Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1017.103.486ON2342349351e-129
TPHA0D032503.486ON2192223112e-34
NCAS0E008503.486ON2302412092e-19
CAGL0I10604g3.486ON2112232047e-19
Suva_7.4143.486ON2301722022e-18
YGR126W3.486ON2301982004e-18
TDEL0D055403.486ON2162181952e-17
Skud_7.4373.486ON2301741925e-17
Smik_6.2223.486ON2301721821e-15
KNAG0B008503.486ON2252381636e-13
SAKL0F02904g3.486ON222801611e-12
KLTH0F14696g3.486ON2192071522e-11
KAFR0C019203.486ON2232521471e-10
NDAI0G009803.486ON2341631363e-09
Kwal_55.212153.486ON1421591245e-08
KLLA0E04709g3.486ON166761169e-07
NCAS0E007503.503ON620571145e-06
CAGL0I10384g3.503ON630551083e-05
NDAI0I027703.503ON626551065e-05
KNAG0B007303.503ON622551041e-04
Kwal_47.189193.503ON640551022e-04
YGR138C (TPO2)3.503ON614551003e-04
Skud_7.4483.503ON611551003e-04
Suva_7.4253.503ON613551003e-04
Suva_16.4843.503ON62254985e-04
TDEL0D057103.503ON61655986e-04
YPR156C (TPO3)3.503ON62254987e-04
KAFR0C020303.503ON62425987e-04
Smik_6.2333.503ON61455977e-04
Skud_16.4503.503ON62254977e-04
Smik_16.4083.503ON62254978e-04
KLLA0E03829g3.503ON60938960.001
KLTH0G02266g3.503ON64456960.001
TPHA0D033103.503ON61356930.003
ZYRO0G19646g3.503ON59467910.005
TBLA0D029003.503ON69181910.005
NCAS0F036203.503ON63455890.009
Kpol_1017.33.503ON62156880.010
AFR322C3.503ON59254810.070
SAKL0F02442g3.503ON61022810.088
Skud_7.1336.241ON802111692.8
YGL139W (FLC3)6.241ON80276675.1
NDAI0J008808.340ON129153666.2
Kpol_1064.398.727ON75562656.9
AER213C3.186ON55748657.2
SAKL0G10384g5.298ON167454658.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1017.10
         (234 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1017.10 s1017 complement(30565..31269) [705 bp, 234 aa] {ON...   364   e-129
TPHA0D03250 Chr4 (670720..671379) [660 bp, 219 aa] {ON} Anc_3.48...   124   2e-34
NCAS0E00850 Chr5 complement(155265..155957) [693 bp, 230 aa] {ON...    85   2e-19
CAGL0I10604g Chr9 complement(1047516..1048151) [636 bp, 211 aa] ...    83   7e-19
Suva_7.414 Chr7 (715894..716586) [693 bp, 230 aa] {ON} YGR126W (...    82   2e-18
YGR126W Chr7 (745835..746527) [693 bp, 230 aa] {ON} Putative pro...    82   4e-18
TDEL0D05540 Chr4 (1002467..1003117) [651 bp, 216 aa] {ON} Anc_3....    80   2e-17
Skud_7.437 Chr7 (725052..725744) [693 bp, 230 aa] {ON} YGR126W (...    79   5e-17
Smik_6.222 Chr6 (363652..364344) [693 bp, 230 aa] {ON} YGR126W (...    75   1e-15
KNAG0B00850 Chr2 complement(155105..155782) [678 bp, 225 aa] {ON...    67   6e-13
SAKL0F02904g Chr6 complement(244726..245394) [669 bp, 222 aa] {O...    67   1e-12
KLTH0F14696g Chr6 (1205320..1205979) [660 bp, 219 aa] {ON} weakl...    63   2e-11
KAFR0C01920 Chr3 (385431..386102) [672 bp, 223 aa] {ON} Anc_3.48...    61   1e-10
NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON...    57   3e-09
Kwal_55.21215 s55 (733385..733813) [429 bp, 142 aa] {ON} YGR126W...    52   5e-08
KLLA0E04709g Chr5 complement(417351..417851) [501 bp, 166 aa] {O...    49   9e-07
NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON}               49   5e-06
CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} high...    46   3e-05
NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503     45   5e-05
KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.5...    45   1e-04
Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]...    44   2e-04
YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}  ...    43   3e-04
Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON...    43   3e-04
Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON...    43   3e-04
Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {...    42   5e-04
TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa] ...    42   6e-04
YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON} ...    42   7e-04
KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {O...    42   7e-04
Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON...    42   7e-04
Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {...    42   7e-04
Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {...    42   8e-04
KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly...    42   0.001
KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly...    42   0.001
TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {O...    40   0.003
ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} simi...    40   0.005
TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.5...    40   0.005
NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {O...    39   0.009
Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON} (12526.....    39   0.010
AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}...    36   0.070
SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly...    36   0.088
Skud_7.133 Chr7 (250133..252541) [2409 bp, 802 aa] {ON} YGL139W ...    31   2.8  
YGL139W Chr7 (245716..248124) [2409 bp, 802 aa] {ON}  FLC3Putati...    30   5.1  
NDAI0J00880 Chr10 complement(194614..198489) [3876 bp, 1291 aa] ...    30   6.2  
Kpol_1064.39 s1064 complement(71731..73998) [2268 bp, 755 aa] {O...    30   6.9  
AER213C Chr5 complement(1028170..1029843) [1674 bp, 557 aa] {ON}...    30   7.2  
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    30   8.1  

>Kpol_1017.10 s1017 complement(30565..31269) [705 bp, 234 aa] {ON}
           complement(30565..31269) [705 nt, 235 aa]
          Length = 234

 Score =  364 bits (935), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 188/234 (80%), Positives = 188/234 (80%)

Query: 1   MTSKQXXXXXXXXXXXXFEDISSFDSQNSFAPQEFKGNLDSNNDNDTGVFNKTKSGTSET 60
           MTSKQ            FEDISSFDSQNSFAPQEFKGNLDSNNDNDTGVFNKTKSGTSET
Sbjct: 1   MTSKQDNNNRNSTDSSNFEDISSFDSQNSFAPQEFKGNLDSNNDNDTGVFNKTKSGTSET 60

Query: 61  NTLKVNSSNEIEKIVTRNALENNTETVATLRETESKLSKVPTENVLPATMENNAAFPEEY 120
           NTLKVNSSNEIEKIVTRNALENNTETVATLRETESKLSKVPTENVLPATMENNAAFPEEY
Sbjct: 61  NTLKVNSSNEIEKIVTRNALENNTETVATLRETESKLSKVPTENVLPATMENNAAFPEEY 120

Query: 121 RIETKTGLVPIKTLEEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEDKDVEQK 180
           RIETKTGLVPIKTLEEM                                  DEDKDVEQK
Sbjct: 121 RIETKTGLVPIKTLEEMHSNKSNGKNEENEHHNHQHNHHNHHNHHHHHEKNDEDKDVEQK 180

Query: 181 EKHPAEHLPHGKLEQKNIDIVVERNKKQLEKWEEHKHEINPVKKFIYKFLDSYQ 234
           EKHPAEHLPHGKLEQKNIDIVVERNKKQLEKWEEHKHEINPVKKFIYKFLDSYQ
Sbjct: 181 EKHPAEHLPHGKLEQKNIDIVVERNKKQLEKWEEHKHEINPVKKFIYKFLDSYQ 234

>TPHA0D03250 Chr4 (670720..671379) [660 bp, 219 aa] {ON} Anc_3.486
           YGR126W
          Length = 219

 Score =  124 bits (311), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 72/222 (32%), Positives = 115/222 (51%), Gaps = 28/222 (12%)

Query: 18  FEDISSFDSQNSFAPQEFKGN---------LDSNNDNDTGVFNKTKSGTSETNTLKVNSS 68
           F+D+SSF+S NS+ PQEF G+         +D    + +    +T+SGTS+ NT+K  +S
Sbjct: 16  FDDVSSFNSDNSYTPQEFIGDTLGKESSTKMDDRASHLSHAIKETRSGTSDNNTIKPVTS 75

Query: 69  NEIEKIVTRNALENNTETVATLRETESKLSKVPTENVLPATMENNAAFPEEYRIETKTGL 128
           N++ +IV+RN ++NN E+   L+   + +     + +LPA+ME N+ FPEEY +ET TGL
Sbjct: 76  NDVHRIVSRNIMDNNVESEEALKTQLTNMESRRADIILPASMEGNSNFPEEYTMETTTGL 135

Query: 129 VPIKTLEEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEDKDVEQKEKHPAEHL 188
           VP+KTLE++                                          K  +  +  
Sbjct: 136 VPVKTLEDIKKKKTIDSENSRKSLVSSELKA-------------------SKSNNTVKSR 176

Query: 189 PHGKLEQKNIDIVVERNKKQLEKWEEHKHEINPVKKFIYKFL 230
             G L    ++  VE+NK++LEK++ HK E NP+KK ++K  
Sbjct: 177 NEGGLNPAKLNAAVEKNKEELEKYQHHKTEKNPIKKMLFKLF 218

>NCAS0E00850 Chr5 complement(155265..155957) [693 bp, 230 aa] {ON}
           Anc_3.486 YGR126W
          Length = 230

 Score = 85.1 bits (209), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 74/241 (30%), Positives = 109/241 (45%), Gaps = 51/241 (21%)

Query: 18  FEDISSFDSQNSFAPQEFKG---------------------NLDSNNDNDTGVFNKTKSG 56
           FED+SSF S +S+ P+ F G                      L   + N T   + TK G
Sbjct: 14  FEDVSSFSSIDSYQPEPFTGVKEPTAYKGTDRKDTLSGDETELKQEHTNATATSSHTKDG 73

Query: 57  -TSETN--TLKVNSSNEIEKIVTRNALENNTETVATLRETESKLSKVPTENVLPATMENN 113
            TS T+  TL+   SN IE+++T NA E NTET+ +L      L+K  T ++      N 
Sbjct: 74  ITSRTSMSTLRRPDSNAIERVITSNAKEGNTETLGSLAAKGLDLNKKATLDINAPLTSNP 133

Query: 114 A--AFPEEYRIETKTGLVPIKTLEEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 171
           A  AFPEEY +ET+TGLV  KT+E +                                  
Sbjct: 134 ADVAFPEEYNLETETGLVKAKTIETLRRETSRVSSTRRG--------------------- 172

Query: 172 DEDKDVEQKEKHPAEHLPHGK-LEQKNIDIVVERNKKQLEKWEEHKHEINPVKKFIYKFL 230
             D  V  K +   +     + L+ + +++ VE+NKK+LEK E+HKH+   +K F+ +  
Sbjct: 173 --DDVVSHKSQATGKSQRSAQSLQAEKLNLAVEKNKKELEKIEKHKHQ-KGLKGFMNRLF 229

Query: 231 D 231
           D
Sbjct: 230 D 230

>CAGL0I10604g Chr9 complement(1047516..1048151) [636 bp, 211 aa]
           {ON} similar to uniprot|P53274 Saccharomyces cerevisiae
           YGR126w
          Length = 211

 Score = 83.2 bits (204), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 67/223 (30%), Positives = 98/223 (43%), Gaps = 36/223 (16%)

Query: 19  EDISSFDSQNSFAPQEFKGNLDSNNDN--------DTGVFNKTKSGTSETNTLKVNSSNE 70
           EDISSF S +S+ P+ F G   + N+N          G +    +      TLK   S  
Sbjct: 15  EDISSFSSVDSYKPEPFTGLEHTKNENLSRKATNASQGTYMDDATSKHSGATLKKLDSLA 74

Query: 71  IEKIVTRNALENNTETVATLRETESKLSK--VPTENVLPATMENNAAFPEEYRIETKTGL 128
           IEK+VT+NA+  N+ET+ +L+     + +  +P  N  P T      FPEEYR+ET TGL
Sbjct: 75  IEKVVTQNAVAGNSETIESLKAKGLDMQRKAIPDYNA-PLTTTGTNQFPEEYRLETDTGL 133

Query: 129 VPIKTLEEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEDKDVEQKEKHPAEHL 188
           V +KTLE +                                   E  D+ QK        
Sbjct: 134 VKMKTLETLKRKSTQVSRNSDLSSKDKSISKSQSNKS-------EVSDIAQK-------- 178

Query: 189 PHGKLEQKNIDIVVERNKKQLEKWEEHKHEINPVKKFIYKFLD 231
                    I++ VERNKK++ K+++HK E   +K F ++  D
Sbjct: 179 ---------INMAVERNKKEIAKYQKHKSE-KGIKGFFHRMFD 211

>Suva_7.414 Chr7 (715894..716586) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score = 82.4 bits (202), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 58/172 (33%), Positives = 86/172 (50%), Gaps = 22/172 (12%)

Query: 62  TLKVNSSNEIEKIVTRNALENNTETVATLRETESKLSKVPTENV-LPAT-MENNAAFPEE 119
           TLK  +SN IEK+VT NALE N+ETV +L++    L+K  T ++  P T   ++AAFPEE
Sbjct: 79  TLKRPTSNSIEKMVTHNALEGNSETVDSLKKEGLNLNKKGTPDITAPVTNSAHDAAFPEE 138

Query: 120 YRIETKTGLVPIKTLEEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEDKDVEQ 179
           YR+ET+TGLV +KTLE +                                   +  D   
Sbjct: 139 YRLETETGLVKLKTLETLKREDSRVSGAKKDHGH-------------------DHTDAHS 179

Query: 180 KEKHPAEHLPHGKLEQKNIDIVVERNKKQLEKWEEHKHEINPVKKFIYKFLD 231
                  +     LE   ++I VE+NKK++EK+++HK E   +K   ++  D
Sbjct: 180 TRSKATAYSQGSSLESDKLNIAVEKNKKRIEKYQKHKGEKG-IKGLFHRMFD 230

>YGR126W Chr7 (745835..746527) [693 bp, 230 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to both the cytoplasm and
           the nucleus and is induced in response to the
           DNA-damaging agent MMS
          Length = 230

 Score = 81.6 bits (200), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 99/198 (50%), Gaps = 22/198 (11%)

Query: 36  KGNLDSNNDNDTGVFNKTKSGTSETNTLKVNSSNEIEKIVTRNALENNTETVATLRETES 95
           KG L+ +++ D    +        ++TLK  +SN IEK+VT NALE N+ETV +L+E   
Sbjct: 53  KGQLEDDSNVDDQHRHSDVHSHHSSSTLKRPTSNSIEKMVTHNALEGNSETVDSLKEDGL 112

Query: 96  KLSKVPTENV-LPAT-MENNAAFPEEYRIETKTGLVPIKTLEEMXXXXXXXXXXXXXXXX 153
            L+K    ++  P T   ++AAFPEEYR+ET+TGLV +KTLE +                
Sbjct: 113 NLNKKALPDITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESL---------------- 156

Query: 154 XXXXXXXXXXXXXXXXXXDEDKDVEQKEKHPAEHLPHGKLEQKNIDIVVERNKKQLEKWE 213
                             ++  D+         +     LE   +++ VE+NKK++EK++
Sbjct: 157 ---KREDSRVSSTKKEHINDHTDMHSTRSKVTTNSQGSSLEPNKLNMAVEKNKKRIEKYQ 213

Query: 214 EHKHEINPVKKFIYKFLD 231
           +HK E   +K F ++  D
Sbjct: 214 KHKSEKG-IKGFFHRIFD 230

>TDEL0D05540 Chr4 (1002467..1003117) [651 bp, 216 aa] {ON} Anc_3.486
           YGR126W
          Length = 216

 Score = 79.7 bits (195), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 66/218 (30%), Positives = 103/218 (47%), Gaps = 21/218 (9%)

Query: 18  FEDISSFDSQNSFAPQEFKGN--LDSNNDNDTGVFNKTKSGTSETNTLKVNSSNEIEKIV 75
           F+++SSF S +S+ PQ F G   L    + D+     +KSGT    TL    SN IEK V
Sbjct: 16  FDEVSSFSSIDSYQPQPFTGQEELPQEKNPDSSSRRSSKSGT----TLNHQDSNTIEKEV 71

Query: 76  TRNALENNTETVATLRET--ESKLSKVPTENVLPATMENNAAFPEEYRIETKTGLVPIKT 133
           T NA+   +ET  +L++   +++   +P  N       + + FPEEYRIET+TGLV +KT
Sbjct: 72  THNAMNGTSETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQTGLVKLKT 131

Query: 134 LEEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEDKDVEQKEKHPAEHLPHGKL 193
           L ++                                   +    EQ+    AE+L H   
Sbjct: 132 LNDLSRSDTRVSIGSDGKISRKSSGPGTIDSKIEPKP--DTAKAEQEAAQNAENLEH--- 186

Query: 194 EQKNIDIVVERNKKQLEKWEEHKHEINPVKKFIYKFLD 231
                   +E+NK ++EK+E+H+HE   +K F+++  D
Sbjct: 187 -------AIEKNKHRIEKFEKHRHEKG-LKGFVHRLFD 216

>Skud_7.437 Chr7 (725052..725744) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score = 78.6 bits (192), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 55/174 (31%), Positives = 85/174 (48%), Gaps = 22/174 (12%)

Query: 60  TNTLKVNSSNEIEKIVTRNALENNTETVATLRETESKLSKVPTENV-LPAT-MENNAAFP 117
           ++TLK  SSN IEK++T NALE N+ET  +L+     L+K    ++  P T   +N AFP
Sbjct: 77  SSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFP 136

Query: 118 EEYRIETKTGLVPIKTLEEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEDKDV 177
           EEYR+ET+TGLV +KTLE +                                  ++  D 
Sbjct: 137 EEYRLETETGLVKLKTLETL-------------------KREDSRVSSAKKEHTNDHADA 177

Query: 178 EQKEKHPAEHLPHGKLEQKNIDIVVERNKKQLEKWEEHKHEINPVKKFIYKFLD 231
                    +     LE   +++ VE+NKK++E++ +HK E   +K F ++  D
Sbjct: 178 HSTRSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKG-IKGFFHRIFD 230

>Smik_6.222 Chr6 (363652..364344) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score = 74.7 bits (182), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 86/172 (50%), Gaps = 22/172 (12%)

Query: 62  TLKVNSSNEIEKIVTRNALENNTETVATLRETESKLSKVPTENV-LPAT-MENNAAFPEE 119
           TLK  +SN IEK+VT+NALE  +ET+ +L+E    L K    ++  P T   ++A FPEE
Sbjct: 79  TLKRPTSNSIEKMVTQNALEGTSETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEE 138

Query: 120 YRIETKTGLVPIKTLEEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEDKDVEQ 179
           YR+ET+TGLV +KTLE +                                  ++  D+  
Sbjct: 139 YRLETETGLVKLKTLETL-------------------RREDSRVSSTKKEHNNDHTDIHS 179

Query: 180 KEKHPAEHLPHGKLEQKNIDIVVERNKKQLEKWEEHKHEINPVKKFIYKFLD 231
                  +     LE   +++ VE+NKK++E++++HK E   +K F ++  D
Sbjct: 180 TRSKVTTNSQGSSLEPNKLNMAVEKNKKKIEQYQKHKSEKG-IKGFFHRIFD 230

>KNAG0B00850 Chr2 complement(155105..155782) [678 bp, 225 aa] {ON}
           Anc_3.486 YGR126W
          Length = 225

 Score = 67.4 bits (163), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 99/238 (41%), Gaps = 51/238 (21%)

Query: 18  FEDISSFDSQNSFAPQEFKG----------------------NLDSNNDNDTGVFNKTKS 55
           F+++SSF S +S+ P+ F G                      +L  N  N     N   S
Sbjct: 13  FDEVSSFSSVDSYKPEPFVGFGTEEEQHDSRLFKNDTILNSEDLAENTANTPSDLNSKAS 72

Query: 56  GTSETNTLKVNSSNEIEKIVTRNALENNTETVATLRETE---SKLSKVPTENVLPATMEN 112
            T    TL    SN IE++VT+NA+ N +E+   LR      +K   +P  N  P T+  
Sbjct: 73  ST----TLGKRDSNAIERVVTKNAMNNQSESADALRSKGLDTTKRRNIPDINA-PLTL-T 126

Query: 113 NAAFPEEYRIETKTGLVPIKTLEEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXD 172
            + FPEEY++ET+TGLV +KT+E +                                   
Sbjct: 127 QSHFPEEYQVETETGLVKMKTIESLKSRHSGGTHNSKKSKGASTRSKNSLTSSME----- 181

Query: 173 EDKDVEQKEKHPAEHLPHGKLEQKNIDIVVERNKKQLEKWEEHKHEINPVKKFIYKFL 230
                        EH   G L  + ++  VERN+K+LE++E+++ +   +K F+ K  
Sbjct: 182 -------------EHGEAG-LNAEKLNSAVERNRKELERYEKNRGK-KGIKGFLSKMF 224

>SAKL0F02904g Chr6 complement(244726..245394) [669 bp, 222 aa] {ON}
           similar to gnl|GLV|CAGL0I10604g Candida glabrata
           CAGL0I10604g and weakly similar to YGR126W
           uniprot|P53274 Saccharomyces cerevisiae YGR126W
           Hypothetical ORF
          Length = 222

 Score = 66.6 bits (161), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 54/80 (67%), Gaps = 3/80 (3%)

Query: 60  TNTLKVNSSNEIEKIVTRNALENNTETVATLRETESKLSK--VPTENVLPATMENNAAFP 117
           +NTLK   SN IEK++T NA+E NTET+ +L+     L K  +P  N  PA   + + FP
Sbjct: 74  SNTLKKLDSNAIEKVLTHNAVEGNTETLESLKTRGLDLRKKAIPDYNN-PAMHTDRSQFP 132

Query: 118 EEYRIETKTGLVPIKTLEEM 137
           EEY+IET+TGLV +KTL+ +
Sbjct: 133 EEYQIETETGLVKVKTLQSL 152

>KLTH0F14696g Chr6 (1205320..1205979) [660 bp, 219 aa] {ON} weakly
           similar to uniprot|P53274 Saccharomyces cerevisiae
           YGR126W Hypothetical ORF
          Length = 219

 Score = 63.2 bits (152), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 96/207 (46%), Gaps = 29/207 (14%)

Query: 32  PQEFK-----GNLDSNNDNDTGVFNKTKSGTSETNTLKVNSSNEIEKIVTRNALENNTET 86
           P E K     G++ ++   D+  F++ KS      TL+   SN IE+I+T NA E  +ET
Sbjct: 35  PSEIKSLEPEGSVQASPSIDSKDFHRVKS----NGTLRKQDSNAIEQIMTHNATEGRSET 90

Query: 87  VATLRETESKLSK--VPTENVLPATMENNAAFPEEYRIETKTGLVPIKTLEEMXXXXXXX 144
           V +L++    L K  +P  N  PA    N AFPEEY++ET TGLV  +TL  +       
Sbjct: 91  VESLKKNGLNLQKKAIPDINN-PAANYKNCAFPEEYQMETDTGLVKAQTLHGLNRLESRT 149

Query: 145 XXXXXXXXXXXXXXXXXXXXXXXXXXXDEDKDVEQKEKHPAEHLPHGKLEQKNIDIVVER 204
                                        + D+       A +  +G L+ + +   VE+
Sbjct: 150 SGRSGASQKKSIRTANSTT----------NSDLAS-----ANNTING-LDGEKLRRAVEK 193

Query: 205 NKKQLEKWEEHKHEINPVKKFIYKFLD 231
           N+K+++K+++HK     +++F+ K  D
Sbjct: 194 NQKKIDKYQKHKSS-GGLRRFLGKIFD 219

>KAFR0C01920 Chr3 (385431..386102) [672 bp, 223 aa] {ON} Anc_3.486
           YGR126W
          Length = 223

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 105/252 (41%), Gaps = 75/252 (29%)

Query: 19  EDISSFDSQNSFAPQEFKGN----------------------------------LDSNND 44
           EDISSF S  S+ P+ F G                                   L     
Sbjct: 8   EDISSFSSIESYKPEPFVGQGIARENTDELEFQSNLKDAQSHTSEKFQEEQVDPLKQVQT 67

Query: 45  NDTGVFNKTKSGTSETNT--LKVNSSNEIEKIVTRNALENNTETVATLRETESKLSK--V 100
           ND+    ++ S TS T++  LK   S +IE+IVT+NA+    ETV +LR T   L+K  V
Sbjct: 68  NDSFWSFRSVSNTSRTSSKNLKKQRSRDIERIVTQNAMLGKAETVDSLRATGLDLTKRAV 127

Query: 101 PTENVLPATMENNAAFPEEYRIETKTGLVPIKTLEEMXXXXXXXXXXXXXXXXXXXXXXX 160
           P  N   + + + +   +E + ET TGL+  KTLE +                       
Sbjct: 128 PDIN---SPISHESKLIDESKFETDTGLIKTKTLETLNRSNT------------------ 166

Query: 161 XXXXXXXXXXXDEDKDVEQKEKHPA-EHLPHGKLEQKNIDIVVERNKKQLEKWEEHKHEI 219
                         ++   K K    ++     L+ + +++VVERN+K+LEK+++HK E 
Sbjct: 167 --------------RNSSSKRKILGNDNSNTSGLDPERMNMVVERNRKKLEKYQQHKKE- 211

Query: 220 NPVKKFIYKFLD 231
             +K F YK  D
Sbjct: 212 KGLKGFFYKIFD 223

>NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON}
           Anc_3.486 YGR126W
          Length = 234

 Score = 57.0 bits (136), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 70/163 (42%), Gaps = 20/163 (12%)

Query: 69  NEIEKIVTRNALENNTETVATLRETESKLSKVPTENVLPATMENNAAFPEEYRIETKTGL 128
           N+IEK +T N + + TET+ +L +      K    ++        A FPEEYRIET+TGL
Sbjct: 92  NDIEKTMTTNIMNDKTETLDSLVKQGLNTRKKSVADINTPLNAGTAEFPEEYRIETETGL 151

Query: 129 VPIKTLEEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEDKDVEQKEKHPAEHL 188
           V  KT+E +                                  D+      +  +  +  
Sbjct: 152 VKAKTIESL-------------------RRQESIASANSRRSQDQGSFKSARTNNTRKSR 192

Query: 189 PHGKLEQKNIDIVVERNKKQLEKWEEHKHEINPVKKFIYKFLD 231
               L+   +++ VE+NKK+LEK+ +HK +   +K F  +  D
Sbjct: 193 ASSSLDPNKLNMAVEKNKKELEKYSKHKQQ-KGIKGFFNRLFD 234

>Kwal_55.21215 s55 (733385..733813) [429 bp, 142 aa] {ON} YGR126W -
           Hypothetical ORF [contig 131] PARTIAL
          Length = 142

 Score = 52.4 bits (124), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 71/159 (44%), Gaps = 19/159 (11%)

Query: 75  VTRNALENNTETVATLRETESKLSK--VPTENVLPATMENNAAFPEEYRIETKTGLVPIK 132
           +T NA E  +ETV +L+     +++  VP  N  PA    N  FPEEY++ET TGLV ++
Sbjct: 1   MTHNATEGRSETVDSLQRNGLNINQKAVPDYNN-PAANFTNCEFPEEYQLETDTGLVKVQ 59

Query: 133 TLEEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEDKDVEQKEKHPAEHLPHGK 192
           TL+++                                    D  +       A    +  
Sbjct: 60  TLQKLNRLESRTSIRSGNSQRKSMRSTPST-----------DHSISPS----AGRSSNSG 104

Query: 193 LEQKNIDIVVERNKKQLEKWEEHKHEINPVKKFIYKFLD 231
           L+ + +   VE+NK+Q++K+++HK     +KKF+ K  D
Sbjct: 105 LDAEKLRKAVEKNKRQIDKYQKHKAS-GGLKKFLGKIFD 142

>KLLA0E04709g Chr5 complement(417351..417851) [501 bp, 166 aa] {ON}
           weakly similar to uniprot|P53274 Saccharomyces
           cerevisiae YGR126W Hypothetical ORF
          Length = 166

 Score = 49.3 bits (116), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 45/76 (59%), Gaps = 5/76 (6%)

Query: 64  KVNSSNEIEKIVTRNALENNTETVATLRETESKLSK--VPTENVLPATMENNAAFPEEYR 121
           K++++ E+E  V  N  +  T+++ +L+ T   LSK  +P  N     +   A FPEEY 
Sbjct: 35  KISTTQEVEDYVKDNVQKGETDSIDSLKATNLDLSKKAIPGFN---QPIAEGAEFPEEYE 91

Query: 122 IETKTGLVPIKTLEEM 137
           IET+TGLV + TL ++
Sbjct: 92  IETRTGLVKVATLHQL 107

>NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 2/57 (3%)

Query: 82  NNTETVATLRETESKLSKVPTENV-LPATMENNAAFPEEYRIETKTGLVPIKTLEEM 137
             TETV TL++     S VP  ++  P + + NA FPEEY +ET TGLVP+ TL+ M
Sbjct: 44  TRTETVKTLQDLGVT-SHVPVPDINAPQSSKKNAIFPEEYTMETTTGLVPVATLQSM 99

>CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138c
          Length = 630

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 84  TETVATLRETE-SKLSKVPTENVLPATMENNAAFPEEYRIETKTGLVPIKTLEEM 137
           TETV +L+E   ++ + +P  N  P T   NA FPEEY +ET TGLVP+ TL+ +
Sbjct: 51  TETVKSLQEMGMTQDAPIPDVNA-PQTTTKNAIFPEEYTMETPTGLVPVATLQSL 104

>NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503
          Length = 626

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 84  TETVATLRETE-SKLSKVPTENVLPATMENNAAFPEEYRIETKTGLVPIKTLEEM 137
           TETV TL++   ++ + VP  N  P T   N  FPEEY +ET TGLVP+ TL+ +
Sbjct: 52  TETVKTLQDLGVTRDAPVPDVNA-PQTSARNTIFPEEYTMETTTGLVPVSTLQSL 105

>KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.503
           YPR156C
          Length = 622

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 84  TETVATLRETE-SKLSKVPTENVLPATMENNAAFPEEYRIETKTGLVPIKTLEEM 137
           TETV +L++   +K + +P  N  P T +  A FPEEY +ET TGLVP+ TL+ +
Sbjct: 51  TETVKSLQDMGMTKNAPIPDVNA-PQTAKKTAIFPEEYTMETPTGLVPVATLQSI 104

>Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]
           {ON} YGR138C (TPO2) -  [contig 188] FULL
          Length = 640

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 84  TETVATLRETE-SKLSKVPTENVLPATMENNAAFPEEYRIETKTGLVPIKTLEEM 137
           TETV +L+E   +  + +P  N   A     A FPEEY +ET TGLVP+ TL+ +
Sbjct: 51  TETVKSLQEMGVTPEAPLPDVNAPAAATSGKAIFPEEYTLETATGLVPVATLQSL 105

>YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}
           TPO2Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; transcription of TPO2
           is regulated by Haa1p; member of the major facilitator
           superfamily
          Length = 614

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 3/55 (5%)

Query: 84  TETVATLRETE-SKLSKVPTENVLPATMENNAAFPEEYRIETKTGLVPIKTLEEM 137
           TETV +L++   +  + VP  N  P T +NN  FPEEY +ET +GLVP+ TL+ M
Sbjct: 45  TETVKSLQDLGVTSAAPVPDINA-PQTAKNNI-FPEEYTMETPSGLVPVATLQSM 97

>Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON}
           YGR138C (REAL)
          Length = 611

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 3/55 (5%)

Query: 84  TETVATLRETE-SKLSKVPTENVLPATMENNAAFPEEYRIETKTGLVPIKTLEEM 137
           TETV +L++   +  + VP  N  P T +NN  FPEEY +ET +GLVP+ TL+ M
Sbjct: 45  TETVKSLQDLGVTSAAPVPDINA-PKTAKNNI-FPEEYTMETPSGLVPVATLQSM 97

>Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON}
           YGR138C (REAL)
          Length = 613

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 3/55 (5%)

Query: 84  TETVATLRETE-SKLSKVPTENVLPATMENNAAFPEEYRIETKTGLVPIKTLEEM 137
           TETV +L++   +  + VP  N  P T +NN  FPEEY +ET +GLVP+ TL+ M
Sbjct: 45  TETVKSLQDLGVTSAAPVPDINA-PQTAKNNI-FPEEYTMETPSGLVPVATLQSM 97

>Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 84  TETVATLRETESKLSKVPTENVLPATMENNAAFPEEYRIETKTGLVPIKTLEEM 137
           TETV +L++     S+ P  +V       N  FPEEY IET TGLVP+ TL  +
Sbjct: 50  TETVKSLQDMGVS-SRAPVPDVNAPQSSKNKIFPEEYTIETPTGLVPVATLHSI 102

>TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa]
           {ON} Anc_3.503 YPR156C
          Length = 616

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 84  TETVATLRETE-SKLSKVPTENVLPATMENNAAFPEEYRIETKTGLVPIKTLEEM 137
           TETV +L+E   +  + VP  N  P T      FPEEY +ET TGLVP+ TL+ +
Sbjct: 45  TETVKSLQEMGMTATAPVPDVNA-PQTTARPQIFPEEYTMETPTGLVPVATLQSI 98

>YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON}
           TPO3Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; member of the major
           facilitator superfamily
          Length = 622

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 84  TETVATLRETESKLSKVPTENVLPATMENNAAFPEEYRIETKTGLVPIKTLEEM 137
           TETV +L++     SK P  +V       N  FPEEY +ET TGLVP+ TL  +
Sbjct: 50  TETVKSLQDMGVS-SKAPVPDVNAPQSSKNKIFPEEYTLETPTGLVPVATLHSI 102

>KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {ON}
           Anc_3.503 YPR156C
          Length = 624

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 20/25 (80%)

Query: 113 NAAFPEEYRIETKTGLVPIKTLEEM 137
           NA FPEEY IET TGLVP+ TL+ +
Sbjct: 80  NAIFPEEYTIETTTGLVPVATLQSL 104

>Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON}
           YGR138C (REAL)
          Length = 614

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (63%), Gaps = 3/55 (5%)

Query: 84  TETVATLRETESKLSKVPTENV-LPATMENNAAFPEEYRIETKTGLVPIKTLEEM 137
           TETV +L++     S  P  ++  P T +NN  FPEEY +ET +GLVP+ TL+ M
Sbjct: 45  TETVKSLQDLGVT-SNAPVPDINAPQTAKNNI-FPEEYTMETPSGLVPVATLQSM 97

>Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 84  TETVATLRETESKLSKVPTENVLPATMENNAAFPEEYRIETKTGLVPIKTLEEM 137
           TETV +L++     SK P  +V       N  FPEEY +ET TGLVP+ TL  +
Sbjct: 50  TETVKSLQDMGVS-SKAPIPDVNAPQSSKNKIFPEEYTLETPTGLVPVATLHSI 102

>Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 84  TETVATLRETESKLSKVPTENVLPATMENNAAFPEEYRIETKTGLVPIKTLEEM 137
           TETV +L++     SK P  +V       N  FPEEY +ET TGLVP+ TL  +
Sbjct: 50  TETVKSLQDMGVS-SKAPVPDVNAPQSGKNKIFPEEYTLETPTGLVPVATLHSI 102

>KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly
           similar to uniprot|Q06451 Saccharomyces cerevisiae
           YPR156C TPO3 Polyamine transport protein
          Length = 609

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 24/38 (63%)

Query: 100 VPTENVLPATMENNAAFPEEYRIETKTGLVPIKTLEEM 137
           +P  N    ++  NA FPEEY +ET TGLVP+ TL  +
Sbjct: 65  IPDFNAPTTSVAKNAIFPEEYTLETATGLVPVATLHSL 102

>KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 644

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 35/56 (62%), Gaps = 3/56 (5%)

Query: 84  TETVATLRETESKLSKVPTENV-LPATMENNAA-FPEEYRIETKTGLVPIKTLEEM 137
           TETV +L++      + P  +V  P T +  AA FPEEY +ET TGLVP+ TL+ +
Sbjct: 57  TETVKSLQDMGVT-PEAPLPDVNAPTTGKGGAAIFPEEYTLETATGLVPVATLQSL 111

>TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {ON}
           Anc_3.503 YPR156C
          Length = 613

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 82  NNTETVATLRETESKLSKVPTENVLPATMENNAAFPEEYRIETKTGLVPIKTLEEM 137
           + TETV +L++     S  P  +V   T   ++ FPEEY +ET TGLVP+ TL  +
Sbjct: 43  SRTETVKSLQDMGLT-SDAPIPDVNAPTSNKHSIFPEEYTMETPTGLVPVATLHSL 97

>ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} similar
           to uniprot|P53283 Saccharomyces cerevisiae YGR138C TPO2
           Polyamine transport protein
          Length = 594

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 36/67 (53%), Gaps = 2/67 (2%)

Query: 71  IEKIVTRNALENNTETVATLRETESKLSKVPTENVLPATMENNAAFPEEYRIETKTGLVP 130
           +E+ VT  AL  + ET  TL +T       P  +V+  T      FPEEY +ET +G+VP
Sbjct: 28  LEQDVTSRALSRH-ETAETL-QTMGMARGTPLPDVVAPTYAAAPVFPEEYTMETPSGIVP 85

Query: 131 IKTLEEM 137
           +  LE +
Sbjct: 86  LAQLESL 92

>TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.503
           YPR156C
          Length = 691

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 41/81 (50%), Gaps = 8/81 (9%)

Query: 57  TSETNTLKVNSSNEIEKIVTRNALENNTETVATLRETESKLSKVPTENVLPATMENNAAF 116
           T+ TN     S+N+  K+V        TETV +L +     S +P   +        A F
Sbjct: 51  TTPTNRSSNASTNQRLKLV-------KTETVKSLIDMGVS-SYIPNPAINAPKTSKKAIF 102

Query: 117 PEEYRIETKTGLVPIKTLEEM 137
           PEEY +ET+TGLVP+ TL  +
Sbjct: 103 PEEYTLETETGLVPVSTLHSL 123

>NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {ON}
           Anc_3.503 YGR138C
          Length = 634

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 84  TETVATLRETESKLSKVPTENV-LPATMENNAAFPEEYRIETKTGLVPIKTLEEM 137
           TET  TL++     S+ P  ++  P   +  A FPEEY +ET TGLVP+ TL+ +
Sbjct: 50  TETAKTLQDM-GMTSEAPLPDINAPQGSKKPAIFPEEYTMETPTGLVPVVTLQSI 103

>Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON}
           (12526..14391) [1866 nt, 622 aa]
          Length = 621

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 82  NNTETVATLRETESKLSKVPTENVLPATMENNAAFPEEYRIETKTGLVPIKTLEEM 137
           + TETV +L++     S+ P   V          FPEEY +ET TGLVP+ TL+ +
Sbjct: 46  SRTETVKSLQDM-GMTSEAPIPGVNAPQTSRVQIFPEEYTMETPTGLVPVATLQSL 100

>AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR138C
           (TPO2) and YPR156C (TPO3)
          Length = 592

 Score = 35.8 bits (81), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 84  TETVATLRETESKLSKVPTENVLPATMENNAAFPEEYRIETKTGLVPIKTLEEM 137
           TETV +L+E     S+ P  +V   +      FPEEY +ET TGLV I TL  +
Sbjct: 45  TETVKSLQEMGLS-SEKPIPDVNAPSTSAGVIFPEEYTLETPTGLVKIATLVSL 97

>SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 610

 Score = 35.8 bits (81), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 14/22 (63%), Positives = 17/22 (77%)

Query: 116 FPEEYRIETKTGLVPIKTLEEM 137
           FPEEY +ET TGLVP+ TL  +
Sbjct: 75  FPEEYTMETPTGLVPVATLHSI 96

>Skud_7.133 Chr7 (250133..252541) [2409 bp, 802 aa] {ON} YGL139W
           (REAL)
          Length = 802

 Score = 31.2 bits (69), Expect = 2.8,   Method: Composition-based stats.
 Identities = 29/111 (26%), Positives = 50/111 (45%), Gaps = 15/111 (13%)

Query: 40  DSNND---NDTGVFNKTKSGTSETNTLKVNSSNE-----IEKIVTR-NALENNTETVATL 90
           + N+D   NDTG+ ++ K G  E       SS++      EKI+++    + N  ++  L
Sbjct: 632 NDNSDYESNDTGMNDELKQGQDEATPTTATSSDDNRLTLSEKILSKFTRPKANNASIEVL 691

Query: 91  RETESKLSKVPTENVLPATMEN-----NAAFPEEYRIETKTGLVPIKTLEE 136
           R+  SK    P  N+   + EN     + ++P   R ++      I T EE
Sbjct: 692 RDETSKQQTFP-HNLTNLSRENLSTLGSKSYPGHTRSQSDANNGLINTFEE 741

>YGL139W Chr7 (245716..248124) [2409 bp, 802 aa] {ON}  FLC3Putative
           FAD transporter, similar to Flc1p and Flc2p; localized
           to the ER
          Length = 802

 Score = 30.4 bits (67), Expect = 5.1,   Method: Composition-based stats.
 Identities = 19/76 (25%), Positives = 32/76 (42%), Gaps = 3/76 (3%)

Query: 40  DSNND---NDTGVFNKTKSGTSETNTLKVNSSNEIEKIVTRNALENNTETVATLRETESK 96
           D N+D   NDTGV ++ K    ET    V SS++ +   +   L   +        T++ 
Sbjct: 632 DDNSDYESNDTGVNDELKQAQDETTPTTVTSSDDNKPTFSEKILSKFSRPKNENASTDAL 691

Query: 97  LSKVPTENVLPATMEN 112
             + P +   P  + N
Sbjct: 692 RVEAPKQQTFPHNLTN 707

>NDAI0J00880 Chr10 complement(194614..198489) [3876 bp, 1291 aa]
           {ON} Anc_8.340 YDR159W
          Length = 1291

 Score = 30.0 bits (66), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 84  TETVATLRETESKLSKVPTENVLPATMEN-NAAFPEEYRIETKTGLVPIKTLE 135
           +++++TLR+ E  +S VP+ N+  +T+ N N   P  + ++T T   PI T E
Sbjct: 609 SDSLSTLRKDEFLISAVPSTNLQSSTLGNINLESPPSFNLDTGTTSKPIITTE 661

>Kpol_1064.39 s1064 complement(71731..73998) [2268 bp, 755 aa] {ON}
           complement(71731..73998) [2268 nt, 756 aa]
          Length = 755

 Score = 29.6 bits (65), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 4/62 (6%)

Query: 53  TKSGTSETNTLKVNSSNEIEKIVTRNALENNTET---VATLRETESKLSKVPTENVLPAT 109
           +KS     N+L + S N++E I TRN   N TET      +++  S L K+P   +L   
Sbjct: 224 SKSLQCSLNSLNIESQNDLEVIATRNFF-NTTETDKLTVAVQQLLSHLFKIPNSELLLVI 282

Query: 110 ME 111
            +
Sbjct: 283 CD 284

>AER213C Chr5 complement(1028170..1029843) [1674 bp, 557 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL013W
           (HEX3)
          Length = 557

 Score = 29.6 bits (65), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 26/48 (54%)

Query: 174 DKDVEQKEKHPAEHLPHGKLEQKNIDIVVERNKKQLEKWEEHKHEINP 221
           D +  ++E    E+LP   L Q+   ++ ER ++Q E   +H+H  +P
Sbjct: 176 DGEPSEREASDREYLPQSVLRQRQQALMQERLQRQREHARQHEHIADP 223

>SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa]
           {ON} similar to uniprot|P15442 Saccharomyces cerevisiae
           YDR283C GCN2 Protein kinase phosphorylates the alpha-
           subunit of translation initiation factor eIF2 (Sui2p) in
           response to starvation activated by uncharged tRNAs and
           the Gcn1p-Gcn20p complex
          Length = 1674

 Score = 29.6 bits (65), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 6/54 (11%)

Query: 76  TRNALENNTETVATLRETESKLSKVPTENVLPATMENN------AAFPEEYRIE 123
            RNAL++    +  +R TE KLS + +E +L A++ +       AA+ EE  +E
Sbjct: 618 ARNALDSRYYAIKKIRHTEEKLSTILSEVMLLASLNHQYVVRYYAAWLEENTVE 671

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.305    0.124    0.334 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,512,269
Number of extensions: 1044636
Number of successful extensions: 6844
Number of sequences better than 10.0: 253
Number of HSP's gapped: 6728
Number of HSP's successfully gapped: 276
Length of query: 234
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 128
Effective length of database: 41,326,803
Effective search space: 5289830784
Effective search space used: 5289830784
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 64 (29.3 bits)