHMTFG EFTKA
Sbjct: 167 GNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKA 226

Query: 182 VELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLE 241
           VE KQIAQQDAERAKFLVEKAEQERQA+VIRAEGEAESAEYISKAL K GDGLLLIRRLE
Sbjct: 227 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 286

Query: 242 ASKEIAATLSQSSNVTYLPNGHGNARGGSDGTPNTLLLNLGR 283
           ASK+IA TL+ S N+TYLP G    RG   G+PN+LLLN+GR
Sbjct: 287 ASKDIAQTLANSPNITYLP-GQQGGRGNDSGSPNSLLLNIGR 327

>NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494
          Length = 296

 Score =  462 bits (1190), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 223/284 (78%), Positives = 255/284 (89%), Gaps = 3/284 (1%)

Query: 3   KIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQK 62
           K  + + KVALPIG++V+G+ +SMYDVKGGSR VIFDR+SGVK  ++GEGTHFL+PWLQK
Sbjct: 13  KFFNLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQK 72

Query: 63  AIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSIS 122
           A+IYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRP+V +LP IYQNLGLDYDE+VLPSI 
Sbjct: 73  AVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIG 132

Query: 123 NEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKAV 182
           NEVLK+IVAQFDAAELITQRE+VS RI++EL  R+NEFG+RLEDVSITHMTFG EFTKAV
Sbjct: 133 NEVLKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAV 192

Query: 183 ELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLEA 242
           E KQIAQQDAERAKFLVEKAEQERQA+VIRAEGEAESAE+ISKAL K GDGLLLIRRLEA
Sbjct: 193 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEA 252

Query: 243 SKEIAATLSQSSNVTYLPNGHGNARGGSDG---TPNTLLLNLGR 283
           SK+IA TL+ S NVTYLP  + ++  G+DG   +PN+LLLN+GR
Sbjct: 253 SKDIAQTLANSPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNIGR 296

>Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  462 bits (1189), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 231/283 (81%), Positives = 260/283 (91%), Gaps = 1/283 (0%)

Query: 2   SKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQ 61
           S++ID + KVALPIGI+ +GIQ++MYDVKGGSR VIFDRI+GVKQ ++GEGTHFL+PWLQ
Sbjct: 5   SRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  KAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSI 121
           KAIIYDVRTKPKSIATNTGT+DLQMVSLTLRVLHRP+V+QLP+IYQNLGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124

Query: 122 SNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKA 181
            NEVLK+IVAQFDAAELITQRE++S +IR EL  R+NEFGI+LEDVSITHMTFG EFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLE 241
           VE KQIAQQDAERAKFLVEKAEQERQA+VIRAEGEAESAE+ISKAL K GDGLLLIRRLE
Sbjct: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244

Query: 242 ASKEIAATLSQSSNVTYLPNGH-GNARGGSDGTPNTLLLNLGR 283
           ASK+IA TL+ SSNV YLP+ H GN  G S G+PN+LLLN+GR
Sbjct: 245 ASKDIAQTLANSSNVVYLPSQHSGNGSGDSSGSPNSLLLNIGR 287

>KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON}
           Anc_3.494 YGR132C
          Length = 283

 Score =  459 bits (1181), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 223/283 (78%), Positives = 255/283 (90%), Gaps = 3/283 (1%)

Query: 2   SKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQ 61
           ++ I+ V K+A+P G++++ + +SMYDVKGGSR VIFDRISGVK+ +IGEGTHFL+PWLQ
Sbjct: 3   TRAINVVTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQ 62

Query: 62  KAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSI 121
           KAIIYDVRTKPKSI+TNTGTKDLQMVSLTLR+LHRP+VV+LP IYQNLGLDYDERVLPSI
Sbjct: 63  KAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSI 122

Query: 122 SNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKA 181
            NEVLK+IVAQFDAAELITQRE+VS RIR E+  R+NEFGI+LEDVSITHMTFG EFTKA
Sbjct: 123 GNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKA 182

Query: 182 VELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLE 241
           VE KQIAQQDAERA+FLVEKAEQERQA+VIRAEGEAESAE ISKAL + GDGLLLIRRLE
Sbjct: 183 VEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLE 242

Query: 242 ASKEIAATLSQSSNVTYLPNGHGNARGGSDGT-PNTLLLNLGR 283
           ASK+IA TLS+SSN+TYLP G G  R G + T PN+LLLN+GR
Sbjct: 243 ASKDIARTLSKSSNITYLPGGKG--REGDEKTPPNSLLLNIGR 283

>TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.494
           YGR132C
          Length = 282

 Score =  456 bits (1173), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 221/281 (78%), Positives = 249/281 (88%), Gaps = 3/281 (1%)

Query: 3   KIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQK 62
           KI + +AK+A+P+G+ VS + +SMYDVKGGSRAVIFDRI GVKQ ++GEGTHFL+PWLQK
Sbjct: 5   KIAEKLAKIAIPLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQK 64

Query: 63  AIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSIS 122
           ++I+D+RTKPK+I TNTGT+DLQMVSLTLR+LHRPD+VQLP IYQNLGLDYDERVLPSI 
Sbjct: 65  SVIFDIRTKPKNITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIG 124

Query: 123 NEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKAV 182
           NEVLK+IVAQFDAAELITQRE+VS RIR EL  R+NEFGIRLEDVSITHMTFG EFTKAV
Sbjct: 125 NEVLKSIVAQFDAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAV 184

Query: 183 ELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLEA 242
           E KQIAQQDAERAKFLVEKAEQERQA+VIRAEGEAESAE IS+AL KAGDGLLLIRRLE 
Sbjct: 185 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLET 244

Query: 243 SKEIAATLSQSSNVTYLPNGHGNARGGSDGTPNTLLLNLGR 283
           SKEIA TL+ S +VTYLP G   A    D + N+LLLNLGR
Sbjct: 245 SKEIAETLAGSPHVTYLPGGGNQA---EDASKNSLLLNLGR 282

>Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {ON}
           YGR132C (PHB1) - mitochondrial protein, prohibitin
           homolog; similar to S. cerevisiae Phb2p [contig 130]
           FULL
          Length = 283

 Score =  448 bits (1153), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 214/266 (80%), Positives = 242/266 (90%)

Query: 1   MSKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWL 60
           MS+  D++AK+ALP+G+  S +Q+SMYDVKGGSRAVIFDR+SGV+Q ++GEGTHFLIPWL
Sbjct: 1   MSRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWL 60

Query: 61  QKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPS 120
           QKA+++DVRTKPK+IATNTGTKDLQMVSLTLRVLHRPDV++LP IYQNLGLDYDERVLPS
Sbjct: 61  QKAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPS 120

Query: 121 ISNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTK 180
           I NEVLK+IVAQFDAAELITQRE VS RIR EL  R++EF IRLEDVSITHMTFG +FTK
Sbjct: 121 IGNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTK 180

Query: 181 AVELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRL 240
           AVE KQIAQQDAERA+F+VE AEQERQA+VIRAEGEAESAEYISKAL KAGDGLLLIRR+
Sbjct: 181 AVEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRI 240

Query: 241 EASKEIAATLSQSSNVTYLPNGHGNA 266
           EASKEIA TL+ SSNVTYLP+    A
Sbjct: 241 EASKEIAKTLANSSNVTYLPSNQQGA 266

>ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar to
           uniprot|P40961 Saccharomyces cerevisiae YGR132C
          Length = 283

 Score =  445 bits (1144), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 226/282 (80%), Positives = 255/282 (90%), Gaps = 2/282 (0%)

Query: 2   SKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQ 61
           S++ +TVAKVA+P+GIV SGIQ+SMYDV+GGSRAVIFDR+SGV+Q ++GEGTHFL+PWLQ
Sbjct: 3   SRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQ 62

Query: 62  KAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSI 121
           KA+IYDVRTKPKSIATNTGTKD+QMVSLTLRVLHRP V+QLP IYQNLGLDYDERVLPSI
Sbjct: 63  KAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSI 122

Query: 122 SNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKA 181
            NEVLKAIVA++DAAELITQRE+VS+ IR EL  R++EF IRLEDVSITHMTFG EFTKA
Sbjct: 123 GNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKA 182

Query: 182 VELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLE 241
           VELKQIAQQDAERAKFLVEKAEQ R+ +VIRAEGEAE+AE ISKAL KAGDGLLLIRRLE
Sbjct: 183 VELKQIAQQDAERAKFLVEKAEQIRKVSVIRAEGEAEAAESISKALAKAGDGLLLIRRLE 242

Query: 242 ASKEIAATLSQSSNVTYLPNGHGNARGGSDGTPNTLLLNLGR 283
           ASK+IA TL+ SSNVTYLP+      GG +GT  +LLLNLGR
Sbjct: 243 ASKDIAQTLANSSNVTYLPSQQSG--GGQEGTSQSLLLNLGR 282

>KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.494
           YGR132C
          Length = 284

 Score =  441 bits (1133), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 226/284 (79%), Positives = 253/284 (89%), Gaps = 1/284 (0%)

Query: 1   MSKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWL 60
           MSK I+ ++K+A+P G+++    ++MYDVKGGSR VIFDR+SGV+Q ++GEGTHFL+PWL
Sbjct: 1   MSKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWL 60

Query: 61  QKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPS 120
           QKAIIYDVR+KPKSIATNTGTKDLQMVSLTLRVLHRP+V++LP IYQ+LGLDYDERVLPS
Sbjct: 61  QKAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPS 120

Query: 121 ISNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTK 180
           I NEVLK+IVAQFDAAELITQREVVS RIR EL  R+ EFGIRLEDVSITHMTFG EFTK
Sbjct: 121 IGNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTK 180

Query: 181 AVELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRL 240
           AVE KQIAQQDAERAKFLVEKAEQ RQA+VIRAEGEAESAE ISKAL K GDGLLLIRRL
Sbjct: 181 AVEQKQIAQQDAERAKFLVEKAEQMRQASVIRAEGEAESAEAISKALAKVGDGLLLIRRL 240

Query: 241 EASKEIAATLSQSSNVTYLPN-GHGNARGGSDGTPNTLLLNLGR 283
           EASKEIA TLS+SSNVTYLP+ G G   G  DG+ NTLLLN+GR
Sbjct: 241 EASKEIARTLSRSSNVTYLPSAGAGGKHGREDGSGNTLLLNIGR 284

>Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to
           Ashbya gossypii AFR313C
          Length = 283

 Score =  437 bits (1125), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 208/286 (72%), Positives = 254/286 (88%), Gaps = 6/286 (2%)

Query: 1   MSKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWL 60
           MS+ ++ +A +A+PIG+ +   Q  +YDV+GG+RAVIFDR+SGV+Q ++GEGTHFLIPWL
Sbjct: 1   MSRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWL 60

Query: 61  QKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPS 120
           QKA+IYDVRTKPK+IATNTGTKDLQ+V+LTLRVLHRPDV+ LP IYQ LGLDYDERVLPS
Sbjct: 61  QKAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPS 120

Query: 121 ISNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTK 180
           I NEVLKAIVAQFDAAELITQRE+VS +IR EL +R++ F I+LEDV+ITHM FG+EFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTK 180

Query: 181 AVELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRL 240
           +VE KQIAQQ++ERAK+LV+ AEQER AAVIRAEG+AE+AEYISKAL+KAGDGLL+IRRL
Sbjct: 181 SVEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRL 240

Query: 241 EASKEIAATLSQSSNVTYLPNGHGNARGGSD---GTPNTLLLNLGR 283
           EASK+IA TL+ SSN+TYLP+   +++GGS    GTP++LLLNLGR
Sbjct: 241 EASKKIAQTLAGSSNITYLPS---SSKGGSHDACGTPSSLLLNLGR 283

>AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR132C
           (PHB1)
          Length = 283

 Score =  413 bits (1061), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 210/286 (73%), Positives = 248/286 (86%), Gaps = 6/286 (2%)

Query: 1   MSKIIDTVAKVALP---IGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLI 57
           MS++ D++ ++ LP   I +  S +QFSMYDV+GG+RA+IFDRISGVK +++GEGTHFLI
Sbjct: 1   MSRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLI 60

Query: 58  PWLQKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERV 117
           PWLQKAII+DVRTKP++IATNTGTKDLQMVSLTLRVLHRPDV+ L  IY+ LG DYDERV
Sbjct: 61  PWLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERV 120

Query: 118 LPSISNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNE 177
           LPSI NEVLKAIVAQF+A+ELITQRE+VS +IR EL RR++EF IRLEDVSITHMTFG E
Sbjct: 121 LPSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQE 180

Query: 178 FTKAVELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLI 237
           FTKAVE KQIAQQ+++RAKF+VE+AEQER+AAVIRAEGEAE+AE+ISKAL KAGDGLL+I
Sbjct: 181 FTKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMI 240

Query: 238 RRLEASKEIAATLSQSSNVTYLPNGHGNARGGSDGTPNTLLLNLGR 283
           RRLEASK IA TL+ S NVTYLP+     +    G PN+LLLNLGR
Sbjct: 241 RRLEASKGIAETLANSPNVTYLPS---KGQAADSGAPNSLLLNLGR 283

>KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa]
           {ON} similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 226

 Score =  374 bits (959), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 173/214 (80%), Positives = 200/214 (93%)

Query: 1   MSKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWL 60
           MS++ D +A++A+P+G+ VS IQ+SMYDV+GG RAVIFDR+ GV+Q +IGEGTHFL+PWL
Sbjct: 1   MSRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWL 60

Query: 61  QKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPS 120
           QK+I++DVRTKPK+IATNTGTKDLQMVSLTLRVLHRPDV+QLP IYQNLG+DYDERVLPS
Sbjct: 61  QKSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPS 120

Query: 121 ISNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTK 180
           I NEVLKAIVAQFDAAELITQRE+VS RIRAEL +R++EF I+LEDVSITHMTFG EFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTK 180

Query: 181 AVELKQIAQQDAERAKFLVEKAEQERQAAVIRAE 214
           AVE KQIAQQDAERA+FLVEKAEQER+AAVIRAE
Sbjct: 181 AVEQKQIAQQDAERARFLVEKAEQERKAAVIRAE 214

>YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}
           PHB2Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 310

 Score =  293 bits (750), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 145/240 (60%), Positives = 186/240 (77%), Gaps = 1/240 (0%)

Query: 22  IQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQKAIIYDVRTKPKSIATNTGT 81
           I  ++++V GG RA+++ RI GV   I  EGTHF+ PWL   IIYDVR KP+++A+ TGT
Sbjct: 54  INNALFNVDGGHRAIVYSRIHGVSSRIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGT 113

Query: 82  KDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSISNEVLKAIVAQFDAAELITQ 141
           KDLQMV++T RVL RPDVVQLPTIY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 142 REVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKAVELKQIAQQDAERAKFLVEK 201
           RE VS  IR  L RR+++F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+K
Sbjct: 174 REKVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 202 AEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLEASKEIAATLSQSSNVTYLPN 261
           A QE+Q  V+RA+GEA+SAE I +A+ K+ D + L +RL+ +++IA  L+ S N   L N
Sbjct: 234 ARQEKQGMVVRAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILASSPNRVILDN 292

>ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR231C (PHB2)
          Length = 307

 Score =  293 bits (750), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 139/237 (58%), Positives = 189/237 (79%), Gaps = 1/237 (0%)

Query: 25  SMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQKAIIYDVRTKPKSIATNTGTKDL 84
           S+++V GG RA+++ R+SGV+Q++ GEGTHF+IPWL+  ++YDVR+KP+++++ TGT DL
Sbjct: 57  SLFNVDGGHRAIVYSRLSGVQQSVYGEGTHFVIPWLETPVLYDVRSKPRTVSSLTGTNDL 116

Query: 85  QMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSISNEVLKAIVAQFDAAELITQREV 144
           QMV++T RVL RPDV  LP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVQHLPLIYRTLGTDYDERVLPSIVNEVLKAVVAQFNASQLITQRES 176

Query: 145 VSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKAVELKQIAQQDAERAKFLVEKAEQ 204
           VS  IR  L RR++ F I L+DVSIT+MTF  EFT AVE KQ+AQQDA+RA F VEKA+Q
Sbjct: 177 VSRLIRDNLVRRASRFNIMLDDVSITYMTFSPEFTSAVEAKQVAQQDAQRASFYVEKAKQ 236

Query: 205 ERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLEASKEIAATLSQSSNVTYLPN 261
           E+Q+ +++A+GEA+SAE I +A+ K+ D + L +RL+ ++EIA  L+ S N   L N
Sbjct: 237 EKQSMIVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIAGILAASPNRVILDN 292

>Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa]
           {ON} YGR231C (PHB2) - mitochondrial protein, prohibitin
           homolog; homolog of mammalian BAP37 and S. cerevisiae
           Phb1p [contig 260] FULL
          Length = 307

 Score =  293 bits (749), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 187/237 (78%), Gaps = 1/237 (0%)

Query: 25  SMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQKAIIYDVRTKPKSIATNTGTKDL 84
           S+++V GG RA+++ R++GV+  I  EGTHF IPWL+  I+YDVR KP+++A+ TGTKDL
Sbjct: 57  SLFNVDGGHRAIVYSRLNGVQSRIFAEGTHFAIPWLETPIVYDVRAKPRNVASLTGTKDL 116

Query: 85  QMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSISNEVLKAIVAQFDAAELITQREV 144
           QMV++T RVL RPDV QLPT+++ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVTQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 145 VSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKAVELKQIAQQDAERAKFLVEKAEQ 204
           VS  IR  L RR+++F + L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASKFNVLLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 205 ERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLEASKEIAATLSQSSNVTYLPN 261
           E+Q  V++A+GEA+SAE I +A+ K+ D + L +RL+ ++EIA  LS S N   L N
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILSSSPNKVILDN 292

>SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa]
           {ON} highly similar to uniprot|P50085 Saccharomyces
           cerevisiae YGR231C PHB2 Possible role in aging
           mitochondrial protein prohibitin homolog homolog of
           mammalian BAP37 and S. cerevisiae Phb1p
          Length = 308

 Score =  292 bits (748), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 141/237 (59%), Positives = 188/237 (79%), Gaps = 1/237 (0%)

Query: 25  SMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQKAIIYDVRTKPKSIATNTGTKDL 84
           ++++V GG RA+++ R+ G++Q I  EGTHF +PWL+  I+YDVR KP+++A+ TGTKDL
Sbjct: 58  ALFNVDGGHRAILYSRVGGIQQRIYNEGTHFAVPWLETPIVYDVRAKPRNVASLTGTKDL 117

Query: 85  QMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSISNEVLKAIVAQFDAAELITQREV 144
           QMV++T RVL RP+V QLPTIY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 118 QMVNITCRVLSRPEVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRER 177

Query: 145 VSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKAVELKQIAQQDAERAKFLVEKAEQ 204
           VS  IR  L RR+++F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 178 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 237

Query: 205 ERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLEASKEIAATLSQSSNVTYLPN 261
           E+Q  V++A+GEA+SAE I +A+ K+ D + L +RL+ ++EIA  LS+S N   L N
Sbjct: 238 EKQGMVVKAQGEAQSAELIGEAIKKSKDYVEL-KRLDTAREIAEILSKSPNRVILDN 293

>KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231C PHB2 Possible role in aging mitochondrial
           protein prohibitin homolog homolog of mammalian BAP37
           and S. cerevisiae Phb1p
          Length = 307

 Score =  291 bits (745), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 141/237 (59%), Positives = 187/237 (78%), Gaps = 1/237 (0%)

Query: 25  SMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQKAIIYDVRTKPKSIATNTGTKDL 84
           S+++V GG RA+I+ R++GV+  I  EGTHF IPW +  I+YDVR KP+++A+ TGTKDL
Sbjct: 57  SLFNVDGGHRAIIYSRLNGVQSRIFAEGTHFAIPWFETPIVYDVRAKPRNVASLTGTKDL 116

Query: 85  QMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSISNEVLKAIVAQFDAAELITQREV 144
           QMV++T RVL RP+V QLPT+++ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPNVSQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 145 VSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKAVELKQIAQQDAERAKFLVEKAEQ 204
           VS  IR  L RR+++F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTYAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 205 ERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLEASKEIAATLSQSSNVTYLPN 261
           E+Q  V++A+GEA+SAE I +A+ K+ D + L +RL+ ++EIA  LSQS N   L N
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILSQSPNRVILDN 292

>Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C
           (REAL)
          Length = 310

 Score =  291 bits (745), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 143/240 (59%), Positives = 186/240 (77%), Gaps = 1/240 (0%)

Query: 22  IQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQKAIIYDVRTKPKSIATNTGT 81
           I  ++++V GG RA+++ RI GV   I  EGTHF+ PWL   I+YDVR KP+++A+ TGT
Sbjct: 54  INNALFNVDGGHRAIVYSRIHGVSTKIFNEGTHFIFPWLDTPIVYDVRAKPRNVASLTGT 113

Query: 82  KDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSISNEVLKAIVAQFDAAELITQ 141
           KDLQMV++T RVL RPDVVQLPTIY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 142 REVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKAVELKQIAQQDAERAKFLVEK 201
           RE VS  IR  L RR+++F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+K
Sbjct: 174 REKVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 202 AEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLEASKEIAATLSQSSNVTYLPN 261
           A QE+Q  V++A+GEA+SAE I +A+ K+ D + L +RL+ +++IA  L+ S N   L N
Sbjct: 234 ARQEKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILASSPNRVILDN 292

>TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98
           YGR231C
          Length = 307

 Score =  290 bits (743), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 144/237 (60%), Positives = 184/237 (77%), Gaps = 1/237 (0%)

Query: 25  SMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQKAIIYDVRTKPKSIATNTGTKDL 84
           S+++V GG RA+++ R+SGV   I  EGTHF+IPWLQ  IIYDVR KP+++A+ TGTKDL
Sbjct: 55  SLFNVDGGHRAILYSRLSGVSSKIYNEGTHFVIPWLQTPIIYDVRAKPRNVASLTGTKDL 114

Query: 85  QMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSISNEVLKAIVAQFDAAELITQREV 144
           QMV++T RVL RPD+  LP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQR+ 
Sbjct: 115 QMVNITCRVLSRPDIPSLPLIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 174

Query: 145 VSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKAVELKQIAQQDAERAKFLVEKAEQ 204
           VS  IR  L RR+ +F I L+DVSIT MTF  EFT AVE KQIAQQDA+RA FLV++A Q
Sbjct: 175 VSRLIRENLVRRAGKFNIALDDVSITFMTFSPEFTNAVESKQIAQQDAQRAAFLVDRARQ 234

Query: 205 ERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLEASKEIAATLSQSSNVTYLPN 261
           E+Q  V++A+GEA+SAE I +A+ K+ D + L +RL+ SK+IA  L+ SSN   L N
Sbjct: 235 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDISKDIAKILATSSNRLVLDN 290

>KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  290 bits (742), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 142/240 (59%), Positives = 187/240 (77%), Gaps = 1/240 (0%)

Query: 22  IQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQKAIIYDVRTKPKSIATNTGT 81
           +Q S+++V GG RA+++ RI+GV   I  EGTHF++PWL+  I+YDVR KP+++A+ TGT
Sbjct: 53  LQQSLFNVDGGHRAIVYSRINGVSSRIYNEGTHFILPWLETPIVYDVRAKPRNVASLTGT 112

Query: 82  KDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSISNEVLKAIVAQFDAAELITQ 141
           KDLQMV++T RVL RPDV  LP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQ
Sbjct: 113 KDLQMVNITCRVLSRPDVRSLPIIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 172

Query: 142 REVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKAVELKQIAQQDAERAKFLVEK 201
           RE VS  IR  L RR+++F I L+DVSIT MTF  EFT+AVE KQIAQQDA+RA F+V+K
Sbjct: 173 REKVSKLIRENLVRRASKFNIMLDDVSITFMTFSPEFTQAVEAKQIAQQDAQRAAFIVDK 232

Query: 202 AEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLEASKEIAATLSQSSNVTYLPN 261
           A QE+Q  V++A+GEA+SAE I +A+ K+ D + L +RL+ ++EIA  L+ S N   L N
Sbjct: 233 ARQEKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTAREIARILANSPNRVVLDN 291

>NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON}
           Anc_5.98
          Length = 316

 Score =  288 bits (738), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 144/237 (60%), Positives = 183/237 (77%), Gaps = 1/237 (0%)

Query: 25  SMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQKAIIYDVRTKPKSIATNTGTKDL 84
           ++++V GG RA+++ RISGV   I  EGTHF IPW++  IIYDVR KP+++A+ TGTKDL
Sbjct: 62  ALFNVDGGHRAIVYSRISGVSPRIYPEGTHFAIPWIETPIIYDVRAKPRNVASLTGTKDL 121

Query: 85  QMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSISNEVLKAIVAQFDAAELITQREV 144
           QMV++T RVL RP+V QLPTIY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 122 QMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 181

Query: 145 VSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKAVELKQIAQQDAERAKFLVEKAEQ 204
           VS  IR  L  R+N F I L+DVSIT MTF  EFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 182 VSKLIRENLMGRANRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 241

Query: 205 ERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLEASKEIAATLSQSSNVTYLPN 261
           E+Q  V+RA+GEA+SAE I  A+ K+ D + L +RL+ ++EIA  L++S N   L N
Sbjct: 242 EKQGMVVRAQGEAKSAELIGDAIKKSKDYVEL-KRLDTAREIARILAKSPNRVVLDN 297

>KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98
           YGR231C
          Length = 288

 Score =  287 bits (734), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 184/237 (77%), Gaps = 1/237 (0%)

Query: 25  SMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQKAIIYDVRTKPKSIATNTGTKDL 84
           ++++V GG RA+++ RI GV   I  EGTHF++PWL+  I+YDVR KP+++A+ TGTKDL
Sbjct: 35  ALFNVDGGHRAIVYSRIGGVLPRIYNEGTHFVLPWLETPIVYDVRAKPRNVASLTGTKDL 94

Query: 85  QMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSISNEVLKAIVAQFDAAELITQREV 144
           QMV++T RVL RPDV QLPT+Y+ LG DYD+RVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 95  QMVNITCRVLSRPDVTQLPTLYRTLGQDYDDRVLPSIVNEVLKSVVAQFNASQLITQREK 154

Query: 145 VSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKAVELKQIAQQDAERAKFLVEKAEQ 204
           VS  IR  L RR++ F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 155 VSRLIRENLVRRASRFNIMLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFIVDKARQ 214

Query: 205 ERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLEASKEIAATLSQSSNVTYLPN 261
           E+Q  V++A GEA+SAE I +A+ K+ D + L +RL+ +KEIA  L+ S N   L N
Sbjct: 215 EKQGMVVKAVGEAKSAELIGEAIKKSKDYVEL-KRLDTAKEIATILAASPNRVVLDN 270

>CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231c PHB2 or uniprot|P40961 Saccharomyces cerevisiae
           YGR132c PHB1
          Length = 313

 Score =  288 bits (736), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 141/237 (59%), Positives = 185/237 (78%), Gaps = 1/237 (0%)

Query: 25  SMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQKAIIYDVRTKPKSIATNTGTKDL 84
           ++++V GG RA+++ RI GV Q I  EGTH +IPW++  I+YDVR KP+++A+ TGTKDL
Sbjct: 59  ALFNVDGGHRAIVYSRIGGVSQKIFSEGTHIIIPWIETPIVYDVRAKPRNVASLTGTKDL 118

Query: 85  QMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSISNEVLKAIVAQFDAAELITQREV 144
           QMV++T RVL RP+V QLPTIY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 119 QMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 178

Query: 145 VSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKAVELKQIAQQDAERAKFLVEKAEQ 204
           VS  IR  L RR++ F I L+DVSIT+MTF  EFT+AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 179 VSRLIRDNLVRRASGFNILLDDVSITYMTFSPEFTQAVEAKQIAQQDAQRAAFIVDKARQ 238

Query: 205 ERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLEASKEIAATLSQSSNVTYLPN 261
           E+Q  V++A+GEA+SAE I  A+ K+ D + L +RL+ +K+IA  L+ S N   L N
Sbjct: 239 EKQGMVVKAQGEAKSAELIGDAIKKSRDYVEL-KRLDTAKDIAKILANSPNRVVLDN 294

>Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {ON}
           complement(135758..136690) [933 nt, 311 aa]
          Length = 310

 Score =  287 bits (735), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 139/237 (58%), Positives = 185/237 (78%), Gaps = 1/237 (0%)

Query: 25  SMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQKAIIYDVRTKPKSIATNTGTKDL 84
           ++++V GG RA+++ RI GV   I  EGTHF++PWL+  ++YDVR KP+++A+ TGTKDL
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSKIYNEGTHFVLPWLETPVVYDVRAKPRNVASLTGTKDL 119

Query: 85  QMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSISNEVLKAIVAQFDAAELITQREV 144
           QMV++T RVL RPDV QLPTIY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 145 VSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKAVELKQIAQQDAERAKFLVEKAEQ 204
           VS  IR  L  R+  F + L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+KA+Q
Sbjct: 180 VSRLIRENLVNRAGRFNLILDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKAKQ 239

Query: 205 ERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLEASKEIAATLSQSSNVTYLPN 261
           E+Q  V++A+GEA+SAE I +A+ K+ D + L +RL+ ++EIA  L++S N   L N
Sbjct: 240 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIADILAKSPNRVVLDN 295

>Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  287 bits (734), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 184/237 (77%), Gaps = 1/237 (0%)

Query: 25  SMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQKAIIYDVRTKPKSIATNTGTKDL 84
           ++++V GG RA+++ R++GV   I  EGTHF+ PW+   IIYDVR KP+++A+ TGTKDL
Sbjct: 57  ALFNVDGGHRAIVYSRLNGVSARIFNEGTHFIFPWIDTPIIYDVRAKPRNVASLTGTKDL 116

Query: 85  QMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSISNEVLKAIVAQFDAAELITQREV 144
           QMV++T RVL RPDV QLPTIY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 176

Query: 145 VSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKAVELKQIAQQDAERAKFLVEKAEQ 204
           VS  IR  L RR++ F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASRFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 205 ERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLEASKEIAATLSQSSNVTYLPN 261
           E+Q  V++A+GEA+SAE I +A+ K+ D + L +RL+ +++IA  L+ S N   L N
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTARDIAKILANSPNRVVLDN 292

>NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98
           YGR231C
          Length = 313

 Score =  287 bits (734), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 142/237 (59%), Positives = 183/237 (77%), Gaps = 1/237 (0%)

Query: 25  SMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQKAIIYDVRTKPKSIATNTGTKDL 84
           S+++V GG RA+++ RISGV   I  EGTHF+IPW++  IIYDVR KP+++A+ TGTKDL
Sbjct: 59  SLFNVDGGHRAIVYSRISGVSPKIYPEGTHFIIPWIETPIIYDVRAKPRNVASLTGTKDL 118

Query: 85  QMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSISNEVLKAIVAQFDAAELITQREV 144
           QMV++T RVL RP+V  LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 119 QMVNITCRVLSRPNVENLPNIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 178

Query: 145 VSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKAVELKQIAQQDAERAKFLVEKAEQ 204
           VS  IR  L  RS+ F I L+DVSIT MTF  EFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 179 VSKLIRENLMGRSSRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 238

Query: 205 ERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLEASKEIAATLSQSSNVTYLPN 261
           E+Q  V+RA+GEA+SAE I +A+ K+ D + L +RL+ ++EIA  L++S N   L N
Sbjct: 239 EKQGMVVRAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILAKSPNRVVLDN 294

>Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  286 bits (732), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 181/237 (76%), Gaps = 1/237 (0%)

Query: 25  SMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQKAIIYDVRTKPKSIATNTGTKDL 84
           ++++V GG RA+++ RI GV   I  EGTHF+ PWL   IIYDVR KP+++A+ TGTKDL
Sbjct: 57  ALFNVDGGHRAIVYSRIHGVSSKIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGTKDL 116

Query: 85  QMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSISNEVLKAIVAQFDAAELITQREV 144
           QMV++T RVL RPDV QLP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVAQLPIIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 145 VSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKAVELKQIAQQDAERAKFLVEKAEQ 204
           VS  IR  L RR+  F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRATRFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 205 ERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLEASKEIAATLSQSSNVTYLPN 261
           E+Q  V++A+GEA+SAE I +A+ K+ D + L +RL+ +++IA  L+ S N   L N
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILANSPNRVILDN 292

>TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  285 bits (730), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 139/237 (58%), Positives = 185/237 (78%), Gaps = 1/237 (0%)

Query: 25  SMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQKAIIYDVRTKPKSIATNTGTKDL 84
           ++++V GG RA+++ RI GV   I  EGTHF+IPW++  +IYDVR KP+++A+ TGTKDL
Sbjct: 58  ALFNVDGGHRAIVYSRIGGVSNKIYTEGTHFVIPWIETPVIYDVRAKPRNVASLTGTKDL 117

Query: 85  QMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSISNEVLKAIVAQFDAAELITQREV 144
           QMV++T RVL RP+V QLPTIY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQR+ 
Sbjct: 118 QMVNITCRVLSRPNVTQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 177

Query: 145 VSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKAVELKQIAQQDAERAKFLVEKAEQ 204
           VS  IR  L  R+ +F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 178 VSRLIRDNLVLRAQKFNITLDDVSITYMTFSPEFTTAVEAKQIAQQDAQRAAFVVDKARQ 237

Query: 205 ERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLEASKEIAATLSQSSNVTYLPN 261
           E+Q  V++A+GEA+SAE I +A+ K+ D + L +RL+ +K+IA  L++S N   L N
Sbjct: 238 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAKDIADILAKSPNRVVLDN 293

>KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 308

 Score =  284 bits (727), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 135/237 (56%), Positives = 187/237 (78%), Gaps = 1/237 (0%)

Query: 25  SMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQKAIIYDVRTKPKSIATNTGTKDL 84
           ++++V GG RA+++ RI+GV+  I  EGTHF+IPW++  ++YDVR KP+++++ TGTKDL
Sbjct: 58  ALFNVDGGHRAIVYSRINGVQPRIYPEGTHFIIPWVENPVVYDVRAKPRNVSSLTGTKDL 117

Query: 85  QMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSISNEVLKAIVAQFDAAELITQREV 144
           QMV++T RVL RP+V  LP IY+ LG+DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 118 QMVNITCRVLSRPNVENLPMIYRTLGVDYDERVLPSIVNEVLKAVVAQFNASQLITQRER 177

Query: 145 VSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKAVELKQIAQQDAERAKFLVEKAEQ 204
           VS  IR  L RR+  F I L+DVSIT+MTF  EFT +VE KQIAQQDA++A F+V+KA Q
Sbjct: 178 VSRLIRENLVRRAKHFNIMLDDVSITYMTFSPEFTNSVEAKQIAQQDAQKAAFVVDKATQ 237

Query: 205 ERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLEASKEIAATLSQSSNVTYLPN 261
           E+Q  +++A+GEA+SAE I +A+ K+ D + L +RL+ ++EIA+ LS+S N   L N
Sbjct: 238 EKQGMIVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIASILSRSPNKVILDN 293

>TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98
           YGR231C
          Length = 309

 Score =  284 bits (726), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 139/237 (58%), Positives = 184/237 (77%), Gaps = 1/237 (0%)

Query: 25  SMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQKAIIYDVRTKPKSIATNTGTKDL 84
           ++++V GG RA+++ RI GV   I  EGTH +IPWL+  ++YDVR KP+++A+ TGTKDL
Sbjct: 59  ALFNVDGGHRAIVYSRIGGVSSRIYNEGTHVIIPWLETPVVYDVRAKPRNVASLTGTKDL 118

Query: 85  QMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSISNEVLKAIVAQFDAAELITQREV 144
           QMV++T RVL RP+V QLPTIY+ LG DY ERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 119 QMVNITCRVLSRPNVEQLPTIYRTLGQDYGERVLPSIVNEVLKAVVAQFNASQLITQREK 178

Query: 145 VSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKAVELKQIAQQDAERAKFLVEKAEQ 204
           VS  IR  L RR++ F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 179 VSRLIRENLVRRASNFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 238

Query: 205 ERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLEASKEIAATLSQSSNVTYLPN 261
           E+Q  V++A+GEA+SAE I +A+ K+ D + L +RL+ ++EIA  L++S N   L N
Sbjct: 239 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIAQILARSPNRVILDN 294

>ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 310

 Score =  283 bits (725), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 139/237 (58%), Positives = 184/237 (77%), Gaps = 1/237 (0%)

Query: 25  SMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQKAIIYDVRTKPKSIATNTGTKDL 84
           ++++V GG RA+++ RI GV   I  EGTH L+PW +  ++YDVR KP+++A+ TGTKDL
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSRIYPEGTHLLLPWFETPVVYDVRAKPRNVASLTGTKDL 119

Query: 85  QMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSISNEVLKAIVAQFDAAELITQREV 144
           QMV++T RVL RPDV QLP IY+ LGLDYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVGQLPVIYRTLGLDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 145 VSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKAVELKQIAQQDAERAKFLVEKAEQ 204
           VS  IR  L RR++ F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 180 VSRLIRENLVRRASRFNILLDDVSITYMTFSPEFTAAVESKQIAQQDAQRAAFVVDRALQ 239

Query: 205 ERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLEASKEIAATLSQSSNVTYLPN 261
           E+Q  V++A+G+A+SAE I +A+ K+ D + L +RL+ ++EIA  LS+S N   L N
Sbjct: 240 EKQGLVVKAQGDAKSAELIGEAIRKSKDYVEL-KRLDTAREIAQILSRSPNRVVLDN 295

>Kwal_56.23494 s56 complement(568724..575116) [6393 bp, 2130 aa] {ON}
            YER172C (BRR2) - putative ATP-dependent RNA helicase
            [contig 176] FULL
          Length = 2130

 Score = 33.5 bits (75), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 52/118 (44%), Gaps = 8/118 (6%)

Query: 89   LTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSISNEVLKAIVAQFDAAELITQREVVSDR 148
            L +R+L  P +  +P  Y +     D+  L    +++  + + +  +  L+   E     
Sbjct: 944  LYVRMLKSPALYGVPDTYTS-----DDPTLLRYRDQLAHSALKELHSNHLVVYDEQKGTV 998

Query: 149  IRAELGRRSNEFGIRLEDVSITHMTFGNEFTKAVELKQIAQQDAERAKFLVEKAEQER 206
            I  ELGR ++ F I+   +S+ + T  + FT    L+  +  D  R    +   E+ER
Sbjct: 999  ISTELGRIASHFYIKYHSMSMYNKTLNSHFTAIEILRLFSMSDEFR---FIPVREEER 1053

>KLTH0F18546g Chr6 (1498810..1507143) [8334 bp, 2777 aa] {ON}
           similar to uniprot|Q06179 Saccharomyces cerevisiae
           YLR454W FMP27 The authentic non-tagged protein was
           localized to the mitochondria
          Length = 2777

 Score = 33.1 bits (74), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 5/79 (6%)

Query: 162 IRLEDVSITHMTFGNEFTKAVELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAE 221
           I+L DVSI++    ++ TK++E     Q+ AER++    ++ ++     ++     ES E
Sbjct: 197 IKLRDVSISY----DQLTKSIE-SAYQQKAAERSEAPANESHKDHFQTNMQPVTTGESIE 251

Query: 222 YISKALDKAGDGLLLIRRL 240
           YI   L KA D + +  R 
Sbjct: 252 YIKSLLLKASDFVTMFDRF 270

>TDEL0H00520 Chr8 complement(79507..87273) [7767 bp, 2588 aa] {ON}
            Anc_7.518 YLR454W
          Length = 2588

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 4/45 (8%)

Query: 58   PWLQKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQL 102
            PWL   + YD    P+ +A+N   K+L  VSL   V  RP +  +
Sbjct: 2115 PWLSLDLCYD----PEPLASNAVVKELSAVSLYDNVSQRPTLYNM 2155

>TDEL0B03290 Chr2 complement(581901..587393) [5493 bp, 1830 aa] {ON}
            Anc_8.520 YBR208C
          Length = 1830

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 51/250 (20%), Positives = 94/250 (37%), Gaps = 35/250 (14%)

Query: 28   DVKGGSRAVIFDRISGVKQNIIGEGTHFL-----IPWLQKAIIYDVRTKPKSIATNTGTK 82
            DV G  R  + D +   K  ++G G  FL     +P   +  +   +  P    T  G  
Sbjct: 1562 DVNGIKREEVRDMMYTAKFMVLGLGDVFLGSPCAVPLDPRQRLLGSKYNPSRTYTERGVV 1621

Query: 83   DLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSISNEVLKAIVAQFDAAELITQR 142
             L  + + +     P   QL  + + + + +D+  L S S      ++  FD  E     
Sbjct: 1622 GLGGMYMCIYATSSPGGYQL--VGRTVPI-WDKLTLASSSKHPW--LLTPFDQVEFYPVS 1676

Query: 143  EVVSDRIRAELGRRSNEFGIRLEDVSITHMTF------GNEFTKAVELKQIAQQDAERAK 196
            E   ++   E    S +F   +ED   +H  +        +  +A +  QI ++ AE AK
Sbjct: 1677 EKELEKFTEEC--ESGKFEFEIEDSVFSHKEYLGWIQENIDSIEAFKKSQIGEKSAEFAK 1734

Query: 197  FLVEKAEQERQAAVIRAEGE---AESAEYISKALD--------------KAGDGLLLIRR 239
             +       + +  I+ + E    E AE +                   KAG GL+++  
Sbjct: 1735 LIQAANSDLKSSETIKVQSEETYPEDAELVYSEHSGRFWKPIVSVGDEVKAGQGLIIVEA 1794

Query: 240  LEASKEIAAT 249
            ++    ++AT
Sbjct: 1795 MKTEMTVSAT 1804

>Kwal_33.13186 s33 complement(111561..112799) [1239 bp, 412 aa] {ON}
           YCL029C (BIK1) - Microtubule-binding protein [contig
           121] FULL
          Length = 412

 Score = 30.0 bits (66), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 104 TIYQNLGLDYDERVLPSISNEVLKAIVAQFDAAELITQREVVSDR 148
           T  QN+ +D +ER  PS S+  L+A V Q  + EL   + VVS++
Sbjct: 128 TFSQNMEVDTEERRTPSTSSRELEARVQQ-QSQELSQYKRVVSEQ 171

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,692,293
Number of extensions: 976384
Number of successful extensions: 3379
Number of sequences better than 10.0: 65
Number of HSP's gapped: 3473
Number of HSP's successfully gapped: 65
Length of query: 283
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 175
Effective length of database: 41,097,471
Effective search space: 7192057425
Effective search space used: 7192057425
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)