Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1016.45.437ON41341320590.0
Smik_4.6365.437ON4463757367e-93
YDR370C5.437ON4423867313e-92
TDEL0B021805.437ON4184037278e-92
Skud_4.6395.437ON4423757262e-91
KAFR0E038205.437ON3963797171e-90
Suva_2.5425.437ON4423757105e-89
TPHA0J026005.437ON4413906829e-85
NDAI0B056905.437ON4233876348e-78
ZYRO0F10098g5.437ON3733676299e-78
NCAS0F034005.437ON4153956182e-75
TBLA0A028005.437ON4533975793e-69
KNAG0C048905.437ON4053895457e-65
CAGL0A02860g5.437ON4023595073e-59
SAKL0G02596g5.437ON4003774742e-54
Kwal_55.214155.437ON3893734122e-45
KLTH0F15994g5.437ON3903694017e-44
AER404C5.437ON3863693587e-38
KLLA0E02245g5.437ON4033833501e-36
Kwal_55.21591na 1ON469201960.003
SAKL0F00726g3.570ON383118830.091
Ecym_26003.570ON384149820.13
KAFR0J001603.570ON380188820.14
TPHA0G036503.570ON377194820.15
NDAI0I032603.570ON377198810.17
KLTH0G00660g3.570ON383210760.82
Kwal_47.192763.570ON386124741.3
KLTH0F16962gna 1ON49981731.6
NCAS0E002403.570ON380119695.1
TDEL0D063803.570ON37853686.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1016.4
         (413 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}...   797   0.0  
Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {...   288   7e-93
YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}...   286   3e-92
TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.4...   284   8e-92
Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {...   284   2e-91
KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.4...   280   1e-90
Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON...   278   5e-89
TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {...   267   9e-85
NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON} Anc_5...   248   8e-78
ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {...   246   9e-78
NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {O...   242   2e-75
TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.4...   227   3e-69
KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.4...   214   7e-65
CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {...   199   3e-59
SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {...   187   2e-54
Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370...   163   2e-45
KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weak...   159   7e-44
AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}...   142   7e-38
KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {...   139   1e-36
Kwal_55.21591 s55 complement(904533..905942) [1410 bp, 469 aa] {...    42   0.003
SAKL0F00726g Chr6 complement(63291..64442) [1152 bp, 383 aa] {ON...    37   0.091
Ecym_2600 Chr2 (1167583..1168737) [1155 bp, 384 aa] {ON} similar...    36   0.13 
KAFR0J00160 Chr10 complement(26405..27547) [1143 bp, 380 aa] {ON...    36   0.14 
TPHA0G03650 Chr7 (776977..778110) [1134 bp, 377 aa] {ON} Anc_3.5...    36   0.15 
NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570     36   0.17 
KLTH0G00660g Chr7 complement(44243..45394) [1152 bp, 383 aa] {ON...    34   0.82 
Kwal_47.19276 s47 (1168248..1169408) [1161 bp, 386 aa] {ON} YGL2...    33   1.3  
KLTH0F16962g Chr6 complement(1373279..1374778) [1500 bp, 499 aa]...    33   1.6  
NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}...    31   5.1  
TDEL0D06380 Chr4 (1146443..1147579) [1137 bp, 378 aa] {ON} Anc_3...    31   6.0  

>Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}
           (8493..9362,9366..9737) [1242 nt, 414 aa]
          Length = 413

 Score =  797 bits (2059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/413 (96%), Positives = 398/413 (96%)

Query: 1   MDEHINDVQTQLSNLKIGEDNPSRKVKQNKSRPKKNVINIIPFHRFVHSNARSFPQKTKD 60
           MDEHINDVQTQLSNLKIGEDNPSRKVKQNKSRPKKNVINIIPFHRFVHSNARSFPQKTKD
Sbjct: 1   MDEHINDVQTQLSNLKIGEDNPSRKVKQNKSRPKKNVINIIPFHRFVHSNARSFPQKTKD 60

Query: 61  LFLESKTVAFFQKDQLFINVEDAALPLLKKDIANISGKSVLNSKKYKLPYLGSDLYASTD 120
           LFLESKTVAFFQKDQLFINVEDAALPLLKKDIANISGKSVLNSKKYKLPYLGSDLYASTD
Sbjct: 61  LFLESKTVAFFQKDQLFINVEDAALPLLKKDIANISGKSVLNSKKYKLPYLGSDLYASTD 120

Query: 121 KYGPLPEDVLDSPKPCFDFIRHWENEHRGEHYGAHADYTILSPRHHITEIVMSLFEDEKN 180
           KYGPLPEDVLDSPKPCFDFIRHWENEHRGEHYGAHADYTILSPRHHITEIVMSLFEDEKN
Sbjct: 121 KYGPLPEDVLDSPKPCFDFIRHWENEHRGEHYGAHADYTILSPRHHITEIVMSLFEDEKN 180

Query: 181 CSVYLLCTYLKNGIILLSKDDAXXXXXXXXXXXXXXXPMTRKICYSGFAFEDLVLEDIAE 240
           CSVYLLCTYLKNGIILLSKDDA               PMTRKICYSGFAFEDLVLEDIAE
Sbjct: 181 CSVYLLCTYLKNGIILLSKDDASSSSNSNTTGLNSSNPMTRKICYSGFAFEDLVLEDIAE 240

Query: 241 NARPIFSVVESKLTESINLLLRNELDGYNNVTNMFTELKCFAPLKCMFSAKEVLKTWVQT 300
           NARPIFSVVESKLTESINLLLRNELDGYNNVTNMFTELKCFAPLKCMFSAKEVLKTWVQT
Sbjct: 241 NARPIFSVVESKLTESINLLLRNELDGYNNVTNMFTELKCFAPLKCMFSAKEVLKTWVQT 300

Query: 301 GLIPESDIVIGIRDTQSGLLEDLVWYNRKDLCRTFNNPSLPPAPSHFNFNANIAVEWLKF 360
           GLIPESDIVIGIRDTQSGLLEDLVWYNRKDLCRTFNNPSLPPAPSHFNFNANIAVEWLKF
Sbjct: 301 GLIPESDIVIGIRDTQSGLLEDLVWYNRKDLCRTFNNPSLPPAPSHFNFNANIAVEWLKF 360

Query: 361 TMESIVSLVSSSIADSNHPCSFKLKIDNHKTISIQKLSRIPQTVQRQIPKEFV 413
           TMESIVSLVSSSIADSNHPCSFKLKIDNHKTISIQKLSRIPQTVQRQIPKEFV
Sbjct: 361 TMESIVSLVSSSIADSNHPCSFKLKIDNHKTISIQKLSRIPQTVQRQIPKEFV 413

>Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {ON}
           YDR370C (REAL)
          Length = 446

 Score =  288 bits (736), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 155/375 (41%), Positives = 224/375 (59%), Gaps = 12/375 (3%)

Query: 41  IPFHRFVHSNARSFPQKT-KDLFLESKTVAFFQKDQLFINVEDAALPLLKKDIANISGKS 99
           + +  F HS    FP K  +D+F ESK VA F   Q +  V    LP LK DIA +  +S
Sbjct: 66  VSYTSFSHSGMHKFPAKPPRDIFHESKEVALFTNGQAYTTVRKDILPNLKGDIAELCERS 125

Query: 100 VLNSKKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHWENEHRGEHYGAHADYT 159
           +L++++ KLPYLG DL+A+  ++ P+    LDS  PC  +I +W   + GE +     +T
Sbjct: 126 LLDARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRLNNHGEDFKIGRKFT 185

Query: 160 ILSPRHHITEIVMSLFEDEKNCSVYLLCTYLKNGIILLSKDDAXXXXXXXXXXXXXXXPM 219
           +++ RHHI ++ M LF D +N    L+ TY+  G+I  S++                 P 
Sbjct: 186 VVTTRHHIVDMTMHLF-DRRNKKRSLVATYMGAGLISFSRNQK-NDSRMSKEGIYSSDPN 243

Query: 220 TRKICYSGFAFEDLVLE-----DIAENARPIFSVVESKLTESINLLLRNELDGYNNVTNM 274
            +KICYSGF FE+ V E     D+  +  P+FSVVESKL+E I LL+R E+D +N V+  
Sbjct: 244 MKKICYSGFEFENWVTEGIKAADLNGSKLPVFSVVESKLSEEIGLLIRCEMDAFNPVSGA 303

Query: 275 FTELKCFAPLKCMFS--AKEVLKTWVQTGLIPESDIVIGIRDTQSGLLEDLVWYNRKDLC 332
            TELKCFAPL    S   +++LKTW+QTGL P SDI+IG+RD+ SG L D+ WY+R  LC
Sbjct: 304 NTELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDIQWYSRDSLC 363

Query: 333 RTFNNPSLPPAPSHFNFNANIAVEWLKFTMESIVSLVSSSIAD--SNHPCSFKLKIDNHK 390
             FN+  LP      N+NA +AVEW    ++SI  L+ ++I+D    +P SF++ ID++ 
Sbjct: 364 MKFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDYSCKNPESFEISIDSNN 423

Query: 391 TISIQKLSRIPQTVQ 405
           TI+I KL  IP+ V+
Sbjct: 424 TIAITKLKNIPKHVE 438

>YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}
           Putative protein of unknown function
          Length = 442

 Score =  286 bits (731), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 157/386 (40%), Positives = 231/386 (59%), Gaps = 15/386 (3%)

Query: 30  KSRPKKNVINIIPFHRFVHSNARSFPQKT-KDLFLESKTVAFFQKDQLFINVEDAALPLL 88
           K RPK   +  IP+  F+H+   +F  K  +D+F ESK VA F   + +  +    +P L
Sbjct: 58  KRRPK---LICIPYTSFLHTGMHNFLTKPPRDIFHESKEVALFTNGRAYTILRKDLIPNL 114

Query: 89  KKDIANISGKSVLNSKKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHWENEHR 148
           K+ IA +   S+L +KK K+PYLG DL+A+ D++ P+    LDS  PCF +I +W  ++ 
Sbjct: 115 KESIAELYESSLLEAKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYIENWILDNP 174

Query: 149 GEHYGAHADYTILSPRHHITEIVMSLFEDEKNCSVYLLCTYLKNGIILLSKDDAXXXXXX 208
           G+ +     +T+++ RHHI ++ M LF + +N    L+ TY+  G++   ++        
Sbjct: 175 GKDFKIGKKFTVVTTRHHIVDLTMHLF-NRRNRQTSLIVTYMGAGLLSFCRN-VKKDSQM 232

Query: 209 XXXXXXXXXPMTRKICYSGFAFEDLVLE-----DIAENARPIFSVVESKLTESINLLLRN 263
                    P  +KICYSGF FE+ V E     D+  +  PIFS+VESKL+E I LL+R 
Sbjct: 233 SKEGIYSNDPNMKKICYSGFEFENWVTENSKVADLTGSKCPIFSLVESKLSEEIGLLIRC 292

Query: 264 ELDGYNNVTNMFTELKCFAPLKCMFS--AKEVLKTWVQTGLIPESDIVIGIRDTQSGLLE 321
           E+D +N V+   TELKCFAPL    S   +++LKTWVQTGL+P SDI+IG+RD+ SG L 
Sbjct: 293 EMDAFNPVSETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSHSGQLL 352

Query: 322 DLVWYNRKDLCRTFNNPSLPPAPSHFNFNANIAVEWLKFTMESIVSLVSSSIAD--SNHP 379
           D+ WY+R  LC+ FN+P LP      N+NA IAVEW  + +E+I  LV ++I+D  S  P
Sbjct: 353 DIQWYSRDLLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANISDYSSTKP 412

Query: 380 CSFKLKIDNHKTISIQKLSRIPQTVQ 405
            SF++ ID +  I I KL   P+ V+
Sbjct: 413 ESFEIGIDTNNAIVITKLKTTPRNVE 438

>TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.437
           YDR370C
          Length = 418

 Score =  284 bits (727), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 164/403 (40%), Positives = 230/403 (57%), Gaps = 22/403 (5%)

Query: 19  EDNPSRKVKQNKSRPKKNVINIIPFHRFVHSNARSFPQKTKDLFLESKTVAFFQKDQLFI 78
           +D+P    KQ + +        IPF +F HS+   FP  T D F   + VA +Q   LF+
Sbjct: 28  QDSPHGPSKQRRKQQSGKRTVCIPFSKFEHSDLDYFPDDTADFFEGCEEVATYQNGYLFM 87

Query: 79  --NVEDAALPLLKKDIANISGKSVLNSKKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPC 136
             + +    P L+   A I+        K KLPY+G DLY   ++Y PLP   LDS   C
Sbjct: 88  KDSSKKPLYPCLQMFAALIAEN---RGPKNKLPYIGCDLYQGHERYKPLPSSELDSSIAC 144

Query: 137 FDFIRHWENEHRGEHYGAHADYTILSPRHHITEIVMSLFEDEKNCSVYLLCTYLKNGIIL 196
           F++I+ WE     + + +    TI+SPRHH+ ++VM+LF D++   V ++CT +  G ++
Sbjct: 145 FEYIKKWERRKISKSFNS-GKVTIISPRHHVVDLVMALFHDDE---VSIICTNIGKGKLI 200

Query: 197 LSKDDAXXXXXXXXXXXXXXXPMTRKICYSGFAFEDLVLEDIAENARPIFSVVESKLTES 256
            S D +                MTRKICYSGFA ED +     E   P +S+VE K+ E 
Sbjct: 201 FSGDRSKEERNGLNSKNS----MTRKICYSGFALEDKLTTSHDERMGPFYSIVEGKINER 256

Query: 257 INLLLRNELDGYNNVTNMFTELKCFAPLKCMFSA--KEVLKTWVQTGLIPESDIVIGIRD 314
           ++LLLR E+D YN + N +TELKCF  L    +A  +++LKTWVQ GLIP+SD++IG RD
Sbjct: 257 LSLLLRCEMDAYNPIFNRYTELKCFTKLNVQDTAHRRKLLKTWVQIGLIPDSDLIIGTRD 316

Query: 315 TQSGLLEDLVWYNRKDLCRTFNNPSLPPAPSHFNFNANIAVEWLKFTMESIVSLV---SS 371
           TQ G LEDL WY+R  L + FNNPS+     + NFNANIAVEW    +ESI  LV   S 
Sbjct: 317 TQVGQLEDLTWYSRGSLYKKFNNPSIARNNKYLNFNANIAVEWCFHCIESICDLVMKNSL 376

Query: 372 SIADSNHPC--SFKLKIDNHKTISIQKLSRIPQTVQRQIPKEF 412
           S  D  +P   SFK+ +D    I ++KL+++P+ V  QIP+ F
Sbjct: 377 SSPDDPYPKYESFKVIVDKSHNIIVKKLTKVPRHV--QIPRAF 417

>Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  284 bits (726), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 152/375 (40%), Positives = 223/375 (59%), Gaps = 12/375 (3%)

Query: 41  IPFHRFVHSNARSFPQKT-KDLFLESKTVAFFQKDQLFINVEDAALPLLKKDIANISGKS 99
           +P+  FVH++     +K   D+F +SK VA F   Q +       +P L+  I  +   S
Sbjct: 66  VPYTSFVHTSIHDLSRKPPGDIFQDSKEVALFTNYQAYTTARKDLIPSLRDGITELYESS 125

Query: 100 VLNSKKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHWENEHRGEHYGAHADYT 159
           +L +++ K+PYLG DL+A+ D++ P+    LDS  PC  ++ +W+  + G+++     +T
Sbjct: 126 LLEARRRKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWKLSNHGKNFKIGKKFT 185

Query: 160 ILSPRHHITEIVMSLFEDEKNCSVYLLCTYLKNGIILLSKDDAXXXXXXXXXXXXXXXPM 219
           I+S RHHI ++ M  F D +N    L+ TY+  G+I  S++                 P 
Sbjct: 186 IVSARHHIVDLTMHRF-DRRNKRKSLIVTYMGAGLISFSRN-PKNDFQMSKEGIYSSDPN 243

Query: 220 TRKICYSGFAFEDLVLEDIAEN-----ARPIFSVVESKLTESINLLLRNELDGYNNVTNM 274
            +KICYSGF FE  V EDI          PIFSVVESKL+E I LL+R E+D +N V+  
Sbjct: 244 MKKICYSGFEFEHWVTEDIKATDLNGPKHPIFSVVESKLSEDIGLLMRCEIDAFNPVSRT 303

Query: 275 FTELKCFAPLKCMFS--AKEVLKTWVQTGLIPESDIVIGIRDTQSGLLEDLVWYNRKDLC 332
            TELKCF PL    S   K++LKTW+QTGL+P SDIVIG+RD+ SG L D+ WY+R  L 
Sbjct: 304 NTELKCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQLLDIQWYSRDSLY 363

Query: 333 RTFNNPSLPPAPSHFNFNANIAVEWLKFTMESIVSLVSSSIA--DSNHPCSFKLKIDNHK 390
           + FN+P LPP+    NFNA +AVEW    ++SI  LV ++I+  +S  P SF++ ID + 
Sbjct: 364 KKFNHPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEANISHYNSTRPESFEVSIDANG 423

Query: 391 TISIQKLSRIPQTVQ 405
           TI+I KL+ +P+ V+
Sbjct: 424 TIAITKLNTVPKNVE 438

>KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.437
           YDR370C
          Length = 396

 Score =  280 bits (717), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 153/379 (40%), Positives = 229/379 (60%), Gaps = 16/379 (4%)

Query: 40  IIPFHRFVHSNARSFPQKTKDLFLESKTVAFFQKDQLFINVEDAA--LPLLKKDIANIS- 96
           + PF RF H +   FP    + F  S+ VA +   +++   E +   LPLL KDI+ I+ 
Sbjct: 29  VSPFKRFQHRSIAYFPNHPANFFQISREVATYHDGRIYEPNETSQDILPLLNKDISKIAQ 88

Query: 97  GKSVLNSKKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHWENEHRGEHYGAHA 156
           G S ++++KYK+ Y+GSDLY   + +  +  + LDS  PCF +I+ WE  H  + Y  + 
Sbjct: 89  GVSAIDARKYKVKYIGSDLYQGFENFESMSREELDSALPCFAYIKKWEAHHHCK-YTENK 147

Query: 157 DYTILSPRHHITEIVMSLFEDEKNCSVYLLCTYLKNGIILLSKDDAXXXXXXXXXXXXXX 216
            YTI+S RHHI  ++MS+F+  K   V    TYL NG++  S+D +              
Sbjct: 148 KYTIVSARHHIVNLIMSIFDTSKETIVN--STYLGNGLLTFSQDTSDPMTMNEGIFTKNK 205

Query: 217 XPMTRKICYSGFAFEDLVLEDIAENARPIFSVVESKLTESINLLLRNELDGYNNVTNMFT 276
               +KICYSGFA EDL+ +   E   P+FS+ E++L ++I LLLR E+D YN +T  +T
Sbjct: 206 N--LKKICYSGFALEDLLTKSQKE---PLFSITENQLDDNITLLLRCEMDAYNQLTQNYT 260

Query: 277 ELKCFAPLKCMFSA--KEVLKTWVQTGLIPESDIVIGIRDTQSGLLEDLVWYNRKDLCRT 334
           ELKC+APLK       K++LKTW+QTG++P SD++ GIR   +G L D+ WY+R  L R 
Sbjct: 261 ELKCYAPLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGELLDIEWYSRDGLYRR 320

Query: 335 FNNPSLPPAPSHFNFNANIAVEWLKFTMESIVSLVSSSIADSNHPCSFKLKIDNHKTISI 394
           FNN +LP      NFNANIAVEW    +++I  L+S ++   + P +F++K+D  + ISI
Sbjct: 321 FNNRNLPENKKSLNFNANIAVEWSHHCIKTICELISDNL-QGDAPQAFQIKVDTFRNISI 379

Query: 395 QKLSRIPQTVQRQIPKEFV 413
           + LS+IPQ    QIP++++
Sbjct: 380 RNLSKIPQNA--QIPRQYL 396

>Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  278 bits (710), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 148/375 (39%), Positives = 225/375 (60%), Gaps = 12/375 (3%)

Query: 41  IPFHRFVHSNARSFPQKTK-DLFLESKTVAFFQKDQLFINVEDAALPLLKKDIANISGKS 99
           +P+  F+H++ R+FP K   D+F ESK VA F  +QL++      +P LK+DI+++    
Sbjct: 66  VPYSSFLHTSIRNFPTKPPPDIFYESKEVALFTDNQLYVAARKDVIPNLKEDISHLYESP 125

Query: 100 VLNSKKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHWENEHRGEHYGAHADYT 159
           +L ++K K  YLG DL+A+ D+  P+    LD+  PC  +I  W   + G+ +     +T
Sbjct: 126 LLEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNNSGKPFKIGKKFT 185

Query: 160 ILSPRHHITEIVMSLFEDEKNCSVYLLCTYLKNGIILLSKDDAXXXXXXXXXXXXXXXPM 219
           +++ RHHI ++ M  F D +N    ++ TY+ NG I LS++                 P 
Sbjct: 186 VVTTRHHIVDLTMHPF-DRRNKQKSIIATYMGNGFISLSRN-PKYDHKASKEGIYSGDPN 243

Query: 220 TRKICYSGFAFEDLVLEDIAENAR-----PIFSVVESKLTESINLLLRNELDGYNNVTNM 274
            +KIC+SGF FE+ + E+   +       P+FS+VE KL+E I LL+R E+D +N V+  
Sbjct: 244 IKKICHSGFEFENCLTENTKNSGSSASKCPVFSIVEGKLSEDIGLLMRCEMDAFNPVSKT 303

Query: 275 FTELKCFAPLKCMFSA--KEVLKTWVQTGLIPESDIVIGIRDTQSGLLEDLVWYNRKDLC 332
            TELKCF PL    S+  K++LKTW+QTGL+P SDI++G+RD+ SG L D+ WY+R  L 
Sbjct: 304 NTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLDIQWYSRDTLF 363

Query: 333 RTFNNPSLPPAPSHFNFNANIAVEWLKFTMESIVSLVSSSIA--DSNHPCSFKLKIDNHK 390
           R FN+P LP      N+NA +AVEW K  ++SI  LV ++I+  + N P  F++ ID + 
Sbjct: 364 RKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISRYNCNKPEPFEINIDANG 423

Query: 391 TISIQKLSRIPQTVQ 405
           TI I KLS IP+ V+
Sbjct: 424 TIIITKLSTIPRNVE 438

>TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {ON}
           Anc_5.437 YDR370C
          Length = 441

 Score =  267 bits (682), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 150/390 (38%), Positives = 240/390 (61%), Gaps = 18/390 (4%)

Query: 36  NVINIIPFHRFVHSNARSFPQKTKDLFLESKTVA-FFQKDQLFINVEDAAL------PLL 88
           ++I  IPF  F +SNA    +   ++F E+K VA ++ K    I   +A L      P L
Sbjct: 58  DIIARIPFKHFSYSNAH-IGKSQPNIFQEAKGVALYYDKRITKITNNEAELINESNPPFL 116

Query: 89  KKDIANISGKSVLNSKKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHWENEHR 148
            KDI+N+S  S+L+SKK+KLPY+G +LY   +K+GP+   +LDS  PCF+++R  +    
Sbjct: 117 TKDISNLSEISLLDSKKFKLPYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYLRTLKISEE 176

Query: 149 GEHYGAHADYTILSPRHHITEIVMSLFEDEKN--CSVYLLCTYLKNGIILLSKDDAXXXX 206
            + Y  +  YT ++PRHH+TE++M+++E  ++       L T +K+ +I++S+D A    
Sbjct: 177 DKLY--NTPYTFMTPRHHLTELMMTVYESRESELTGKSWLFTRIKDDLIVISEDLAKENN 234

Query: 207 XXXXXXXXXXXPMTRKICYSGFAFEDLVLEDIAENARPIFSVVESKLTESINLLLRNELD 266
                        ++K+  SGF FE+LV+E+  E  +P F + E++LT     ++R+E+D
Sbjct: 235 PSPQNHKLQNS-FSKKVINSGFTFEELVIENFQECHKPYFYISENRLTPKSTFIIRSEMD 293

Query: 267 GYNNVTNMFTELKCFAPLKCMFSA--KEVLKTWVQTGLIPESDIVIGIRDTQSGLLEDLV 324
            YNN T  FTELKCF  L    +   K++LKTW QTGL P  DIVIGIRDT SG+LEDL+
Sbjct: 294 SYNNKTETFTELKCFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILEDLL 353

Query: 325 WYNRKDLCRTFNNPSLPPAPSHFNFNANIAVEWLKFTMESIVSLVSSSIADS-NHPCSFK 383
           WY+R+++ +   +PSLP   + F+F  +I ++WL   + +I S  +   +D+ ++P ++K
Sbjct: 354 WYSRENMYQKLQDPSLPKFKNSFDFKPHIGIQWLNHCIHAIESAFTKDTSDTASNPMTYK 413

Query: 384 LKIDNHKTISIQKLSRIPQTVQRQIPKEFV 413
           + ID HK+I I+KLS +P+ V  +IP +F+
Sbjct: 414 VIIDKHKSIIIKKLSIVPKNV--EIPTDFL 441

>NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON}
           Anc_5.437 YDR370C
          Length = 423

 Score =  248 bits (634), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 150/387 (38%), Positives = 219/387 (56%), Gaps = 25/387 (6%)

Query: 38  INIIPFHRFVHSNARSFPQKTKDLFLESKTVAFFQKDQLFINVEDAALPLLKKDIANISG 97
           I  IPF +F H +  ++P+     F  SK VA +   QL+ + +   +P L+  IA ++ 
Sbjct: 36  ITTIPFKQFKHCSISTYPKTPSSFFETSKDVALYHNKQLYSSDDTNLIPQLEPAIAKLAN 95

Query: 98  KSV-LN-SKKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHWENEHRGEHYGAH 155
            S  LN ++  KLPYLGSDLY   + + P+  D LDS +PCF +I  WE +++ + Y   
Sbjct: 96  PSCSLNEARDLKLPYLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQNKHD-YQLG 154

Query: 156 ADYTILSPRHHITEIVMSLFEDEKNCSVYLLCTYL--KNGIILLSKDDAXXXXXXXXXXX 213
             +TI+S RHHI E+ M +F   K     L  TY    NG++L S+D             
Sbjct: 155 NKFTIVSARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRD----VNKKDDGGI 210

Query: 214 XXXXPMTRKICYSGFAFEDLVLEDI----AENA--------RPIFSVVESKLTESINLLL 261
                + RKI YSGFA EDL+  +     A+N+        + +F+++E+KL + I+LLL
Sbjct: 211 YSKDGVVRKISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKAVFAIIENKLNDDISLLL 270

Query: 262 RNELDGYNNVTNMFTELKCFAPLKC--MFSAKEVLKTWVQTGLIPESDIVIGIRDTQSGL 319
           R E+D YN V   FTE+KCFA LK       +++LK WVQTG+IP SDI+IGIRD   G 
Sbjct: 271 RCEMDSYNPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGE 330

Query: 320 LEDLVWYNRKDLCRTFNNPSLPPAPSHFNFNANIAVEWLKFTMESIVSLVSSSIADS--N 377
           L D+ W++R +L R  NN +LP A    N+NA IAV+W +  ++SI  LV  SI  +  N
Sbjct: 331 LNDIEWFSRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDESIDKTRLN 390

Query: 378 HPCSFKLKIDNHKTISIQKLSRIPQTV 404
              SF+++I+  + I I+KL  +P  V
Sbjct: 391 TSQSFQIRINASRAIQIKKLKSVPNNV 417

>ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 373

 Score =  246 bits (629), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 131/367 (35%), Positives = 217/367 (59%), Gaps = 15/367 (4%)

Query: 41  IPFHRFVHSNARSFPQKTKDLFLESKTVAFFQKDQLFINVEDAALPLLKKDIANISGKSV 100
           +PF++F HS+A  FP + ++LF + K  +++   QL  ++ D+    LK     +S    
Sbjct: 16  VPFNQFQHSSAFRFPSEPRNLFTKYKEASYYYGGQLHDSISDSIG--LKSPGNKLSHDRS 73

Query: 101 LNSKKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHWENEHRGEHYGAHADYTI 160
            ++K+    +LGSDLY   + + PL  ++LDS + C+ +I  WEN++    Y   + + +
Sbjct: 74  CSNKR---DFLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWENDNHTS-YSQRSPFVV 129

Query: 161 LSPRHHITEIVMSLFEDEKNCSVYLLCTYLKNGIILLSKDDAXXXXXXXXXXXXXXXPMT 220
           +SPRH++ E+ M LF+  K     +LCT+L +G I+LS+ +                 MT
Sbjct: 130 ISPRHYLVELTMQLFQQSK---YSILCTHLGDGKIVLSQVENDKKSHQHTSRNTT---MT 183

Query: 221 RKICYSGFAFEDLVLEDIAENARPIFSVVESKLTESINLLLRNELDGYNNVTNMFTELKC 280
           +KI +SG+A EDL+         P F+++E++L  +I+L+LR ELD YN +T  FTELKC
Sbjct: 184 KKILHSGYALEDLLTRGPRVEDDPFFAIIEAELDANISLVLRCELDSYNELTETFTELKC 243

Query: 281 FAPLKC--MFSAKEVLKTWVQTGLIPESDIVIGIRDTQSGLLEDLVWYNRKDLCRTFNNP 338
           +APL     +  +++LKTW+Q  + P  D++IG+R+T  GLL+DL ++  K+L R  N+ 
Sbjct: 244 YAPLNMHNAYHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFTNKELYRKINDR 303

Query: 339 SLPPAPSHFNFNANIAVEWLKFTMESIVSLVSSSIADSNHPCSFKLKIDNHKTISIQKLS 398
           +LP +P  FN+NA++AV+W +  + SI  LV  ++ D + P  FKL ID    I ++KL 
Sbjct: 304 NLPKSPKRFNYNADLAVQWCQHCIRSICKLVGENV-DRSSPQCFKLTIDESHKIQLEKLK 362

Query: 399 RIPQTVQ 405
            +P  V+
Sbjct: 363 HVPAHVE 369

>NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {ON}
           Anc_5.437 YDR370C
          Length = 415

 Score =  242 bits (618), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 145/395 (36%), Positives = 216/395 (54%), Gaps = 26/395 (6%)

Query: 34  KKNVINIIPFHRFVHSNARSFPQKTKDLFLESKTVAFFQKDQLFINVEDAALPLLKKDIA 93
           K+  I  +PF  F HS+   FP  T+  +  S  VA +   +L+   +   +P LK DIA
Sbjct: 19  KQAPITRVPFGEFSHSSISLFPTCTQPFYESSNQVALYHNHKLYPASQYDIIPHLKNDIA 78

Query: 94  NISGKSVLNSKKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHWENEHRGEHYG 153
            +  KS   ++  K  YLGSDLY   + + P+    LDS +PC  FI+ WE +   + Y 
Sbjct: 79  QLPKKSASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKASTK-YK 137

Query: 154 AHADYTILSPRHHITEIVMSLFEDEKN-------CSVYLL---CTYLKNGIILLSKDDAX 203
               + I+S RHHI E+ M LF  + N          Y+L    T  + G +L +KD + 
Sbjct: 138 PGRKFNIVSTRHHIVEMTMKLFTGKTNNYNNTKKVQDYVLNVVYTGDETGRLLFTKDWSN 197

Query: 204 XXXXXXXXXXXXXXPMTRKICYSGFAFEDLVLEDIAE----------NARPIFSVVESKL 253
                          + R ICYSGFA EDL+ E  +E            + +F+VVE+KL
Sbjct: 198 TGNSMNEGIYSKNIILKR-ICYSGFALEDLMTETTSELEKEGEKLTGGEKAVFAVVENKL 256

Query: 254 TESINLLLRNELDGYNNVTNMFTELKCFAPLKCM-FS-AKEVLKTWVQTGLIPESDIVIG 311
            + I +LLR ELD +N     FTELKCF+PLK   FS  +++LK WVQTG++P+SDI+IG
Sbjct: 257 DDDICILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIG 316

Query: 312 IRDTQSGLLEDLVWYNRKDLCRTFNNPSLPPAPSHFNFNANIAVEWLKFTMESIVSLVSS 371
           IRD+  G LED+ WY+R  L    NN +LP +   +NFNA +A +W +  + SI  LV  
Sbjct: 317 IRDSSFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDE 376

Query: 372 SIADS--NHPCSFKLKIDNHKTISIQKLSRIPQTV 404
           ++     ++P  F+++ID+ + I I+ LS++P+ +
Sbjct: 377 NLDQKAISNPQGFQIRIDSRRNIRIKCLSKVPKDI 411

>TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.437
           YDR370C
          Length = 453

 Score =  227 bits (579), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 141/397 (35%), Positives = 216/397 (54%), Gaps = 42/397 (10%)

Query: 41  IPFHRFVHSNARSFPQKTKDLFLESKTVAFFQKDQLFINVEDA-----ALPLLKKDIANI 95
           I F+ FV  +   F     DL+  SK VA +    L IN +        +P LK DI  I
Sbjct: 43  IRFNSFVKPSKTHF----SDLYRTSKEVATYHLGNLNINTDPTIEHTKGVPCLKDDICQI 98

Query: 96  SGKSVLNSKKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHWENEHRGEH--YG 153
           +GKS+L+SKKYK  Y+G+DL+   +KY  + ++ L  P  CF +I++++ +H  E   YG
Sbjct: 99  AGKSLLDSKKYKAKYIGADLFKDYEKYHAMEKEPLHDPISCFKYIQYYDKKHANEKKKYG 158

Query: 154 AHADYTILSPRHHITEIVMSLFEDEKNCSVYLLCTYLKNGIILLSKDDAXXXXXXXXXXX 213
              ++ I++ RHHI ++V++ F+   +  V +L TYL +  ILLS+D A           
Sbjct: 159 MDKEFVIITSRHHINDLVLAPFKKISDPEVSVLLTYLGDNRILLSQDYAHEPPDWRENKQ 218

Query: 214 XXXXPMTRKICYSGFAFEDLVLEDIAEN----------------ARPIFSVVESKLTESI 257
                  RKI  SGFAFEDLV++D   +                    FSVVE+ ++  +
Sbjct: 219 FYNS--MRKIVNSGFAFEDLVIKDYTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKL 276

Query: 258 NLLLRNELDGYNNVTNMFTELKCFAPLKCM--FSAKEVLKTWVQTGLIPESDIVIGIRDT 315
            +LLR+E+DGYN +TN +TELKCF  L     F  +++LKTWVQ G +P SD+++G RDT
Sbjct: 277 TILLRSEMDGYNPLTNSYTELKCFTRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDT 336

Query: 316 QSGLLEDLVWYNRKDL---CRTFNNPSLPPAPSHFNFNANIAVEWLKFTMESIVSLVSSS 372
           Q+GLL D+ W++R DL   C ++ +P L     H N     A  W    + +I SL    
Sbjct: 337 QTGLLNDITWFSRDDLVTKCDSYYSPRL---RFHQNTTPTNASAWYYHVLSAITSLTRDY 393

Query: 373 I-----ADSNHPCSFKLKIDNHKTISIQKLSRIPQTV 404
           +     A S+ P  F+L ++ ++TI++  L ++P +V
Sbjct: 394 LKKTPKAPSSVPVPFRLIVEKNRTITLLPLKKVPASV 430

>KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.437
           YDR370C
          Length = 405

 Score =  214 bits (545), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 132/389 (33%), Positives = 206/389 (52%), Gaps = 27/389 (6%)

Query: 41  IPFHRFVHSNARSFPQKTKDLFLESKTVAFFQKDQLFINVEDAA----LPLLKKDIANIS 96
           + F  F H +   +  K   +F +SK VA +   +L+IN  +      LPLLK+DIA ++
Sbjct: 28  VRFKEFHHHDPGKYVSKPAHIFQKSKEVACYTGGKLYINDGNTTNLTILPLLKEDIAALA 87

Query: 97  -GKSVLNSKKYKLPYLGSDLYASTDKYG-PLPEDVLDSPKPCFDFIRHWENEHRGEH-YG 153
             K+   S  +K  YLG  LYA  + Y   +  D+LDS KPC D+I  W    +GE  +G
Sbjct: 88  QSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSPDMLDSAKPCLDYINEWNRGSKGEKKFG 147

Query: 154 AHADYTILSPRHHITEIVMSLFEDEKNCSVYLLCTYLKNGIILLSK-DDAXXXXXXXXXX 212
               + I+ PRHH+ E+ M+LF ++ +    L+CT L+   I+LS+ DD           
Sbjct: 148 ESYRHIIVGPRHHLVELTMALFANDSDYK--LVCTVLRGKFIVLSQFDDGSQRNRNEGIT 205

Query: 213 XXXXXPMTRKICYSGFAFEDLVLEDIAENARPI----FSVVESKLTESINLLLRNELDGY 268
                  TR +CYSGF     V+  I    R I    F    + +          E+D Y
Sbjct: 206 LSDRR--TRMLCYSGF-----VICKIWSLNRGIIPSQFFYYGTPIRRGHLATFTCEMDAY 258

Query: 269 NNVTNMFTELKCFAPL--KCMFSAKEVLKTWVQTGLIPESDIVIGIRDTQSGLLEDLVWY 326
           N + N +TELKC+ PL  K  +   ++L+TWVQT + P++D+VIG R+   G L+D+   
Sbjct: 259 NQIENHYTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDVVIGCRNAYDGTLQDITQL 318

Query: 327 NRKDLCRTFNNPSLPPAPSHFNFNANIAVEWLKFTMESIVSLVSSSIADSN--HPCSFKL 384
           +R+ L R FNN   P A ++FN+NA +AVEW ++ M++I+ L+  ++   +   P +F +
Sbjct: 319 SRESLYRKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAIIRLIEGNLNQKSVLEPQAFVV 378

Query: 385 KIDNHKTISIQKLSRIPQTVQRQIPKEFV 413
            +     I I+KL  +P+    +IPKEF+
Sbjct: 379 TVYRGHDIGIRKLKGVPKYA--EIPKEFI 405

>CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370c
          Length = 402

 Score =  199 bits (507), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 118/359 (32%), Positives = 197/359 (54%), Gaps = 18/359 (5%)

Query: 44  HRFVHSNARSFPQKTKDLFLESKTVAFFQKDQLFINVEDAALPLLKKDIANISGKSVLNS 103
            R   S+ ++ PQ     +  +KT+  F   +L+        P LK  IA+I+  +    
Sbjct: 49  QRLKTSHHKNMPQ----FYDSAKTLGIFHDHKLYEMNRMDLFPQLKDPIAHIAKSTPAEK 104

Query: 104 KKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHWENEHRGEHYGAHADYTILSP 163
            +   P+LG  LY + DKY P+    LD+ + C  ++  +EN H G+ YG   D+ I++ 
Sbjct: 105 TQLVRPFLGISLYENHDKYSPMTAKELDTTEACSTYLDQYENSH-GQKYGEDRDFVIVTA 163

Query: 164 RHHITEIVMSLFEDEKNCSVYLLCTYLKNGIILLSKDDAXXXXXXXXXXXXXXXPMTRKI 223
           RHH+ ++ +  F   +  +V LLC Y    ++ +S+D A               P+ +KI
Sbjct: 164 RHHMIDLAILPFS-RQFTNVNLLCAYTPGNLLEISQDPADNTNDKVGVNTDN--PILKKI 220

Query: 224 CYSGFAFEDLVLEDIAENAR-PIFSVVESKLTESINLLLRNELDGYNNVTNMFTELKCFA 282
           C+SGFA ED++ E   +  R P F +VE+++  +  LL+R E+D YN +T+ +TELKC+A
Sbjct: 221 CFSGFALEDILTESANDEERNPTFLIVENEIANT-RLLMRCEIDAYNPITSHYTELKCYA 279

Query: 283 PLKCMFS----AKEVLKTWVQTGLIPESDIVIGIRDTQSGLLEDLVWYNRKDLCRTFNNP 338
             K  F      +++LK+W+QTG+IP +DIVIG+RDT+SG L+D+  YNR  L     + 
Sbjct: 280 --KYNFGNPNHRRKLLKSWIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISK 337

Query: 339 SLPPAPSHFNFNANIAVEWLKFTMESIVSLVSSSIA--DSNHPCSFKLKIDNHKTISIQ 395
           SLP   S  N++  I+V W +  + ++ + ++S +     + P  F +K+DN+  I I+
Sbjct: 338 SLPRCDSELNYDPAISVVWYRSLINTLTTTIASLLDKFGRDEPQLFSIKVDNNCNIRIE 396

>SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 400

 Score =  187 bits (474), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 122/377 (32%), Positives = 198/377 (52%), Gaps = 22/377 (5%)

Query: 46  FVHSNARSFPQKTKDLFLESKTVAFFQK---DQLFINVEDAALPLLKKDIANISGKSVLN 102
           FVHSN   FP      F ES+ +  F +      ++  +   L  LK DI         N
Sbjct: 30  FVHSNVSHFPSVPCKFFQESREIGTFTRMVSSGKYLFDDKLGLRPLKDDICEYIHNPAKN 89

Query: 103 SKKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHWENEHRGEHYGAHADYTILS 162
           + K K  YLG DL    + Y PL ED L++     +FI +WE E  G+ YG+   +TI+S
Sbjct: 90  ASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNWE-EKNGKKYGSENKFTIVS 148

Query: 163 PRHHITEIVMSLFEDEKNCSVYLLCTYLKNGIILLSKDDAXXXXXXXXXXXXXXXPMTRK 222
            RHH+ +++M  F  E+     L+ T+L +G++++S D +                  RK
Sbjct: 149 NRHHLIDLIMCPFSLEE---ANLIVTHL-DGLLIISSDKSKPKVDSGIRSKDTR---VRK 201

Query: 223 ICYSGFAFEDLVLEDIAENARP---IFSVVESKLTESINLLLRNELDGYNNVTNMFTELK 279
           +CY+GF  E+LV +   ++       +S+VE+KLTE ++LLL+ E+D YN  T+ + ELK
Sbjct: 202 LCYTGFELENLVTKGKVDSPGMHTCFYSIVENKLTEGVSLLLQAEMDSYNPKTDNYVELK 261

Query: 280 CFA--PLKCMFSAKEVLKTWVQTGLIPESDIVIGIRDTQSGLLEDLVWYNRKDLCRTFNN 337
           C     LK     +++L+ W+QTGL+P +D+++G RD     L+ L  Y R ++ + F+ 
Sbjct: 262 CSVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEIYKKFST 321

Query: 338 PSLPPAPSHFNFNANIAVEWLKFTMESIVSLVSSSIADSNHPC-SFKLKIDNHKTISIQK 396
            +L     ++NFN+ +AV+W    +  I  LV  ++ D   P  SFKL +     +S+ K
Sbjct: 322 RNLNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLTD--EPLQSFKLTLTRDLQLSLTK 379

Query: 397 LSRIPQTVQRQIPKEFV 413
           L+  P  +   IP++F+
Sbjct: 380 LANTPAGL---IPEKFL 393

>Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370C -
           Hypothetical ORF [contig 130] FULL
          Length = 389

 Score =  163 bits (412), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 108/373 (28%), Positives = 182/373 (48%), Gaps = 20/373 (5%)

Query: 46  FVHSNARSFPQKTKDLFLESKTVA----FFQKDQLFINVEDAALPLLKKDIANISGKSVL 101
           F H+    FP+     F E + VA        D+  ++ +   +P L +D+   +    L
Sbjct: 24  FQHAQINQFPKNVLPFFDEVQEVATITHLLDTDEFLLD-DKLGMPELVQDLCEFTESGKL 82

Query: 102 NSKKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHWENEHRGEHYGAHADYTIL 161
            +K     Y+G DL    D+Y P+    L+       F+  W+  H G  +  +AD+TI+
Sbjct: 83  ANKG---KYIGHDLLDHFDEYVPITPKQLEDMAGVQAFLERWKQLH-GRSFCDNADFTIV 138

Query: 162 SPRHHITEIVMSLFEDEKNCSVYLLCTYLKNGIILLSKDDAXXXXXXXXXXXXXXXPMTR 221
             RH++ +++M  F DE    V+L   +  NG + LS D                    +
Sbjct: 139 CSRHNLIDLIMMPFSDE---DVHLKIQF-SNGYLNLSPDAQYQKTDQGIHSGDTK---IK 191

Query: 222 KICYSGFAFEDLVLEDIAENARPIF-SVVESKLTESINLLLRNELDGYNNVTNMFTELKC 280
           KICY+GF  E+L+      + R  F S+VE KL + I LLL+ E+D +N+ T  +TE+KC
Sbjct: 192 KICYTGFELENLITATSKPDVRSSFYSLVEGKLGDGIKLLLKAEMDCFNSSTRSYTEIKC 251

Query: 281 FAPLKC--MFSAKEVLKTWVQTGLIPESDIVIGIRDTQSGLLEDLVWYNRKDLCRTFNNP 338
            + LK    +  +++L+ WVQT L+P +++++GIRD     L     Y R  L R FNN 
Sbjct: 252 SSGLKVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYTRSQLYRKFNNQ 311

Query: 339 SLPPAPSHFNFNANIAVEWLKFTMESIVSLVSSSI-ADSNHPCSFKLKIDNHKTISIQKL 397
            L     ++N+NA I+V+W +  ++ +  ++   I   S    +F+L +  + TI ++K+
Sbjct: 312 RLTVMRKNYNYNATISVQWFRHVIQQLCQMIKPFIEKGSKEEVNFRLTLRKNLTIKLRKM 371

Query: 398 SRIPQTVQRQIPK 410
              P   +  I K
Sbjct: 372 PETPAPTKGTIFK 384

>KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weakly
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 390

 Score =  159 bits (401), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 107/369 (28%), Positives = 185/369 (50%), Gaps = 23/369 (6%)

Query: 46  FVHSNARSFPQKTKDLFLESKTVA----FFQKDQLFINVEDAALPLLKKDIANISGKSVL 101
           F  ++   FP +    F E K +     +   D+  +  + +A P LKKD+    G   +
Sbjct: 24  FERASISHFPAEPLHFFDEVKEIGTMTHWIDSDKFELGRKQSA-PHLKKDL----GLFTI 78

Query: 102 NSKKYKL-PYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHWENEHRGEHYGAHADYTI 160
             K  K   Y+G DL    D + PL  + L+     F+F+  WE +H G+ Y + +D+TI
Sbjct: 79  TKKLAKTNSYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKWEGDH-GKPYSSGSDFTI 137

Query: 161 LSPRHHITEIVMSLFEDEKNCSVYLLCTYLKNGIILLSKDDAXXXXXXXXXXXXXXXPMT 220
           +  RH++ +++M+ F DE    V+    Y+ NG + +  D                    
Sbjct: 138 VCSRHNLIDLIMAPFSDE---DVHFNVKYI-NGYLHIFPDKQFQKKDDGIYSSESN---I 190

Query: 221 RKICYSGFAFEDLVLEDIAENARPIF-SVVESKLTESINLLLRNELDGYNNVTNMFTELK 279
           R+ICY+GF  EDLV E      +  F S+V+ K++++I LL + E+D +N     +TE+K
Sbjct: 191 RRICYTGFELEDLVTETQPGAPKSAFYSLVQGKISKNIKLLFKAEMDCFNPAKRSYTEIK 250

Query: 280 CFAPLKC--MFSAKEVLKTWVQTGLIPESDIVIGIRDTQSGLLEDLVWYNRKDLCRTFNN 337
           C   LK    F  +++L+ WVQT L+P +D++IG+RD     L     Y R++L + FNN
Sbjct: 251 CTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYTRQELYQKFNN 310

Query: 338 PSLPPAPSHFNFNANIAVEWLKFTMESIVSLVSSSIADS-NHPCSFKLKIDNHKTISIQK 396
            +L      +N+NANI+V+W +  ++ +   ++  +  +     SFKL +     + ++K
Sbjct: 311 RNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYVEKTPTEAVSFKLTLTKQLELRLRK 370

Query: 397 LSRIPQTVQ 405
           +   P T +
Sbjct: 371 I-ETPSTAK 378

>AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR370C
          Length = 386

 Score =  142 bits (358), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 104/369 (28%), Positives = 183/369 (49%), Gaps = 21/369 (5%)

Query: 34  KKNVINIIPFHRFVHSN-ARSFPQKTKDLFLESKTVAFFQKDQLFINVEDAA-LPLLKKD 91
           +K++I  +   +F H    R   +++  +F ES+ V    +  L  +++D   LPLL  +
Sbjct: 18  EKDLIVNVNMKKFPHGPITRRGKERSIRIFSESREVGTAFRQGLVYDLDDKKNLPLLNDE 77

Query: 92  IAN-ISGKSVLNSKKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHWENEHRGE 150
           I   IS +S    K   + Y+GSDL   ++ + P+  + L        FI  WE ++   
Sbjct: 78  ICEYISHRS----KSKLIGYVGSDLSVESETFHPVTSEELHCLHGLLKFIAKWEADNE-V 132

Query: 151 HYGAHADYTILSPRHHITEIVMSLFEDEKNCSVYLLCTYLKNGIILLSKDDAXXXXXXXX 210
           +Y + + +TI+SPRHHI +I+M  F +E+ C +         G+ +++            
Sbjct: 133 NYASRSKFTIVSPRHHILDILMIPFGNER-CRLVFTA---HRGLFVIT-----LAPSQRP 183

Query: 211 XXXXXXXPMTRKICYSGFAFEDLVLEDIAENARPIFSVVESKLTESINLLLRNELDGYNN 270
                    TRKICY+GF  E L+           +S +E+KL   I +LL+ E+D YN 
Sbjct: 184 TGINSPSSATRKICYTGFELERLLTATSGTERGSFYSFIEAKLEPDITILLQCEMDAYNP 243

Query: 271 VTNMFTELKCFAP--LKCMFSAKEVLKTWVQTGLIPESDIVIGIRDTQSGLLEDLVWYNR 328
               +TE+K      ++ +    ++LK W QT L+P +DI++G RD  + +L+ +V Y+ 
Sbjct: 244 KRQKYTEIKSSVDFNVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSV 303

Query: 329 KDLC-RTFNNPSLPPAPSHFNFNANIAVEWLKFTMESIVSLVSSSI-ADSNHPCSFKLKI 386
             +  + +        PS+FNFN  +A +W  + +  I   +SS + A S+ P SF ++I
Sbjct: 304 DQIAEKLYIRDRTRSHPSYFNFNPEVAKDWTHYAIREICERLSSLVDATSSSPQSFLVEI 363

Query: 387 DNHKTISIQ 395
           D +  + I+
Sbjct: 364 DKNLQMKIR 372

>KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 403

 Score =  139 bits (350), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 111/383 (28%), Positives = 182/383 (47%), Gaps = 24/383 (6%)

Query: 27  KQNKSRPKKNVINIIPFHRFVHSNARSFPQKTKDLFLESKTV---AFFQKDQLFINVEDA 83
           K NK   KK  + ++   +F H +      KT  L  + K V   ++   D   +  E +
Sbjct: 29  KNNKPSQKKGSL-VLSCKKFPHVSVNYVVDKTPKLLTDCKEVHNCSYIINDATLLWNEAS 87

Query: 84  ALPLLKKDIANISGKSVLNSKKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHW 143
             P L+ ++      S   +K  K  ++G DL    D Y PL  +VL+S       +   
Sbjct: 88  RKPRLRPEVCTYIKDSKWENKAVKDSFIGIDLTKGYDDYVPLDRNVLNS------LVILK 141

Query: 144 ENEHRGEHYGAHADYTILSPRHHITEIVMSLFEDEKNCSVYLLCTYLKNGIILLSKDDAX 203
           E   R E        T +S RHHI +I+M  F DE    + LL T   +  IL+S D + 
Sbjct: 142 EAYQRYEKTLNPEKTTFVSLRHHIIDIIMCPFLDE---PLSLLMTVQPDKNILISVDKSK 198

Query: 204 XXXXXXXXXXXXXXPMTRKICYSGFAFEDLVLEDIAENA----RPIFSVVESKLTESINL 259
                            +KICY+GFA EDL++E   E         +S+V   L + I+L
Sbjct: 199 DKPNGIHETRNS---FNKKICYTGFALEDLLIESPTEGHILEHELYYSIVHGSLNDEIDL 255

Query: 260 LLRNELDGYNNVTNMFTELKCFAPLKC--MFSAKEVLKTWVQTGLIPESDIVIGIRDTQS 317
           L++ E+D  N +T+ +TE+K     K    +  +++L+ W+QT L+P+SD++IG R++ S
Sbjct: 256 LIQAEMDSINTLTDTYTEIKSSVHFKLGNTYHRRKLLRMWIQTNLLPKSDLLIGFRNSYS 315

Query: 318 GLLEDLVWYNRKDLCRTFNNPSLPPAPSHF-NFNANIAVEWLKFTMESIVSLVSSSIADS 376
             LE L  Y  +D+    NN S+   P  F  FN N+A +W +   + ++      ++  
Sbjct: 316 NELEQLKAYKIQDIYHKINNSSIVGKPGKFYKFNPNVANDWFQHIFQ-VLKQNLLLLSQE 374

Query: 377 NHPCSFKLKIDNHKTISIQKLSR 399
           +   +FK++ID + T+SI   S+
Sbjct: 375 STSTTFKVQIDTNLTLSISPASQ 397

>Kwal_55.21591 s55 complement(904533..905942) [1410 bp, 469 aa] {ON}
           [contig 128] FULL
          Length = 469

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 81/201 (40%), Gaps = 48/201 (23%)

Query: 160 ILSPRHHITEIVMSLFEDEKNCSVYL-LCTYLKNGIILLSKDDAXXXXXXXXXXXXXXXP 218
           +L+ R  + ++ +S F  + N    +    YLK+G + L  D A                
Sbjct: 110 VLTNRGDLVDLAVSFFPGKDNNFEKMNHVVYLKSGRLFLWHDRARDDTFSNSR------- 162

Query: 219 MTRKICYSGFAFEDLV-------------LEDIAENARPIFSVVESKLTESINLLLRNEL 265
            +RK  YSG  FE +              L  + E A P  S+V+  L+E +N+L+  E 
Sbjct: 163 -SRKNWYSGHKFEHMCTHTWPDDVKTWGPLPPLDEAAPPTLSLVQLPLSEDMNVLMMAEY 221

Query: 266 D---GYNNVTNMFTELKCFAPL----KC------MFSAKEVL-------------KTWVQ 299
           D         + F ELKCF P     KC        S  ++L             KT +Q
Sbjct: 222 DVRLPKRQGLSGFAELKCFQPRMNNSKCDQISWHKLSNSKILKLLITNTTYMRFFKTLLQ 281

Query: 300 TGLIPESDIVIGIRDTQSGLL 320
           + L    +++ GIR+ ++ L+
Sbjct: 282 SRLSGCENLIYGIRNNKTSLV 302

>SAKL0F00726g Chr6 complement(63291..64442) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P53063 Saccharomyces
           cerevisiae YGL246C RAI1 Nuclear protein that binds to
           and stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 383

 Score = 36.6 bits (83), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 50/118 (42%), Gaps = 29/118 (24%)

Query: 225 YSGFAFEDLVL-----------------EDIAENARPIFSVVESKLTESINLLLRNELD- 266
           YSG+ FE LV                  + I  N     SVV + + +S  L+L  E+D 
Sbjct: 160 YSGYKFESLVTLPKPLGEVSRTTLEKRPKKIVNNGEQYISVVRTGVGKS-KLILGAEVDC 218

Query: 267 ------GYNNVTNMFTELKCFAPLKCMFSAK----EVLKTWVQTGLIPESDIVIGIRD 314
                    +    +TELKC   +  +  A+    ++ KTW+Q  L+  + ++ G RD
Sbjct: 219 VFDFKEDSGDNLKHYTELKCTKGVTTIAEARAFERKIFKTWLQCFLVGVNRVIYGFRD 276

>Ecym_2600 Chr2 (1167583..1168737) [1155 bp, 384 aa] {ON} similar to
           Ashbya gossypii AFR263C AFR262C
          Length = 384

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 69/149 (46%), Gaps = 33/149 (22%)

Query: 225 YSGFAFEDL-------------VLED----IAENARPIFSVVESKLTESINLLLRNELD- 266
           YSG+ FE L             VLE     I  N     +VV + + +   L+L  E+D 
Sbjct: 160 YSGYKFETLTTLSKSFSETPRQVLESRPKKIVSNGEQFVTVVRTGIGKC-KLILGAEVDC 218

Query: 267 -------GYNNVTNMFTELKCFAPLKCMFSAK----EVLKTWVQTGLIPESDIVIGIRDT 315
                  G +N+ + + ELKC   +  +  A+    ++ KTWVQ  L+  + I+ G RD 
Sbjct: 219 VFDFKEVGSDNLKH-YAELKCSKAVNTVADARTFELKLFKTWVQCFLVGINRIIYGFRD- 276

Query: 316 QSGLLEDLVWYNRKDLCRTF-NNPSLPPA 343
           ++ +L+ +  ++ +++     NNP L  A
Sbjct: 277 ENCILKSVEEFSTQEIPVLLKNNPRLTNA 305

>KAFR0J00160 Chr10 complement(26405..27547) [1143 bp, 380 aa] {ON}
           Anc_3.570 YGL246C
          Length = 380

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 76/188 (40%), Gaps = 37/188 (19%)

Query: 225 YSGFAFEDLVL--EDIA---------------ENARPIFSVVESKLTESINLLLRNELDG 267
           Y+G+ FE L L  E IA                N     SVV++ + +   +L+  E+DG
Sbjct: 159 YTGYKFEALTLLNEPIAFTERDSLDSRADACVSNGDEYVSVVKTGIGKH-RVLMGGEVDG 217

Query: 268 -YNNVTNMFTELKCFAPLKCMFS----------AKEVLKTWVQTGLIPESDIVIGIRDTQ 316
            Y+   +    LK +  LKC  S           K++ KTW+Q  LI    I  G RD +
Sbjct: 218 IYDFKEDGADNLKHYLELKCTRSLSSYQDIENFEKKLFKTWLQCFLIGIPRITYGFRD-R 276

Query: 317 SGLLEDLVWYNRKDLCRTFNNPSLPPAPSHFNFNANIAVEWLKFTMESIVSLVSSSIADS 376
           S  L  +  Y  +D+ + F N  +             A++W    +  +   ++    D+
Sbjct: 277 SYNLTSIEEYLTEDVPKLFTNRGVKAQCMD-------AIQWYGEIIGWLYDTLAHLETDA 329

Query: 377 NHPCSFKL 384
           N    FKL
Sbjct: 330 NEIRPFKL 337

>TPHA0G03650 Chr7 (776977..778110) [1134 bp, 377 aa] {ON} Anc_3.570
           YGL246C
          Length = 377

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 86/194 (44%), Gaps = 39/194 (20%)

Query: 225 YSGFAFEDLV--------LEDIAENARP---------IFSVVESKLTESINLLLRNELD- 266
           Y+G+ FE L         +     N RP           SVV++ +  +  +LL  E+D 
Sbjct: 156 YTGYKFEALCTLPEPLPYVSRTKLNKRPKKIVSHGDEFVSVVKTGVG-NCKILLGAEVDA 214

Query: 267 -------GYNNVTNMFTELKCFAPLKCMFSAKE----VLKTWVQTGLIPESDIVIGIRDT 315
                  G +N+ + + ELKC A +  +   K+    + KTW+Q  LI  + I  G RD 
Sbjct: 215 IFDFKEKGKDNLQH-YIELKCTAAINNINDTKKFENKLFKTWIQCFLIGITRITYGFRDE 273

Query: 316 QSGLLEDLVWYNRKDLCRTFNNPSLPPAPSHFNFNANIAVEWLKFTMESIVSLVSSSIAD 375
           Q  LL+ +  +   D+   F N +   A +  N     A++W     E ++ ++ +   D
Sbjct: 274 QY-LLKTIEEFATSDIPLIFKNHNPTLASNCVN-----AIKWYGVFTEWLMKMIPTE--D 325

Query: 376 SNHPCSFKLKIDNH 389
           ++   +++L  +N+
Sbjct: 326 TSVTKAYRLVCENN 339

>NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570
          Length = 377

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 76/198 (38%), Gaps = 45/198 (22%)

Query: 224 CYSGFAFEDLVL-----------------EDIAENARPIFSVVESKLTESINLLLRNELD 266
           CY+G+ FE L                   + I+ N     +VV++ +  S  L+L  E+D
Sbjct: 153 CYTGYKFESLATLSQPLPLVSRTTLEKRPKKISSNGDEYIAVVKTGVGSS-KLVLGAEID 211

Query: 267 -----GYNNVTNM--FTELKCFAPLKCMFSA----KEVLKTWVQTGLIPESDIVIGIRDT 315
                   N  N+  + ELKC   +     A    +++ KTW+Q  L+    I+ G RD 
Sbjct: 212 CIFDFKEENKDNLRHYAELKCSTQIITAADAHRFERKLFKTWLQCFLVGIPRIIYGFRDE 271

Query: 316 QSGLLEDLVWYNRKDLCRTFNNPSLPPAPSHFNFNANI----AVEWLKFTMESIVSLVSS 371
                     Y  K +   F+   +P      N   N     A++W     E ++ L+  
Sbjct: 272 N---------YTLKSV-EEFSTEEVPILLKEHNPKMNTSCIDAIKWYGLLTEWLLKLIPR 321

Query: 372 SIADSNHPCSFKLKIDNH 389
              D   P  ++L  +N+
Sbjct: 322 DSGDEIRP--YRLVFENN 337

>KLTH0G00660g Chr7 complement(44243..45394) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P53063 Saccharomyces
           cerevisiae YGL246C RAI1 Nuclear protein that binds to
           and stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 383

 Score = 33.9 bits (76), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 50/210 (23%), Positives = 87/210 (41%), Gaps = 42/210 (20%)

Query: 219 MTRKICYSGFAFEDLVL-----------------EDIAENARPIFSVVESKLTESINLLL 261
           M  +  YSG+ FE L                   + I  N     +VV S +     L+L
Sbjct: 154 MEYRSYYSGYKFETLSTISKPLPQVTRNSLEKRHKRICCNGDQYITVVRSGVGH-CKLVL 212

Query: 262 RNELDGYNNVTNMFTE-LKCFAPLKCMFSA----------KEVLKTWVQTGLIPESDIVI 310
             E+D   + T   ++ LK +A LKC              +++ KTW+Q  L+  + ++ 
Sbjct: 213 GAEVDCVFDFTEDSSDNLKHYAELKCTKGVSTFAEARAFERKMFKTWLQCFLVGINRVIY 272

Query: 311 GIRDTQSGLLEDLVWYNRKD--LCRTFNNPSLPPAPSHFNFNANIAVEWLKFTMESIVSL 368
           G RD ++ +L  +  Y+ ++  L    NNP L  A          AV W     E ++S 
Sbjct: 273 GFRD-ENFILRSVEEYSTQEVPLLLKNNNPQLTNACMD-------AVRWYGALTEWLLSS 324

Query: 369 VSSSIADSNHPCSFKLKIDNH--KTISIQK 396
           +      + H  +++L  +N+  K + I+K
Sbjct: 325 IPRE-ESAEHIRAYRLTFENNHLKLVEIEK 353

>Kwal_47.19276 s47 (1168248..1169408) [1161 bp, 386 aa] {ON} YGL246C
           (RAI1) - Product of gene unknown [contig 344] FULL
          Length = 386

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 50/124 (40%), Gaps = 29/124 (23%)

Query: 219 MTRKICYSGFAFEDLVL-----------------EDIAENARPIFSVVESKLTESINLLL 261
           M  +  YSG+ FE L                   + I  N     +VV S +  +  L+L
Sbjct: 154 MQYRSYYSGYKFESLATLSKPLPQTPRSSLEKRSKKICNNGDQFVTVVRSGVG-NCKLVL 212

Query: 262 RNELDG-YNNVTNMFTELKCFAPLKCMFSA----------KEVLKTWVQTGLIPESDIVI 310
             E+D  ++   +    LK +A LKC              +++ KTW+Q  L+  + I+ 
Sbjct: 213 GAEVDCVFDFAEDTSNNLKHYAELKCTKGVSTFAEARSFERKLFKTWLQCFLVGINRIIY 272

Query: 311 GIRD 314
           G RD
Sbjct: 273 GFRD 276

>KLTH0F16962g Chr6 complement(1373279..1374778) [1500 bp, 499 aa]
           {ON} conserved hypothetical protein
          Length = 499

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 36/81 (44%), Gaps = 18/81 (22%)

Query: 220 TRKICYSGFAFEDL-------------VLEDIAENARPIFSVVESKLTESINLLLRNELD 266
            R   YSG+ FED+              L +  ++  P+ S+VE  L + ++ ++  E D
Sbjct: 163 ARDGWYSGYKFEDMCRHVWPQNTQTWTALPETNKDNNPLISLVELPLKKDVSTVMMAEYD 222

Query: 267 ----GYNNVTNMFTELKCFAP 283
               G     N F ELKCF P
Sbjct: 223 LRLPGAKK-PNGFVELKCFLP 242

>NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}
           Anc_3.570
          Length = 380

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 50/119 (42%), Gaps = 31/119 (26%)

Query: 225 YSGFAFEDLVL-----------------EDIAENARPIFSVVESKLTESINLLLRNELD- 266
           YSG+ FE L                   + I  N     +VV++ +  S  L+L  E+D 
Sbjct: 162 YSGYKFETLATLSQPVPYVSRATLDKRSKKICNNGDEYVTVVKTGVG-SAKLVLGAEIDC 220

Query: 267 -------GYNNVTNMFTELKCFAPLKCMFSA----KEVLKTWVQTGLIPESDIVIGIRD 314
                  G +N+ + + ELKC   +     A    +++ +TW+Q  L+    I+ G RD
Sbjct: 221 VFDFKEDGKDNLKH-YAELKCTTQVITAADAHKFERKIFRTWLQCFLVGIPRIIYGFRD 278

>TDEL0D06380 Chr4 (1146443..1147579) [1137 bp, 378 aa] {ON}
           Anc_3.570 YGL246C
          Length = 378

 Score = 30.8 bits (68), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 5/53 (9%)

Query: 266 DGYNNVTNMFTELKCFAPLKCMFSA----KEVLKTWVQTGLIPESDIVIGIRD 314
           +G +N+ + + ELKC A +     A    K++ KTW+Q  L+    I+ G RD
Sbjct: 223 EGKDNLKH-YAELKCSAMVSTQADARKFEKKIFKTWLQCFLVGIPRIIYGFRD 274

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,238,541
Number of extensions: 2042085
Number of successful extensions: 5843
Number of sequences better than 10.0: 43
Number of HSP's gapped: 5911
Number of HSP's successfully gapped: 44
Length of query: 413
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 301
Effective length of database: 40,638,807
Effective search space: 12232280907
Effective search space used: 12232280907
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)