Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1017.43.496ON1841849801e-137
TPHA0D033003.496ON1961524781e-60
YPR151C (SUE1)3.496ON2061434322e-53
Suva_16.4793.496ON2121434312e-53
SAKL0F02618g3.496ON2531674335e-53
Smik_16.4033.496ON2031434261e-52
Skud_16.4453.496ON2151854156e-51
ZYRO0D09812g3.496ON1851653902e-47
KLLA0E03983g3.496ON1911513823e-46
KNAG0A079603.496ON1771603613e-43
KLTH0F14938g3.496ON2291703593e-42
NDAI0B058903.496ON2781453546e-41
Kwal_55.212483.496ON2221563481e-40
CAGL0L08426g3.496ON1401482551e-27
TDEL0D056403.496ON1241612331e-24
NCAS0F035703.496ON2301472052e-19
TBLA0D029403.496ON71571882e-18
Ecym_12333.496ON87811682e-15
KAFR0G037103.496ON79501439e-12
AFR315C3.496ON77441369e-11
NCAS0C013108.682ON2571601343e-09
Suva_16.1518.682ON2531441301e-08
Kpol_1013.98.682ON2611411203e-07
Smik_6.3568.682ON2531571193e-07
TPHA0D012908.682ON2181461168e-07
TDEL0A062708.682ON2421451168e-07
TPHA0G015708.682ON2551771151e-06
ZYRO0F07480g8.682ON2361511151e-06
Skud_16.1238.682ON2551441151e-06
KNAG0J017608.682ON2581441142e-06
TDEL0E007103.62ON4761501143e-06
YPL159C (PET20)8.682ON2531441123e-06
Kpol_1066.443.62ON4791441063e-05
TBLA0B038008.682ON3241411043e-05
KLLA0A07447g3.62ON4861571054e-05
SAKL0H06380g8.682ON2191531034e-05
KLTH0A01364g3.62ON4761471011e-04
Kpol_1072.128.682ON222144982e-04
KLLA0D06061g8.682ON24977982e-04
CAGL0M02101g8.682ON267164982e-04
KLTH0D11396g8.682ON225160973e-04
NDAI0K013208.682ON25829964e-04
Kwal_26.88288.682ON223144930.001
ZYRO0C02244g3.62ON460160920.002
Suva_14.443.62ON525147910.002
Smik_14.363.62ON524147900.003
YNL295W3.62ON524158890.004
CAGL0M03685g3.62ON493150860.010
TPHA0P012603.62ON494150860.010
TBLA0B085103.62ON501161840.017
KAFR0H023808.682ON22037820.020
Kwal_23.52773.62ON47052820.037
NDAI0A061103.62ON490156810.050
SAKL0C12342g3.62ON552151800.057
Skud_14.423.62ON524156780.12
Kpol_175.1singletonON1377104780.12
NCAS0A099403.62ON494160770.13
Ecym_23908.682ON22728730.34
Skud_11.1602.610ON101729654.9
Suva_14.1982.125ON160898646.8
TPHA0L002204.366ON24086637.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1017.4
         (184 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON} (17411..1...   382   e-137
TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON...   188   1e-60
YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}  ...   171   2e-53
Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {O...   170   2e-53
SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar...   171   5e-53
Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {O...   168   1e-52
Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {O...   164   6e-51
ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar...   154   2e-47
KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar...   151   3e-46
KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {...   143   3e-43
KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa] ...   142   3e-42
NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {...   140   6e-41
Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {O...   138   1e-40
CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} simila...   102   1e-27
TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {...    94   1e-24
NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON...    84   2e-19
TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496...    77   2e-18
Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to ...    69   2e-15
KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}...    60   9e-12
AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON} S...    57   9e-11
NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON...    56   3e-09
Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {O...    55   1e-08
Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON} (15300..1...    51   3e-07
Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C (...    50   3e-07
TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.68...    49   8e-07
TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8....    49   8e-07
TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON...    49   1e-06
ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar...    49   1e-06
Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {O...    49   1e-06
KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.6...    49   2e-06
TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.6...    49   3e-06
YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}  ...    48   3e-06
Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {O...    45   3e-05
TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON...    45   3e-05
KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} simila...    45   4e-05
SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {O...    44   4e-05
KLTH0A01364g Chr1 (126448..127878) [1431 bp, 476 aa] {ON} weakly...    44   1e-04
Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON...    42   2e-04
KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly ...    42   2e-04
CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {...    42   2e-04
KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar...    42   3e-04
NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {O...    42   4e-04
Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C ...    40   0.001
ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa] {...    40   0.002
Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W (...    40   0.002
Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W (...    39   0.003
YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative pro...    39   0.004
CAGL0M03685g Chr13 complement(413333..414814) [1482 bp, 493 aa] ...    38   0.010
TPHA0P01260 Chr16 complement(252274..253758) [1485 bp, 494 aa] {...    38   0.010
TBLA0B08510 Chr2 complement(2036557..2038062) [1506 bp, 501 aa] ...    37   0.017
KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON...    36   0.020
Kwal_23.5277 s23 complement(1088250..1089662) [1413 bp, 470 aa] ...    36   0.037
NDAI0A06110 Chr1 complement(1384706..1386178) [1473 bp, 490 aa] ...    36   0.050
SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]...    35   0.057
Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W (...    35   0.12 
Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON} comp...    35   0.12 
NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa] ...    34   0.13 
Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON} ...    33   0.34 
Skud_11.160 Chr11 (290123..293176) [3054 bp, 1017 aa] {ON} YKL06...    30   4.9  
Suva_14.198 Chr14 complement(357206..362032) [4827 bp, 1608 aa] ...    29   6.8  
TPHA0L00220 Chr12 (23667..24389) [723 bp, 240 aa] {ON} Anc_4.366...    29   7.7  

>Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON}
           (17411..17965) [555 nt, 185 aa]
          Length = 184

 Score =  382 bits (980), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 184/184 (100%), Positives = 184/184 (100%)

Query: 1   MNTVLKFQRYSYVRCYSSTPIRFMKRKMSSDTEHIFRSLPRVPTTQFLESTTLTNDILFS 60
           MNTVLKFQRYSYVRCYSSTPIRFMKRKMSSDTEHIFRSLPRVPTTQFLESTTLTNDILFS
Sbjct: 1   MNTVLKFQRYSYVRCYSSTPIRFMKRKMSSDTEHIFRSLPRVPTTQFLESTTLTNDILFS 60

Query: 61  GYRPITYPVKENPLFRNTGNTKNIFGQDLVNAESNSNDASLLQEHDKNITSQEFNTLSGD 120
           GYRPITYPVKENPLFRNTGNTKNIFGQDLVNAESNSNDASLLQEHDKNITSQEFNTLSGD
Sbjct: 61  GYRPITYPVKENPLFRNTGNTKNIFGQDLVNAESNSNDASLLQEHDKNITSQEFNTLSGD 120

Query: 121 RGTGGIKSGGVNGTWRFNPRVPSKLLPYSWWSTSIMGMEYYPEWKNIPRKVVKDLKPYQL 180
           RGTGGIKSGGVNGTWRFNPRVPSKLLPYSWWSTSIMGMEYYPEWKNIPRKVVKDLKPYQL
Sbjct: 121 RGTGGIKSGGVNGTWRFNPRVPSKLLPYSWWSTSIMGMEYYPEWKNIPRKVVKDLKPYQL 180

Query: 181 VDKE 184
           VDKE
Sbjct: 181 VDKE 184

>TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON}
           Anc_3.496 YPR151C
          Length = 196

 Score =  188 bits (478), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 114/152 (75%), Gaps = 7/152 (4%)

Query: 29  SSDTEHIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQD 88
           S+    IF++LPRVPTT++LEST LTNDILFSGYRPITYPVKENPLFRN     N F   
Sbjct: 44  SATFNSIFKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDF--- 100

Query: 89  LVNAESNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPY 148
           L   E+   +  +L + +     + F+ L+G++GTGGI SGGVNGTW++NP VP  LLPY
Sbjct: 101 LSTQETQEKNNPVLPQKNH----EAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPY 156

Query: 149 SWWSTSIMGMEYYPEWKNIPRKVVKDLKPYQL 180
           +WWSTSIMGMEYYPEW N+PR+ +K LKP+++
Sbjct: 157 NWWSTSIMGMEYYPEWNNVPRRFLKTLKPFEV 188

>YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}
           SUE1Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 206

 Score =  171 bits (432), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 80/143 (55%), Positives = 109/143 (76%), Gaps = 8/143 (5%)

Query: 36  FRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQDLVNAESN 95
           FRSLP+VPTTQ+LE+  LT DIL+SGYRP+ YPVKENPLFR+    K++     +N ++N
Sbjct: 55  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKR-KSLQTLLTMNEKTN 113

Query: 96  SNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYSWWSTSI 155
           +   ++ ++  KNI       L G+RGTGGI SGGVNGTW++NP VP++LLP++WWSTS 
Sbjct: 114 AEAKTIDEKKHKNI-------LFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSS 166

Query: 156 MGMEYYPEWKNIPRKVVKDLKPY 178
           MGMEY+PEWKN+P  +++ LKP+
Sbjct: 167 MGMEYFPEWKNVPPYMMRKLKPF 189

>Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {ON}
           YPR151C (REAL)
          Length = 212

 Score =  170 bits (431), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 80/143 (55%), Positives = 104/143 (72%), Gaps = 8/143 (5%)

Query: 36  FRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQDLVNAESN 95
           FRSLP+VPTTQ+LE+  LT DIL+SGYRP+ YPVKENPLFR+    K      L + E  
Sbjct: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRD--KKKKSLQMLLASDEKP 119

Query: 96  SNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYSWWSTSI 155
           + +A   ++      S+  N   G+RGTGGI SGGVNGTW++NP VP++LLPY+WWSTS 
Sbjct: 120 ATEAKATEK------SEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSS 173

Query: 156 MGMEYYPEWKNIPRKVVKDLKPY 178
           MGMEY+PEWKN+P  +++ LKP+
Sbjct: 174 MGMEYFPEWKNVPSYMMRKLKPF 196

>SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar to
           uniprot|Q06524 Saccharomyces cerevisiae YPR151C SUE1
           Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 253

 Score =  171 bits (433), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 109/167 (65%), Gaps = 11/167 (6%)

Query: 14  RCYSSTPIRFMKRKMSSDTEHIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENP 73
           R +S+T    +K+K S     IFR LP+VPTTQFLE   LT DILFSGYRP+TYPVKENP
Sbjct: 5   RLFSTTATNMIKKKNSD----IFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENP 60

Query: 74  LFRNTGNTKNIFGQDLVNAESNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNG 133
            F      K + G+     E  +      ++ + N+       ++G RGTGGI SGGVNG
Sbjct: 61  FFNIGTQRKGLAGETSAKKEYKNEAERENEKEEHNV-------MAGPRGTGGIVSGGVNG 113

Query: 134 TWRFNPRVPSKLLPYSWWSTSIMGMEYYPEWKNIPRKVVKDLKPYQL 180
           TWR+NPR+P+KLLPY+ WS+S M MEYYPEW N+P+ +   LKP+ +
Sbjct: 114 TWRYNPRIPTKLLPYNLWSSSTMAMEYYPEWLNVPKTIANKLKPFDM 160

>Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {ON}
           YPR151C (REAL)
          Length = 203

 Score =  168 bits (426), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 104/143 (72%), Gaps = 8/143 (5%)

Query: 36  FRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQDLVNAESN 95
           FRSLP+VPTTQ+LE+  LT DIL+SGYRP+ YPVKENPLFR+    K    Q L+ A   
Sbjct: 53  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDK---KKKSLQMLLTA--- 106

Query: 96  SNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYSWWSTSI 155
             D + + E      S+  N L G+RGTGGI SGGVNGTW++NP VP++LLP++WWSTS 
Sbjct: 107 --DEAPITEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSS 164

Query: 156 MGMEYYPEWKNIPRKVVKDLKPY 178
           MGMEY+PEW+NIP  + + LKP+
Sbjct: 165 MGMEYFPEWRNIPSYMTRKLKPF 187

>Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {ON}
           YPR151C (REAL)
          Length = 215

 Score =  164 bits (415), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 120/185 (64%), Gaps = 19/185 (10%)

Query: 3   TVLKFQRYSYVRCYSSTPIRFMKRKMSSDTE---------HIFRSLPRVPTTQFLESTTL 53
           T+ + QR ++ R  +  PIR   ++++             + FRSLP+VPTTQ+LE+  L
Sbjct: 22  TLARIQRRTHTRLVN--PIRQQHQQITKQRSSKIFKNVHFYDFRSLPKVPTTQYLEAREL 79

Query: 54  TNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQDLVNAESNSNDASLLQEHDKNITSQE 113
           T DIL+SGYRP+ YPVKENPLFR+    K    Q L+  +      +   E D +     
Sbjct: 80  TRDILYSGYRPVMYPVKENPLFRDK---KRDSLQMLLAPDEAPAAEAKATEKDMHK---- 132

Query: 114 FNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYSWWSTSIMGMEYYPEWKNIPRKVVK 173
            N L G+RGTGGI SGGVNGTW++NP VP++LLP++WWSTS MGMEY+PEWKN+P  +++
Sbjct: 133 -NVLFGERGTGGISSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPEWKNVPSYMMR 191

Query: 174 DLKPY 178
            LKP+
Sbjct: 192 KLKPF 196

>ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar to
           gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g and
           weakly similar to YPR151C uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 185

 Score =  154 bits (390), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 115/165 (69%), Gaps = 4/165 (2%)

Query: 14  RCYSSTPIRFMKRKMSSDTEHIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENP 73
           R +S+  IR  KRK  S    IFRS+PRVPTTQFLES  LT DILFSGYRP+ YPVKENP
Sbjct: 5   RLFSTATIRSFKRKCCSS--DIFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENP 62

Query: 74  LFRNTGNTKNIFGQDLVNAESNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNG 133
           LF+    T+N    D + +  NS       + ++  + +E++ ++G RG GGI SGG +G
Sbjct: 63  LFKE--RTRNGELTDELQSRHNSGLRQGRTQEEEKESGEEYSVIAGPRGCGGIASGGASG 120

Query: 134 TWRFNPRVPSKLLPYSWWSTSIMGMEYYPEWKNIPRKVVKDLKPY 178
           TWR   ++PSKLLPYSWWST+ MGME++PEW+ +PR VV+ LKP+
Sbjct: 121 TWRNGAKMPSKLLPYSWWSTTSMGMEFFPEWEGVPRHVVRKLKPF 165

>KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar to
           gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g and
           weakly similar to YPR151C uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 191

 Score =  151 bits (382), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 75/151 (49%), Positives = 95/151 (62%), Gaps = 8/151 (5%)

Query: 30  SDTEHIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQDL 89
           S    ++R LPRVPTT+FL    LT DILFSGYRPI  P+++NPLF+     K +     
Sbjct: 6   SKATQMYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQ--AKVKEL----- 58

Query: 90  VNAESNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYS 149
              E   N    L+      +  E   ++G  GTGGI SGGVNGTWR+NPR+P+KLL  +
Sbjct: 59  -EVEREKNGGGKLKSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSA 117

Query: 150 WWSTSIMGMEYYPEWKNIPRKVVKDLKPYQL 180
            WS+S MGME+YPEW ++P KV   LKPYQL
Sbjct: 118 LWSSSAMGMEFYPEWNDVPNKVSASLKPYQL 148

>KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {ON}
           Anc_3.496 YPR151C
          Length = 177

 Score =  143 bits (361), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 73/160 (45%), Positives = 97/160 (60%), Gaps = 23/160 (14%)

Query: 29  SSDTEHIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQD 88
           + D   +FR LP+VP T++LE+  L  DIL+SGYRP+ YPV+ENPLFRN           
Sbjct: 25  NGDGRSMFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRN----------- 73

Query: 89  LVNAESNSNDASLLQEHDKNIT------SQEFNT-LSGDRGTGGIKSGGVNGTWRFNPRV 141
                SN   A    EHD   T      SQ  NT L G+   GGI + G NGTW++ P++
Sbjct: 74  -----SNKLMAISHPEHDTEGTEGTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKI 128

Query: 142 PSKLLPYSWWSTSIMGMEYYPEWKNIPRKVVKDLKPYQLV 181
           P K+LP++WWS S + ME YPEW ++P+ VVK LKP+ L+
Sbjct: 129 PQKMLPFNWWSASSLAMEVYPEWSSVPKHVVKGLKPFDLL 168

>KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa]
           {ON} weakly similar to uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 229

 Score =  142 bits (359), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 86/170 (50%), Positives = 113/170 (66%), Gaps = 17/170 (10%)

Query: 11  SYVRCYSSTPIRFMKRKMSSDTEHIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVK 70
           ++ R +S    + +KRK S     IFRSLP+VPTTQ+LE   LT DIL+SGYRP+ YPVK
Sbjct: 2   AHKRQFSLEASKMLKRKSS----EIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVK 57

Query: 71  ENPLFRNTG-NTKNIFGQDLVNAESNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSG 129
           ENPLF+  G  T+ + G      E  +  +S + +      S E N ++G  GTGGI SG
Sbjct: 58  ENPLFKEAGWKTQRLRG------ERGARKSSTVPQ------SSEMNAMAGPLGTGGIGSG 105

Query: 130 GVNGTWRFNPRVPSKLLPYSWWSTSIMGMEYYPEWKNIPRKVVKDLKPYQ 179
           GVNGTWR+NPR+PSKLLPY+ WS + M MEY+PEW  +PR VV  L+P++
Sbjct: 106 GVNGTWRYNPRIPSKLLPYNLWSCTSMAMEYHPEWLAVPRTVVNKLRPFE 155

>NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {ON}
           Anc_3.496 YPR151C
          Length = 278

 Score =  140 bits (354), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 72/145 (49%), Positives = 97/145 (66%), Gaps = 8/145 (5%)

Query: 34  HIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQDLVNAE 93
           +IFR++P+VP T++LE+  L+ D+L+SGYRPI YPVKENPLFR T        ++  ++ 
Sbjct: 127 NIFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLT------LKKNSSSSF 180

Query: 94  SNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYSWWST 153
             S  +S   E  K    QE      D   GGI +GG+NGTWR++PR+P+ LLP   WS 
Sbjct: 181 PFSTTSSSSSEKKK--PQQEQMKKHYDDEYGGIMTGGINGTWRYSPRIPNNLLPNKIWSM 238

Query: 154 SIMGMEYYPEWKNIPRKVVKDLKPY 178
           SIMGMEYYPEWK +P  +VK+LKP+
Sbjct: 239 SIMGMEYYPEWKGVPFNIVKNLKPF 263

>Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {ON}
           YPR151C - Hypothetical ORF [contig 130] FULL
          Length = 222

 Score =  138 bits (348), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 84/156 (53%), Positives = 108/156 (69%), Gaps = 16/156 (10%)

Query: 24  MKRKMSSDTEHIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKN 83
           M ++ SSD   IFRSLP+VPTTQ+LE   LT DIL+SGYRP+ YPVKENPLF+ TG    
Sbjct: 14  MLKRRSSD---IFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETG---- 66

Query: 84  IFGQDLVNAESNSNDA-SLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVP 142
            +    +  E  S+ A +  +E  KN        ++G +GTGGI SGGVNGTWR+NPR+P
Sbjct: 67  -WKTQRLREEPGSDTALTAAKESSKN-------AMAGPQGTGGIGSGGVNGTWRYNPRIP 118

Query: 143 SKLLPYSWWSTSIMGMEYYPEWKNIPRKVVKDLKPY 178
           SKLLP+S WS++ M MEY+PEW  +PR VV  L+P+
Sbjct: 119 SKLLPFSLWSSTSMAMEYHPEWLAVPRTVVNKLRPF 154

>CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} similar
           to uniprot|Q06524 Saccharomyces cerevisiae YPR151c
          Length = 140

 Score =  102 bits (255), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 86/148 (58%), Gaps = 19/148 (12%)

Query: 34  HIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQDLVNAE 93
            IFR LP+VP T++LE+  L+ D+L++GYRPI YP++ENPL  ++    N+         
Sbjct: 6   EIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHS----NVRETHYYGES 61

Query: 94  SNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYSWWST 153
           SN      LQ+ D+   ++    L G  G GGI + GV          PSK+      S 
Sbjct: 62  SNE-----LQKKDEEPVNE---LLYGPEGRGGISTMGVRRMAD-----PSKV--KLGLSY 106

Query: 154 SIMGMEYYPEWKNIPRKVVKDLKPYQLV 181
           SIMGMEYYPEW+ +PR VVK +KPY+++
Sbjct: 107 SIMGMEYYPEWEKVPRDVVKRIKPYEVM 134

>TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {ON}
           Anc_3.496 YPR151C
          Length = 124

 Score = 94.4 bits (233), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/161 (36%), Positives = 78/161 (48%), Gaps = 56/161 (34%)

Query: 18  STPIRFMKRKMSSDTEHIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRN 77
           ST  R  +RK  S T+ +FR+LPRVPTT+FLE+  L++DILFSGYRP+ YPV+ENPLF  
Sbjct: 15  STSSRVWRRK--SVTDDLFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLF-- 70

Query: 78  TGNTKNIFGQDLVNAESNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRF 137
                                                      RGT       +      
Sbjct: 71  ------------------------------------------GRGTKTEAPASLE----- 83

Query: 138 NPRVPSKLLPYSWWSTSIMGMEYYPEWKNIPRKVVKDLKPY 178
                S L  Y  WST+ MG+E +PEW N+PR+VV+ L+P+
Sbjct: 84  -----SNLPRYDLWSTTTMGLERFPEWSNVPREVVRKLRPF 119

>NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON}
           Anc_3.496 YPR151C
          Length = 230

 Score = 83.6 bits (205), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 70/147 (47%), Gaps = 44/147 (29%)

Query: 32  TEHIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQDLVN 91
           + +IFR LP+VP T++LE+  L+ +ILF+GY+PI YPV+ENPLF+               
Sbjct: 114 SNNIFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFK--------------- 158

Query: 92  AESNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYSWW 151
                    + QE  K     E       R  G   S    G                 W
Sbjct: 159 -------LKIKQEDAKRENGNE------KRALGSSVSHKYKGI----------------W 189

Query: 152 STSIMGMEYYPEWKNIPRKVVKDLKPY 178
           STSI+G++ YPEW N+P   +K+LKP+
Sbjct: 190 STSILGLQDYPEWNNVPWNNIKNLKPF 216

>TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496
          YPR151C
          Length = 71

 Score = 77.0 bits (188), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 33/57 (57%), Positives = 46/57 (80%)

Query: 21 IRFMKRKMSSDTEHIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRN 77
          ++ +K+ +  +++ + R LPRVPTT++LE+T L NDI FSGYRP+ YPVKENPLFRN
Sbjct: 1  MQALKQVVVRNSKSVLRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRN 57

>Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to
           Ashbya gossypii AFR315C
          Length = 87

 Score = 69.3 bits (168), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 38/81 (46%), Positives = 48/81 (59%), Gaps = 13/81 (16%)

Query: 35  IFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIF--------- 85
           I R LPRVPTTQ+L    L  DI FSGYRP+ YPVK+NPLFR   ++KNI          
Sbjct: 9   ILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFR---SSKNILESSIGKGLG 65

Query: 86  -GQDLVNAESNSNDASLLQEH 105
             +D  NA +  + AS ++ H
Sbjct: 66  RDKDKGNAGNGCSGASSVRGH 86

>KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}
          Anc_3.496 YPR151C
          Length = 79

 Score = 59.7 bits (143), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 38/50 (76%), Gaps = 1/50 (2%)

Query: 35 IFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENP-LFRNTGNTKN 83
          + ++LPRVPTT++L+ + L  DIL++GYRP+ YP+KENP L+R  G   N
Sbjct: 7  LCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLLYRQNGELAN 56

>AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YPR151C
          (SUE1)
          Length = 77

 Score = 57.0 bits (136), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 25/44 (56%), Positives = 32/44 (72%)

Query: 33 EHIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFR 76
          +  FR LPRVP+TQ L +  +  DILFS +RP+TYPV +NPL R
Sbjct: 4  QQFFRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIR 47

>NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON}
           Anc_8.682
          Length = 257

 Score = 56.2 bits (134), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 71/160 (44%), Gaps = 41/160 (25%)

Query: 20  PIRFMKRKMSSDTEHIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTG 79
           PI   ++K   D    + +LP+V     L    ++ DIL+SGYRP+    K+     N+ 
Sbjct: 75  PIHIQRKKKRFD----YSTLPKVEPITNLRHNEISTDILYSGYRPLFLNFKD---LENSS 127

Query: 80  NTKNIFGQDLVNAESNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNP 139
             K  FG        NSN+++L +       + + + LS +  +G   S           
Sbjct: 128 R-KAEFG--------NSNNSTLYE------IAMKLDDLSPEAISGSTSSNF--------- 163

Query: 140 RVPSKLLPYSWWSTSIMGMEYYPEWKNIPRKVVKDLKPYQ 179
                     W STS  GME + EW N+P  ++K+LKP+Q
Sbjct: 164 ----------WHSTSATGMEVFDEWDNVPNSILKNLKPFQ 193

>Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {ON}
           YPL159C (REAL)
          Length = 253

 Score = 54.7 bits (130), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 61/144 (42%), Gaps = 52/144 (36%)

Query: 36  FRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQDLVNAESN 95
           F  LPRVP+T  L+ + +T ++L+SGYRPI                             N
Sbjct: 100 FSWLPRVPSTSHLKHSDMTTNVLYSGYRPIFI---------------------------N 132

Query: 96  SNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYSWWSTSI 155
            ND  L  + D   T  EF           +K   +N              P S W +S 
Sbjct: 133 PNDPKL--KEDTGSTLYEF----------AMKLDDLNE-------------PLSPWISSA 167

Query: 156 MGMEYYPEWKNIPRKVVKDLKPYQ 179
            G+E++ EW+NIP +++K+LKP+ 
Sbjct: 168 TGLEFFSEWENIPSELLKNLKPFH 191

>Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON}
           (15300..16085) [786 nt, 262 aa]
          Length = 261

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 54/141 (38%), Gaps = 49/141 (34%)

Query: 39  LPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQDLVNAESNSND 98
           LP+VP+T+ L    +    L+SGYRPI                        +N++     
Sbjct: 112 LPKVPSTENLNHREIRTSALYSGYRPI-----------------------YINSKG---- 144

Query: 99  ASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYSWWSTSIMGM 158
                              SG     G    GVN T+     +  KL   S W +S  GM
Sbjct: 145 -------------------SGKNKLSGTMKNGVNSTFY---EIAMKLENPSPWMSSATGM 182

Query: 159 EYYPEWKNIPRKVVKDLKPYQ 179
           E Y EW ++P  V+KDLKP+ 
Sbjct: 183 ELYSEWDHVPLDVLKDLKPFH 203

>Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C
           (REAL)
          Length = 253

 Score = 50.4 bits (119), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 65/157 (41%), Gaps = 56/157 (35%)

Query: 23  FMKRKMSSDTEHIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTK 82
           F  +K  SD    F  LP+VP+T  L+ + +T ++L+SGYRP+                 
Sbjct: 91  FNSKKKRSD----FSWLPKVPSTSHLKQSDMTTNVLYSGYRPLFI--------------- 131

Query: 83  NIFGQDLVNAESNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVP 142
                       N ND  L  + D   T  EF           +K   +N          
Sbjct: 132 ------------NPNDPKL--KEDTGSTLYEF----------AMKLEDLNE--------- 158

Query: 143 SKLLPYSWWSTSIMGMEYYPEWKNIPRKVVKDLKPYQ 179
               P S W +S  G+E++ EW NIP +++++LKP+ 
Sbjct: 159 ----PLSPWISSATGLEFFSEWDNIPSELLRNLKPFH 191

>TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.682
           YPL159C
          Length = 218

 Score = 49.3 bits (116), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 58/146 (39%), Gaps = 46/146 (31%)

Query: 39  LPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQDLVNAESNSND 98
           LP+VP T  +    +T + L+SGYRP+    K+  L                        
Sbjct: 95  LPKVPQTSSITHREITTNSLYSGYRPLFIDNKKGTLL----------------------- 131

Query: 99  ASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYSWWSTSIMGM 158
                  D N T+Q+ N+                  + F  ++ ++L   S W  S  G+
Sbjct: 132 ------GDVNSTAQDANS----------------SIYEFAMKL-NELSEPSPWMMSATGL 168

Query: 159 EYYPEWKNIPRKVVKDLKPYQLVDKE 184
           E Y EW  +P KV+K LKPY L  KE
Sbjct: 169 ESYSEWDYVPSKVIKKLKPYDLSIKE 194

>TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8.682
           YPL159C
          Length = 242

 Score = 49.3 bits (116), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 58/145 (40%), Gaps = 50/145 (34%)

Query: 34  HIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQDLVNAE 93
           H +  LPRVP+T  L+   ++  +L+SGYRP         LF                  
Sbjct: 91  HDYSWLPRVPSTGNLKPRDMSMKVLYSGYRP---------LF------------------ 123

Query: 94  SNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYSWWST 153
                          I   E  T S   GTGG         + F  ++  +L   S W T
Sbjct: 124 ---------------INPDEIKTSSEGSGTGGT-------LYEFAMKL-EELGDQSPWVT 160

Query: 154 SIMGMEYYPEWKNIPRKVVKDLKPY 178
           S  G+EYY EW +IP ++ K LKP+
Sbjct: 161 SATGLEYYREWDSIPGELQKKLKPF 185

>TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON}
           Anc_8.682 YPL159C
          Length = 255

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 67/177 (37%), Gaps = 52/177 (29%)

Query: 6   KFQRYSYVRCYSSTPIRFMKRKMSSDTEHI---FRSLPRVPTTQFLESTTLTNDILFSGY 62
           KFQ +     Y + P+       +++ + I   + SLP+ PTT  L S+    D+ +SGY
Sbjct: 70  KFQSHLIHNKYPTLPLLHPTSTTTAEAKQIKFDYSSLPKAPTTHHLHSSEFNTDLFYSGY 129

Query: 63  RPITYPVKENPLFRNTGNTKNIFGQDLVNAESNSNDASLLQEHDKNITSQEFNTLSGDRG 122
           RP++  V +                             L  E +   T  E  +LS D  
Sbjct: 130 RPLSIDVNQ-----------------------------LASEQENPCTCYEI-SLSMDIV 159

Query: 123 TGGIKSGGVNGTWRFNPRVPSKLLPYSWWSTSIMGMEYYPEWKNIPRKVVKDLKPYQ 179
              +K   V+  W F                S  G E Y EW NIP+ V+ +LK + 
Sbjct: 160 KKNLK---VSTPWLF----------------SATGSELYKEWDNIPKSVLDNLKCFH 197

>ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 236

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 62/151 (41%), Gaps = 53/151 (35%)

Query: 39  LPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQDLVNAESNSND 98
           LPRVP+T +L    +++ IL+SGYR         PLF N    K                
Sbjct: 88  LPRVPSTNYLRPRDMSSKILYSGYR---------PLFLNPDELK---------------- 122

Query: 99  ASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYSWWSTSIMGM 158
                      TSQ+          GG  + G    + F  ++  +L   S W++S  G 
Sbjct: 123 -----------TSQD----------GGNANNGAR-LYEFAMKL-EELGEQSLWTSSATGQ 159

Query: 159 EYYPEWKNIPRKVVKDLKPYQL-----VDKE 184
           E YPEW  +P +V + LKP+       VDKE
Sbjct: 160 EIYPEWDYVPMEVQRKLKPFNAPAPFNVDKE 190

>Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {ON}
           YPL159C (REAL)
          Length = 255

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 61/144 (42%), Gaps = 52/144 (36%)

Query: 36  FRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQDLVNAESN 95
           F  LPRVP+T  L+ T +T ++L+SGYRP+                             N
Sbjct: 100 FSWLPRVPSTSHLKHTDMTTNVLYSGYRPLFI---------------------------N 132

Query: 96  SNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYSWWSTSI 155
            ND  L  + D   T  EF           +K   +N      P  P       W S S 
Sbjct: 133 PNDPKL--KEDTGSTLYEF----------AMKLEDLN-----EPLSP-------WIS-SA 167

Query: 156 MGMEYYPEWKNIPRKVVKDLKPYQ 179
            G+E++ EW+NIP +++K+LKP+ 
Sbjct: 168 TGLEFFSEWENIPSELLKNLKPFH 191

>KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.682
           YPL159C
          Length = 258

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 56/144 (38%), Gaps = 43/144 (29%)

Query: 36  FRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQDLVNAESN 95
           +  LP VP+TQ +E+  +  ++L+SGYRP         LF ++                 
Sbjct: 93  YHPLPSVPSTQHIEANDMCTELLYSGYRP---------LFLDS----------------- 126

Query: 96  SNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLL-PYSWWSTS 154
                         T+ E   L+        +S    G+  +   +  KL  P   W+ S
Sbjct: 127 --------------TALERGLLAAKEQASFTQSASPTGSTFYE--IAMKLEDPACIWANS 170

Query: 155 IMGMEYYPEWKNIPRKVVKDLKPY 178
             G+E Y EW NIP  V   LKP+
Sbjct: 171 ATGLEKYTEWDNIPYSVANSLKPF 194

>TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.62
           YNL295W
          Length = 476

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 68/150 (45%), Gaps = 23/150 (15%)

Query: 39  LPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNI--FGQDLVNAESNS 96
           LPRVP+T ++ +T +  + LF+GYRP+      N   R    T  +  F     N +  S
Sbjct: 75  LPRVPSTDYIPNTEVQTEGLFAGYRPLFLG---NSSLRPETRTNALDNFFTSFANLKVTS 131

Query: 97  NDASLLQEHDKNITSQEFNTLSGDRGTGGIK-SGGVNGTWRFNPRVPSKLLPYSWWSTSI 155
              +  +E  +++  +    L  D     +K S G N      P +P        W  SI
Sbjct: 132 ESKNSAEEEVQDVIEE----LKRDSAQLNLKNSKGKNR----KPIIP--------WDASI 175

Query: 156 MGMEYYPE-WKNIPRKVVKDLKPYQLVDKE 184
            GM Y    +K++P+ VV  LKP+++V  E
Sbjct: 176 SGMVYNDHSFKDVPKSVVSKLKPFKMVKLE 205

>YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}
           PET20Mitochondrial protein, required for respiratory
           growth under some conditions and for stability of the
           mitochondrial genome
          Length = 253

 Score = 47.8 bits (112), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 60/144 (41%), Gaps = 52/144 (36%)

Query: 36  FRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQDLVNAESN 95
           F  LPRVP+T  L+ + +T ++L+SGYRP+     +  L  +TG+T   F   L      
Sbjct: 100 FSWLPRVPSTSHLKQSDMTTNVLYSGYRPLFINPNDPKLKEDTGSTLYEFAMKL------ 153

Query: 96  SNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYSWWSTSI 155
                           ++ N                       P  P       W S S 
Sbjct: 154 ----------------EDLN----------------------EPLSP-------WIS-SA 167

Query: 156 MGMEYYPEWKNIPRKVVKDLKPYQ 179
            G+E++ EW+NIP +++K+LKP+ 
Sbjct: 168 TGLEFFSEWENIPSELLKNLKPFH 191

>Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {ON}
           complement(74670..76109) [1440 nt, 480 aa]
          Length = 479

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 61/144 (42%), Gaps = 14/144 (9%)

Query: 39  LPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQDLVNAESNSND 98
           LPRVP+T+ +    +  D LF+GYRP+           N        G +L    ++ +D
Sbjct: 74  LPRVPSTENIPVEEVQTDGLFAGYRPL--------FLGNCPIDDAEKGSELDRFLASFSD 125

Query: 99  ASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYSWWSTSIMGM 158
             LL   D +  S+E                  N     N R    ++P   W  SI G+
Sbjct: 126 LKLLNNEDSD--SKEVKIEDILEDIQNDIRNATNEDIGDNSRTRKPVVP---WDASISGL 180

Query: 159 EYYPE-WKNIPRKVVKDLKPYQLV 181
            Y    +KNIP +VV  LKP++L+
Sbjct: 181 IYNDRPFKNIPNEVVSKLKPFKLI 204

>TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON}
           Anc_8.682 YPL159C
          Length = 324

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 63/141 (44%), Gaps = 44/141 (31%)

Query: 39  LPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQDLVNAESNSND 98
           LP+VPT + L+   +  ++L+SGYRP++        F+   +  NI+     +  S+ N 
Sbjct: 167 LPKVPTLKNLKQRDVMTNVLYSGYRPLSID------FKALNDPTNIY-----DPYSSPNG 215

Query: 99  ASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYSWWSTSIMGM 158
           +S L E      + +  +LS                         ++ P   W +S  G+
Sbjct: 216 SSTLYEF-----AMQLQSLS-------------------------EIFP---WMSSAAGL 242

Query: 159 EYYPEWKNIPRKVVKDLKPYQ 179
           E Y EW +IP +V+K LKP Q
Sbjct: 243 EVYSEWDSIPIEVLKKLKPLQ 263

>KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} similar
           to uniprot|P48564 Saccharomyces cerevisiae YNL295W
          Length = 486

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 72/157 (45%), Gaps = 45/157 (28%)

Query: 39  LPRVPTTQFLESTTLTNDILFSGYRPI---TYPVKEN-------PLFRNTGNTKNIFGQD 88
           +P+VP+T +L    L  + LF+GY+P+     P++ N        LF +    KN     
Sbjct: 90  VPQVPSTDYLPREDLETEGLFAGYKPLFLGNSPLESNNNDVLLDGLFSSIRKLKNA---- 145

Query: 89  LVNAESNSND---ASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKL 145
            +N+E+N+ +   + +L +  K+  +QE+  L                     P++P   
Sbjct: 146 QINSENNTVEIDVSDMLDDLKKD--NQEYQRLHEK-----------------APKIP--- 183

Query: 146 LPYSWWSTSIMGMEYYPE-WKNIPRKVVKDLKPYQLV 181
                W  SI G+ Y  E +K +PR VV  LKP++LV
Sbjct: 184 -----WDASISGLVYNDEPFKGVPRSVVSKLKPFKLV 215

>SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {ON}
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 219

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 61/153 (39%), Gaps = 56/153 (36%)

Query: 27  KMSSDTEHIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFG 86
           ++S    H +  LP+ P+T+ L+   ++ D+ +SGYR         P+F N  + K    
Sbjct: 71  ELSGKKRHDYSWLPKAPSTEHLKLREISTDVFYSGYR---------PIFLNPASPK---- 117

Query: 87  QDLVNAESNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLL 146
                 ES S             T  EF           +K   +         +P    
Sbjct: 118 ------ESES-------------TLYEF----------AMKLEALGDP------IP---- 138

Query: 147 PYSWWSTSIMGMEYYPEWKNIPRKVVKDLKPYQ 179
               W +S  G E+Y EW N+P +V+K LKP+Q
Sbjct: 139 ----WVSSATGTEFYGEWDNVPTEVIKKLKPFQ 167

>KLTH0A01364g Chr1 (126448..127878) [1431 bp, 476 aa] {ON} weakly
           similar to uniprot|P48564 Saccharomyces cerevisiae
           YNL295W Hypothetical ORF
          Length = 476

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 64/147 (43%), Gaps = 18/147 (12%)

Query: 39  LPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQDLVNAESNSND 98
           +P+V +T  ++   +  + LF+G +P+          R +G    IFG  L   +  ++D
Sbjct: 86  VPKVHSTDHIKQDEIHTEGLFAGNKPLFLGELSLSFKRPSGALDGIFGT-LTKIKRATDD 144

Query: 99  ASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYSWWSTSIMGM 158
               QE D      +  T     G   I SG  +   R  P +P        W  SI GM
Sbjct: 145 GGD-QEIDVQGIINDLQT-----GDKDISSGEKSAAKR--PVIP--------WDASISGM 188

Query: 159 EYYPE-WKNIPRKVVKDLKPYQLVDKE 184
            Y  + +K +PR VV  LKP++L+  E
Sbjct: 189 VYNDQPFKQVPRGVVNKLKPFKLLKIE 215

>Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON}
           complement(24362..25030) [669 nt, 223 aa]
          Length = 222

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 58/144 (40%), Gaps = 49/144 (34%)

Query: 39  LPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQDLVNAESNSND 98
           LP+VP+ + L    +T DI +SG+RP++                               D
Sbjct: 97  LPKVPSNKRLTHQDITTDIFYSGFRPLSI------------------------------D 126

Query: 99  ASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYSWWSTSIMGM 158
            + L+  D++ ++    +L+ D     +   G N                S W++S  GM
Sbjct: 127 PTELENKDEDSSTWYEVSLTLD---SPVPPSGHN----------------SIWTSSATGM 167

Query: 159 EYYPEWKNIPRKVVKDLKPYQLVD 182
           E Y EW ++P +V+  L P+Q  D
Sbjct: 168 ERYREWHSVPEEVINSLTPFQPPD 191

>KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 249

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 107 KNITSQEFNT---LSGDRG-TGGIKSGGVNGTWRFNPRVPSKLLPYSWWSTSIMGMEYYP 162
           ++I  +EFN+    SG R    G K+   N   +F  ++     P  W S++  G E++ 
Sbjct: 119 EHILREEFNSDMLYSGYRPIVVGDKNAKENKLMQFAMKLEKLSEPVPWVSSAT-GQEFFS 177

Query: 163 EWKNIPRKVVKDLKPYQ 179
           EW N+P +++KDLKP+ 
Sbjct: 178 EWDNVPSEIIKDLKPFH 194

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 33/59 (55%), Gaps = 7/59 (11%)

Query: 21  IRFMKRKMSSDTEHIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYP---VKENPLFR 76
           I+   +K+S D    +  LPRVPTT+ +      +D+L+SGYRPI       KEN L +
Sbjct: 98  IKMATKKLSRD----YSWLPRVPTTEHILREEFNSDMLYSGYRPIVVGDKNAKENKLMQ 152

>CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {ON}
           some similarities with uniprot|Q99373 Saccharomyces
           cerevisiae YPL159c
          Length = 267

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 61/164 (37%), Gaps = 56/164 (34%)

Query: 17  SSTPIRFMKRKMSSDTEHIF--RSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPL 74
           +   +R +K + +   + ++   +LPRV      +   ++ ++L+SGYRP+ + V     
Sbjct: 92  AGGAVRDLKSEKAQTKKKVYDYSTLPRVEQISDTKLKNMSTEVLYSGYRPLFFDV----- 146

Query: 75  FRNTGNTKNIFGQDLVNAESNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGT 134
                                           KN  SQE  TL                 
Sbjct: 147 ------------------------------EPKN--SQEGKTL----------------- 157

Query: 135 WRFNPRVPSKLLPYSWWSTSIMGMEYYPEWKNIPRKVVKDLKPY 178
           + F  ++       S W +S  G E Y EW N+P  V+KDLKP+
Sbjct: 158 YEFAMKLEEFQEAMSPWVSSATGSEMYAEWDNVPGDVIKDLKPF 201

>KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 225

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 60/160 (37%), Gaps = 61/160 (38%)

Query: 25  KRKMSSDTEHIFRS-----LPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTG 79
           K++M+S+     R      LP+ P+T  L+   ++  +L+SGYRP               
Sbjct: 66  KKRMASELRGKQRKTDFSWLPKAPSTDHLKHRDVSTTLLYSGYRPFV------------- 112

Query: 80  NTKNIFGQDLVNAESNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNP 139
                    L ++E    D++L                                 + F  
Sbjct: 113 ---------LNSSEQKQTDSTL---------------------------------YEFAM 130

Query: 140 RVPSKLLPYSWWSTSIMGMEYYPEWKNIPRKVVKDLKPYQ 179
           ++ +   P  W S S  G E+Y EW NIP  V+K L+P+Q
Sbjct: 131 KLEALGDPLPWIS-SATGTEFYGEWDNIPADVIKKLRPFQ 169

>NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {ON}
           Anc_8.682 YPL159C
          Length = 258

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 21/29 (72%)

Query: 151 WSTSIMGMEYYPEWKNIPRKVVKDLKPYQ 179
           W TS  G+E + EW N+P  V+++LKP+Q
Sbjct: 157 WDTSATGVETFTEWDNVPESVIRNLKPFQ 185

>Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C -
           Hypothetical ORF [contig 68] FULL
          Length = 223

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 51/144 (35%), Gaps = 56/144 (38%)

Query: 36  FRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQDLVNAESN 95
           F  LP+ P+T  L+   ++  +L+SGYRP                        L  A+  
Sbjct: 82  FSWLPKAPSTDHLKQRDVSTTLLYSGYRPFV----------------------LAPADQK 119

Query: 96  SNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYSWWSTSI 155
             D++L                                 + F  ++ S   P  W S S 
Sbjct: 120 QTDSTL---------------------------------YEFAMKLESLGDPLPWIS-SA 145

Query: 156 MGMEYYPEWKNIPRKVVKDLKPYQ 179
            G E+Y EW  +P  V+K L+P+Q
Sbjct: 146 TGTEFYGEWDGVPADVIKQLRPFQ 169

>ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa] {ON}
           similar to gnl|GLV|KLLA0A07447g Kluyveromyces lactis
           KLLA0A07447g and weakly similar to YNL295W
           uniprot|P48564 Saccharomyces cerevisiae YNL295W
           Hypothetical ORF
          Length = 460

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 70/160 (43%), Gaps = 19/160 (11%)

Query: 27  KMSSDTEHIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTK-NIF 85
           K  +D       +PRVP T ++ +  +  + LF+GYRP+   +  +P+    G+T  + F
Sbjct: 46  KDETDNNKAHLVVPRVPPTDYISAPEIQTEGLFAGYRPLF--LGNSPINDKNGSTPLDNF 103

Query: 86  GQDLVNAESNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKL 145
                N +       + + + + +               GI SG ++ +   N +     
Sbjct: 104 FTSFANLKVVEESEVVGEVNVQEVIED---------LRRGIPSGQMSNSKGKNRK----- 149

Query: 146 LPYSWWSTSIMGMEYYPE-WKNIPRKVVKDLKPYQLVDKE 184
            P   W  SI GM Y  + +K++P  VV  LKP+++V  E
Sbjct: 150 -PIIPWDASISGMVYNDDPFKHVPNNVVSKLKPFKMVRLE 188

>Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W
           (REAL)
          Length = 525

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 62/147 (42%), Gaps = 12/147 (8%)

Query: 39  LPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQDLVNAESNSND 98
           +P+V +T  +    +  + LF+GYRP+       P     G  KN    D V       D
Sbjct: 112 VPKVASTDHIPKKEVNTEGLFAGYRPLFLGNSSFPSDVRKG--KNFHDLDEVLPNIQLVD 169

Query: 99  ASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYSWWSTSIMGM 158
           AS   E D  +  QE   +  D     ++    N     +      ++P   W  SI GM
Sbjct: 170 AS---EKDGKLNVQE---IIEDLQRTSLRESISNMEQSSSSHKRRPVIP---WDASISGM 220

Query: 159 EYYPE-WKNIPRKVVKDLKPYQLVDKE 184
            Y    +K+IP+ VV  LKP++LV  E
Sbjct: 221 VYNDMPFKHIPKNVVSKLKPFKLVRVE 247

>Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 65/147 (44%), Gaps = 12/147 (8%)

Query: 39  LPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQDLVNAESNSND 98
           +P+V +T  +++  +  + LF+GYRP+       P     G   +  G  L N +    D
Sbjct: 111 VPKVASTDHIQNKEVHTEGLFAGYRPLFLGNSSFPSDARKGKNFHELGDVLPNIQ--VID 168

Query: 99  ASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYSWWSTSIMGM 158
           AS   E D  +  QE   +  D     ++    N     +      ++P   W  SI GM
Sbjct: 169 AS---EKDGKLNMQE---IIEDLHKSSLRDSIHNMEQHSSSHKRKPVIP---WDASISGM 219

Query: 159 EYYPE-WKNIPRKVVKDLKPYQLVDKE 184
            Y    +K++P+ VV  +KP++L+  E
Sbjct: 220 VYNDMPFKHVPKSVVLRMKPFKLMRIE 246

>YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative
           protein of unknown function
          Length = 524

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 68/158 (43%), Gaps = 18/158 (11%)

Query: 27  KMSSDTEHIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFG 86
           K+S    H+   +PRV +T ++ +  +  + LF+GYRP+       P     G  KN   
Sbjct: 101 KISGSNLHLL--VPRVASTDYISNKEVHTEGLFAGYRPLFLGNSGFPSDARKG--KNFHE 156

Query: 87  QDLVNAESNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPS--K 144
            D V       DAS   E D  +  QE            ++   +  +     ++PS  K
Sbjct: 157 LDDVLPNIQVVDAS---EKDGKLNVQEI--------IEDLQRTSLRESIHSMEQLPSSHK 205

Query: 145 LLPYSWWSTSIMGMEYYPE-WKNIPRKVVKDLKPYQLV 181
             P   W  SI GM Y    +K +P+ ++  +KP++L+
Sbjct: 206 RKPVIPWDASISGMVYNDMPFKYVPKNIILKMKPFKLL 243

>CAGL0M03685g Chr13 complement(413333..414814) [1482 bp, 493 aa]
           {ON} weakly similar to uniprot|P48564 Saccharomyces
           cerevisiae YNL295w
          Length = 493

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 64/150 (42%), Gaps = 35/150 (23%)

Query: 39  LPRVPTTQFLESTTLTNDILFSGYRPI----TYPVKENPLFRNTGN--TKNIFGQDLVNA 92
           +P V +T  L    +  + LF+G +P+       +K  P F + G   +KN     ++NA
Sbjct: 94  VPSVSSTDHLTDQEIHLEGLFAGSKPLFLGKLASMKSMPSFFDNGVLLSKNF---RVINA 150

Query: 93  ESNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYSWWS 152
             +  + SL                  D     +K    +  W  +     K++P   W 
Sbjct: 151 SDDGGEKSL------------------DEFLESVK----DNDWNIDNSEQKKVIP---WQ 185

Query: 153 TSIMGMEYYPE-WKNIPRKVVKDLKPYQLV 181
            SI G+EY  + + NIP+ V+  L+PY+L+
Sbjct: 186 ASISGIEYEDKSFSNIPKHVLSKLRPYKLI 215

>TPHA0P01260 Chr16 complement(252274..253758) [1485 bp, 494 aa] {ON}
           Anc_3.62 YNL295W
          Length = 494

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 65/150 (43%), Gaps = 19/150 (12%)

Query: 39  LPRVPTTQFLESTTLTNDILFSGYRPI---TYPVKENPLFRNTGNTKNIFGQDLVNAESN 95
           +P+V +T  L S  +  + LF+GYRP+      ++ N       N    F    V+A  +
Sbjct: 89  VPKVASTDNLSSAEIQTEGLFAGYRPLFLGNSSLETNSKLDVLDNFFTSFANLKVSAPES 148

Query: 96  SNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYSWWSTSI 155
             D+           S +   +  D    G++S     +     R P  ++P   W  SI
Sbjct: 149 ETDS---------YNSGQIKDVIDDL-QNGLESEQEQSSLTRENRKP--IIP---WDASI 193

Query: 156 MGMEYYPE-WKNIPRKVVKDLKPYQLVDKE 184
            GM Y  + +K++P+ VV  L P++LV  E
Sbjct: 194 GGMVYSDKAFKDLPKSVVSKLSPFKLVKLE 223

>TBLA0B08510 Chr2 complement(2036557..2038062) [1506 bp, 501 aa]
           {ON} Anc_3.62 YNL295W
          Length = 501

 Score = 37.0 bits (84), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 75/161 (46%), Gaps = 47/161 (29%)

Query: 39  LPRVPTTQFLESTTLTNDILFSGYRP-------ITYPVKENPL----------FRNTGNT 81
           +PRV +T+ + S  +  D LF+GYRP       I    K +PL           RN  + 
Sbjct: 90  VPRVASTEDIPSHEVQVDGLFAGYRPLFLGESSIKRRRKASPLDKFFHSVETHTRNRESG 149

Query: 82  KNIFG-QDLVNAESNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPR 140
           K+  G QD+++        +L ++H++     E ++   D+ T            +  PR
Sbjct: 150 KSTLGIQDIID--------NLRKDHEEENLEIEEHS---DKNT------------KVEPR 186

Query: 141 VPSKLLPYSWWSTSIMGMEYYPE-WKNIPRKVVKDLKPYQL 180
            P  ++P   W  S+ G+ Y  + +KN+P+ V+  LKPY++
Sbjct: 187 KP--VIP---WDASVSGIFYKDQSFKNVPKHVMNKLKPYKV 222

>KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON}
           Anc_8.682 YPL159C
          Length = 220

 Score = 36.2 bits (82), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 25/37 (67%)

Query: 36  FRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKEN 72
           + +LPRVP+T  ++   L  ++LFS YRP++  +K +
Sbjct: 88  YSALPRVPSTSNMDRKQLNTELLFSAYRPLSMDLKSD 124

>Kwal_23.5277 s23 complement(1088250..1089662) [1413 bp, 470 aa]
           {ON} YNL295W - Hypothetical ORF [contig 8] FULL
          Length = 470

 Score = 36.2 bits (82), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 12/52 (23%)

Query: 138 NPRVPSK--------LLPYSWWSTSIMGMEYYPE-WKNIPRKVVKDLKPYQL 180
           +P VP+K        ++P   W  SI GM Y  E +K++PR VV  LKP++L
Sbjct: 157 DPEVPAKDSDIAEKAVIP---WDASISGMVYNDEPFKHVPRAVVSKLKPFKL 205

>NDAI0A06110 Chr1 complement(1384706..1386178) [1473 bp, 490 aa]
           {ON} Anc_3.62 YNL295W
          Length = 490

 Score = 35.8 bits (81), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 66/156 (42%), Gaps = 24/156 (15%)

Query: 39  LPRVPTTQFLESTTLTNDILFSGYRPI----TYPVKENPLFRNTGNTKNIFGQ--DL--- 89
           +PRV  T  +    +  + LF+GY+P+    +    +N  + N  + K +  Q  DL   
Sbjct: 67  VPRVGETDHIPVNEVQTEGLFAGYKPLFLGNSSISTQNRFYDNELHLK-LLPQLSDLKLL 125

Query: 90  -VNAESNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVN--GTWRFNPRVPSKLL 146
             NAE+   ++S L  HD          +  +     I S  +N  G     P +P    
Sbjct: 126 GANAENFITESSSL--HDTLSQKNNIQDIIEELKNATIHSQDINSDGEGITKPTIP---- 179

Query: 147 PYSWWSTSIMGMEYYPE-WKNIPRKVVKDLKPYQLV 181
               W  SI GM Y    +K +P  VV  LKP++++
Sbjct: 180 ----WDASISGMLYKDRPFKAVPNSVVTKLKPFKMI 211

>SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]
           {ON} similar to uniprot|P48564 Saccharomyces cerevisiae
           YNL295W Hypothetical ORF
          Length = 552

 Score = 35.4 bits (80), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 62/151 (41%), Gaps = 35/151 (23%)

Query: 39  LPRVPTTQFLESTTLTNDILFSGYRPI-----TYPVKENPLFRN--TGNTKNIFGQDLVN 91
           +P VP T ++  + +  + LF+GY+P+     +   K   +     T  TK   G    N
Sbjct: 161 VPHVPNTDYIPHSEIQTEGLFAGYKPLFLGNSSLDEKRADVLDGLFTSLTKIKKGTSAPN 220

Query: 92  AESNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYSWW 151
            E N  +  +L +  K+ T +     S  +                 P +P        W
Sbjct: 221 GEINVQE--ILDDLQKDDTMETLKEKSHKK-----------------PVIP--------W 253

Query: 152 STSIMGMEYYP-EWKNIPRKVVKDLKPYQLV 181
             SI GM Y    +K++PR VV  LKP++L+
Sbjct: 254 DASISGMVYNDLPFKDVPRNVVGKLKPFKLL 284

>Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 70/156 (44%), Gaps = 14/156 (8%)

Query: 27  KMSSDTEHIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFG 86
           KM     H+   +P+V +T+++    +  + LF+GYRP+   +  +    +    KN   
Sbjct: 101 KMFGSNLHLL--VPKVASTEYIPIKEVHTEGLFAGYRPLF--LGNSSFSSDMRKGKNFHA 156

Query: 87  QDLVNAESNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLL 146
            D         DAS   E D  +  QE   +   + T  I++  V+   +F+     K  
Sbjct: 157 LDDGLPNIQVIDAS---EKDGKLDVQEI--IEDLQKTSLIEN--VSDKEQFSSSHKRK-- 207

Query: 147 PYSWWSTSIMGMEYYPE-WKNIPRKVVKDLKPYQLV 181
           P   W  SI GM Y    +K +P+ V+  +KP++L+
Sbjct: 208 PVIPWDASISGMVYNDMPFKYVPKNVISKMKPFKLM 243

>Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON}
           complement(1..4131) [4131 nt, 1377 aa]
          Length = 1377

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 45/104 (43%), Gaps = 19/104 (18%)

Query: 34  HIFRSLPRVPTTQ-----FLESTTLTNDILFSGYRP--ITYPVKENPLFRNTGNTKNIFG 86
           H+F+    VP+        +    LTN I +    P  I   +K N LF +  N K    
Sbjct: 744 HLFKGEIHVPSLASKHELMIHGDGLTNSISYCSQIPWIINDSIKNNILFGSEFNLKRY-- 801

Query: 87  QDLVNAESNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGG 130
            D++ A   +ND  LLQ+ D        N++ GDRG     SGG
Sbjct: 802 NDVIRACCLTNDLRLLQDGD--------NSIVGDRGQN--LSGG 835

>NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa]
           {ON} Anc_3.62 YNL295W
          Length = 494

 Score = 34.3 bits (77), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 74/160 (46%), Gaps = 24/160 (15%)

Query: 39  LPRVPTTQFLESTTLTNDILFSGYRPI-----TYPVKE---------NPLFRNTGNTKNI 84
           +P+VPTT ++ S  +  + LF+GY+P+       PVK+         N +        N+
Sbjct: 70  VPKVPTTDYIPSLEMQTEGLFAGYKPLFLGNHVLPVKKQLPEELKALNFIIPKISRI-NL 128

Query: 85  FGQDLVNAESNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIK-SGGVNGTWRFNPRVPS 143
           F  + V   +  + + L  +  K I  +  N L   R    +  S  ++ T        +
Sbjct: 129 FSSNAVETLNPDHVSPLDNDGVKTIDIK--NILK--RSDAEVHPSDNIDNTVAKKTETLT 184

Query: 144 KLLPYSWWSTSIMGMEY--YPEWKNIPRKVVKDLKPYQLV 181
           +  P   W  SI G+ Y  +P +KN+P +++ +LKP++++
Sbjct: 185 R-KPVIPWDASISGVIYNDHP-FKNVPGRIISELKPFKIM 222

>Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON}
           similar to Ashbya gossypii AAL087C
          Length = 227

 Score = 32.7 bits (73), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 18/28 (64%)

Query: 151 WSTSIMGMEYYPEWKNIPRKVVKDLKPY 178
           W  +  G   Y EW N+P+ V+++L+PY
Sbjct: 145 WVKNATGRVLYDEWDNVPQSVIRNLRPY 172

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 18/28 (64%)

Query: 39  LPRVPTTQFLESTTLTNDILFSGYRPIT 66
            P  P T+ L+   +  D+L+SGYRP++
Sbjct: 89  FPVAPKTEHLKEGDIAVDLLYSGYRPLS 116

>Skud_11.160 Chr11 (290123..293176) [3054 bp, 1017 aa] {ON} YKL068W
           (REAL)
          Length = 1017

 Score = 29.6 bits (65), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 14/29 (48%)

Query: 58  LFSGYRPITYPVKENPLFRNTGNTKNIFG 86
           LF   +PIT P   NP     G   NIFG
Sbjct: 494 LFGATKPITMPFGANPTINQPGGENNIFG 522

>Suva_14.198 Chr14 complement(357206..362032) [4827 bp, 1608 aa]
           {ON} YNL139C (REAL)
          Length = 1608

 Score = 29.3 bits (64), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 21/98 (21%), Positives = 45/98 (45%), Gaps = 10/98 (10%)

Query: 84  IFGQDLVNAESNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPS 143
           +F ++LVN +   + ASL+ +    ++S   NT          K   +    +  P +  
Sbjct: 88  LFIEELVNCDRQGSQASLVGKMFIAVSSTVPNT----------KDTNIISLCKLIPSLHE 137

Query: 144 KLLPYSWWSTSIMGMEYYPEWKNIPRKVVKDLKPYQLV 181
           +L  +SW S+ ++  E     +++ +K   ++K Y L+
Sbjct: 138 ELFKFSWISSKLLNKEQTTLLRHLLKKSKYEVKKYNLL 175

>TPHA0L00220 Chr12 (23667..24389) [723 bp, 240 aa] {ON} Anc_4.366
           YJR135C
          Length = 240

 Score = 28.9 bits (63), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 41/86 (47%), Gaps = 2/86 (2%)

Query: 90  VNAESNSNDASL--LQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLP 147
           V +ESN  D +L  L      I  ++ N L  +  +  + S    G+ R + RV   L  
Sbjct: 128 VESESNEEDPNLILLPSQKNKILRRQLNNLIEEYISIDLLSSQNMGSERNSKRVKKLLSR 187

Query: 148 YSWWSTSIMGMEYYPEWKNIPRKVVK 173
              +  S++  +++PE+K++ R + K
Sbjct: 188 LINYDDSLLVSDFFPEYKDLYRLLSK 213

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,253,245
Number of extensions: 1032537
Number of successful extensions: 3537
Number of sequences better than 10.0: 92
Number of HSP's gapped: 3579
Number of HSP's successfully gapped: 114
Length of query: 184
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 81
Effective length of database: 41,670,801
Effective search space: 3375334881
Effective search space used: 3375334881
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)