Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1010.138.774ON49949926810.0
TPHA0G012108.774ON49451814910.0
NDAI0E006308.774ON49051213730.0
NCAS0B007808.774ON47250013430.0
KAFR0D014908.774ON44350012661e-171
CAGL0A03828g8.774ON47650712641e-170
TDEL0B033508.774ON42649712471e-169
Smik_15.4828.774ON42550011751e-158
YOR301W (RAX1)8.774ON43550011611e-156
ZYRO0F12232g8.774ON42649611591e-155
Skud_15.4688.774ON42350011411e-153
SAKL0B05456g8.774ON43249911061e-147
TBLA0D008408.774ON57758311031e-145
KNAG0G031008.774ON46351010641e-140
KLLA0F24904g8.774ON42449510491e-139
Kwal_34.159438.774ON4324919891e-130
KLTH0H15070g8.774ON4384949671e-126
Suva_8.3528.774ON4674659601e-125
AFR532W8.774ON4224939031e-117
Ecym_14768.774ON4535068431e-107
TBLA0I023706.334ON33767840.086
KLTH0E00352gsingletonON51566732.2
TBLA0B019401.519ON1127110742.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1010.13
         (499 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1010.13 s1010 complement(27385..28884) [1500 bp, 499 aa] {O...  1037   0.0  
TPHA0G01210 Chr7 complement(246099..247583) [1485 bp, 494 aa] {O...   578   0.0  
NDAI0E00630 Chr5 complement(128590..130062) [1473 bp, 490 aa] {O...   533   0.0  
NCAS0B00780 Chr2 (119384..120802) [1419 bp, 472 aa] {ON} Anc_8.7...   521   0.0  
KAFR0D01490 Chr4 (297425..298756) [1332 bp, 443 aa] {ON} Anc_8.7...   492   e-171
CAGL0A03828g Chr1 (390687..392117) [1431 bp, 476 aa] {ON} simila...   491   e-170
TDEL0B03350 Chr2 complement(599587..600867) [1281 bp, 426 aa] {O...   484   e-169
Smik_15.482 Chr15 (830795..832072) [1278 bp, 425 aa] {ON} YOR301...   457   e-158
YOR301W Chr15 (880965..882272) [1308 bp, 435 aa] {ON}  RAX1Prote...   451   e-156
ZYRO0F12232g Chr6 (994273..995553) [1281 bp, 426 aa] {ON} simila...   451   e-155
Skud_15.468 Chr15 (820871..822142) [1272 bp, 423 aa] {ON} YOR301...   444   e-153
SAKL0B05456g Chr2 (470064..471362) [1299 bp, 432 aa] {ON} simila...   430   e-147
TBLA0D00840 Chr4 (221070..222803) [1734 bp, 577 aa] {ON} Anc_8.7...   429   e-145
KNAG0G03100 Chr7 (673022..674413) [1392 bp, 463 aa] {ON} Anc_8.7...   414   e-140
KLLA0F24904g Chr6 complement(2319858..2321132) [1275 bp, 424 aa]...   408   e-139
Kwal_34.15943 s34 complement(128372..129670) [1299 bp, 432 aa] {...   385   e-130
KLTH0H15070g Chr8 (1304724..1306040) [1317 bp, 438 aa] {ON} simi...   377   e-126
Suva_8.352 Chr8 (621701..623104) [1404 bp, 467 aa] {ON} YOR301W ...   374   e-125
AFR532W Chr6 (1391215..1392483) [1269 bp, 422 aa] {ON} Syntenic ...   352   e-117
Ecym_1476 Chr1 (980938..982299) [1362 bp, 453 aa] {ON} similar t...   329   e-107
TBLA0I02370 Chr9 (543496..544509) [1014 bp, 337 aa] {ON} Anc_6.3...    37   0.086
KLTH0E00352g Chr5 (33232..34779) [1548 bp, 515 aa] {ON} similar ...    33   2.2  
TBLA0B01940 Chr2 (445353..448736) [3384 bp, 1127 aa] {ON} Anc_1....    33   2.2  

>Kpol_1010.13 s1010 complement(27385..28884) [1500 bp, 499 aa] {ON}
           complement(27385..28884) [1500 nt, 500 aa]
          Length = 499

 Score = 1037 bits (2681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/499 (100%), Positives = 499/499 (100%)

Query: 1   MAQVTDFDRIQQERLPTLYEVLIQKTDSPVDLWSFYTFLSQFPHALNYLEFWIDLMSHIR 60
           MAQVTDFDRIQQERLPTLYEVLIQKTDSPVDLWSFYTFLSQFPHALNYLEFWIDLMSHIR
Sbjct: 1   MAQVTDFDRIQQERLPTLYEVLIQKTDSPVDLWSFYTFLSQFPHALNYLEFWIDLMSHIR 60

Query: 61  LCKDYIRGIRESVLIPNEELKSRRQSEVYENVERNVIETENDIEQPNKENNGDQDNISVT 120
           LCKDYIRGIRESVLIPNEELKSRRQSEVYENVERNVIETENDIEQPNKENNGDQDNISVT
Sbjct: 61  LCKDYIRGIRESVLIPNEELKSRRQSEVYENVERNVIETENDIEQPNKENNGDQDNISVT 120

Query: 121 SSILIDALMDEGYLDFQNPQKVNRFLQGDLEYSPQLSQLLDDWKRHSGYIDHSNDDSYAS 180
           SSILIDALMDEGYLDFQNPQKVNRFLQGDLEYSPQLSQLLDDWKRHSGYIDHSNDDSYAS
Sbjct: 121 SSILIDALMDEGYLDFQNPQKVNRFLQGDLEYSPQLSQLLDDWKRHSGYIDHSNDDSYAS 180

Query: 181 SGKDNKIVSAVDGLLQNYTKMHQERPQVTAKLLLQNAQTICSLYLISPEKSEKYLINVPE 240
           SGKDNKIVSAVDGLLQNYTKMHQERPQVTAKLLLQNAQTICSLYLISPEKSEKYLINVPE
Sbjct: 181 SGKDNKIVSAVDGLLQNYTKMHQERPQVTAKLLLQNAQTICSLYLISPEKSEKYLINVPE 240

Query: 241 HIRNETLQLVEIGGRHDPEVFESMRSLAYQFLEIDCFSKFLNRVALHNIHDQISDWKYHP 300
           HIRNETLQLVEIGGRHDPEVFESMRSLAYQFLEIDCFSKFLNRVALHNIHDQISDWKYHP
Sbjct: 241 HIRNETLQLVEIGGRHDPEVFESMRSLAYQFLEIDCFSKFLNRVALHNIHDQISDWKYHP 300

Query: 301 VKPHSHNDNNTEKKQPKKNLKIFGMNLSNASDDESVNEVEYSRHQSRSPFSNYTTISRIC 360
           VKPHSHNDNNTEKKQPKKNLKIFGMNLSNASDDESVNEVEYSRHQSRSPFSNYTTISRIC
Sbjct: 301 VKPHSHNDNNTEKKQPKKNLKIFGMNLSNASDDESVNEVEYSRHQSRSPFSNYTTISRIC 360

Query: 361 FGTFWMGIGFWIGYVLIFLNYNRGIRVVTIVPFAIGSYFIVCGIYQVDVVYSWFGVTQEL 420
           FGTFWMGIGFWIGYVLIFLNYNRGIRVVTIVPFAIGSYFIVCGIYQVDVVYSWFGVTQEL
Sbjct: 361 FGTFWMGIGFWIGYVLIFLNYNRGIRVVTIVPFAIGSYFIVCGIYQVDVVYSWFGVTQEL 420

Query: 421 MFRHKSSDEENGHPMNLDKNNKGVPGILKVLGGKSRLIRIDHQFIRNLLFKRGLWCCAII 480
           MFRHKSSDEENGHPMNLDKNNKGVPGILKVLGGKSRLIRIDHQFIRNLLFKRGLWCCAII
Sbjct: 421 MFRHKSSDEENGHPMNLDKNNKGVPGILKVLGGKSRLIRIDHQFIRNLLFKRGLWCCAII 480

Query: 481 TISTAIFTVIFSCVPGRRV 499
           TISTAIFTVIFSCVPGRRV
Sbjct: 481 TISTAIFTVIFSCVPGRRV 499

>TPHA0G01210 Chr7 complement(246099..247583) [1485 bp, 494 aa] {ON}
           Anc_8.774 YOR301W
          Length = 494

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/518 (55%), Positives = 367/518 (70%), Gaps = 51/518 (9%)

Query: 6   DFDRIQQERLPTLYEVLIQKTDSPVDLWSFYTFLSQFPHALNYLEFWIDLMSHIRLCKDY 65
           DF+++Q+ERLPTLYEVLI KT+ PVDLWSFYTFLSQFPHA+NYLEFWIDLM+HIRLCKDY
Sbjct: 4   DFEKLQEERLPTLYEVLILKTEKPVDLWSFYTFLSQFPHAINYLEFWIDLMAHIRLCKDY 63

Query: 66  IRGIRESVLIPNEELKSRRQSEVYENV------ERNVIETENDIEQPNKENNGDQDNISV 119
           +  IR SV+   E +   R S+ Y N+       ++  E+ +D   P   +    D+ SV
Sbjct: 64  LENIRSSVI---EVVDESRVSDEYGNLTTAGDHRKHKEESSSDRYGPGGNDGDADDSASV 120

Query: 120 TSSILIDALMDEGYLDFQNPQKVNRFLQGDLEYSPQLSQLLDDWKRHSGYIDHSNDDSYA 179
           TSS+LI+ALM+EGYLDFQ+P +VNRFLQGD+EYSPQLSQLL +W+RHSG     NDD   
Sbjct: 121 TSSLLINALMNEGYLDFQDPDQVNRFLQGDIEYSPQLSQLLAEWRRHSGIPGKRNDDVNE 180

Query: 180 SS------------GKDNKIVSAVDGLLQNYTKMHQE-----RPQVTAKLLLQNAQTICS 222
           S             G +NKI+SA+D LL+N+           +PQ+T K L  NA  IC+
Sbjct: 181 SEIDENTGEKKNQVGYENKILSAIDDLLKNHVSGQNNAGETIKPQITTKQLHHNAAQICT 240

Query: 223 LYLISPEKSEKYLINVPEHIRNETLQLVEIGGRHDPEVFESMRSLAYQFLEIDCFSKFLN 282
           LYL+SPE+S+KYLIN+PEH+R +TL+ ++   R+DP+VFE +++++YQFLEIDCF+KFL 
Sbjct: 241 LYLLSPERSDKYLINIPEHVREDTLKAIQNDKRYDPDVFEELKNISYQFLEIDCFTKFLG 300

Query: 283 RVALHNIHDQISDWKYHPVKPHSHNDNNTEKKQPKKNLKIFGMNLSNASDDESVNEVEYS 342
           RVALHN+HDQISDW++H     +    N E  + KK L                      
Sbjct: 301 RVALHNLHDQISDWRFH--NSSTRFLPNEETHEKKKQL---------------------- 336

Query: 343 RHQSRSPFSNYTTISRICFGTFWMGIGFWIGYVLIFLNYNRGIRVVTIVPFAIGSYFIVC 402
           RH SRS FS+YTT+SR+  G F+MGIGFWIGY LIFLNY RGIRVVTIVPF IGSYFIVC
Sbjct: 337 RHHSRSLFSSYTTLSRVMLGLFFMGIGFWIGYALIFLNYARGIRVVTIVPFIIGSYFIVC 396

Query: 403 GIYQVDVVYSWFGVTQELMFRHK-SSDEENGHPMNLDKNNKGVPGILKVLGGKSRLIRID 461
           GIYQ+D+ Y+ FG+TQELM++HK S DEE  H  NL+  +  + G+ K+LGG++RLI+I 
Sbjct: 397 GIYQIDIAYACFGITQELMYKHKRSPDEETNHSDNLEAKDGEISGLFKILGGQTRLIKIK 456

Query: 462 HQFIRNLLFKRGLWCCAIITISTAIFTVIFSCVPGRRV 499
           H FIRNL++KRGLWC   + IST +FTVIF+CVP RRV
Sbjct: 457 HPFIRNLIYKRGLWCLLWVLISTGVFTVIFACVPSRRV 494

>NDAI0E00630 Chr5 complement(128590..130062) [1473 bp, 490 aa] {ON}
           Anc_8.774 YOR301W
          Length = 490

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/512 (51%), Positives = 353/512 (68%), Gaps = 43/512 (8%)

Query: 6   DFDRIQQERLPTLYEVLIQKTDSPVDLWSFYTFLSQFPHALNYLEFWIDLMSHIRLCKDY 65
           D+ +IQ ERLPTLYEVLIQKT  PVDLWSFYTFLSQFP+A+NYL+FWIDLM+H+RLCKDY
Sbjct: 4   DYKKIQTERLPTLYEVLIQKTKFPVDLWSFYTFLSQFPYAINYLDFWIDLMAHLRLCKDY 63

Query: 66  IRGIRESVLIPNEELKSRRQSEVYENVERNVIETENDIEQPNKENNGDQD------NISV 119
           I GIRES+     E ++ R     +      I+ E    Q + +  G  +      NISV
Sbjct: 64  ISGIRESITYNQNEARNSRIRHHLQYTSEESIQHETQSIQHHDDPEGGDEDDDDDDNISV 123

Query: 120 TSSILIDALMDEGYLDFQNPQKVNRFLQGDLEYSPQLSQLLDDWKRHS---------GYI 170
           T+S+L++AL+DEG+LDF+NP++V++FLQG+ EYSP+LSQLL+DWKRHS         G +
Sbjct: 124 TTSVLLNALLDEGHLDFENPERVSQFLQGNTEYSPKLSQLLEDWKRHSIANNDSNRKGSL 183

Query: 171 DHSNDDSYASSGKDNKIVSAVDGLLQNYTKMHQERPQVTAKLLLQNAQTICSLYLISPEK 230
           + +N +  +       +   VD +L+  ++  +ER ++T K LL NA  ICS+YL SPE+
Sbjct: 184 NRNNSNVRSRETNGAALPDVVDDILRKQSQ-QEERAKITTKQLLNNALKICSIYLQSPER 242

Query: 231 SEKYLINVPEHIRNETLQLVEIGGRHDPEVFESMRSLAYQFLEIDCFSKFLNRVALHNIH 290
           SE+YL N+P+ IR + L LV+   RHDP+VFE ++S+A+QFLE+DCF KFL+ VALHNIH
Sbjct: 243 SERYLTNLPDDIRLKALNLVQNERRHDPQVFEELKSIAFQFLEMDCFPKFLSTVALHNIH 302

Query: 291 DQISDWKYHPVKPHSHNDNNTEKKQPKKNLKIFGMNLSNASDDESVNEVEYSRHQSRSPF 350
           D+ISDW++H     SHN    +K   K +                        H S+SPF
Sbjct: 303 DEISDWRFHS-NARSHNLTRVDKSLIKNH-----------------------DHISKSPF 338

Query: 351 SNYTTISRICFGTFWMGIGFWIGYVLIFLNYNRGIRVVTIVPFAIGSYFIVCGIYQVDVV 410
           S YT +SR  FG  W+GIGFWIGY LIFL Y+RGIRVVTIVPFAIG+YFI+CG+Y+VD++
Sbjct: 339 STYTLLSRTIFGLLWLGIGFWIGYTLIFLKYDRGIRVVTIVPFAIGNYFIICGMYRVDII 398

Query: 411 YSWFGVTQELMFRHKSSDEENGHPMNLDKNNKG---VPGILKVLGGKSRLIRIDHQFIRN 467
           YSWFGVTQ L+++H   + +    + +D+ N     V GIL +LGG+SRLIRI+H FI+N
Sbjct: 399 YSWFGVTQRLLYKHNEKNRDADREVQMDEKNGKNHHVSGILALLGGRSRLIRIEHPFIKN 458

Query: 468 LLFKRGLWCCAIITISTAIFTVIFSCVPGRRV 499
           +L KRGLWC  ++ +ST IFTVIFSCVPG R+
Sbjct: 459 ILMKRGLWCLFLVLLSTGIFTVIFSCVPGYRI 490

>NCAS0B00780 Chr2 (119384..120802) [1419 bp, 472 aa] {ON} Anc_8.774
           YOR301W
          Length = 472

 Score =  521 bits (1343), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/500 (50%), Positives = 358/500 (71%), Gaps = 42/500 (8%)

Query: 6   DFDRIQQERLPTLYEVLIQKTDSPVDLWSFYTFLSQFPHALNYLEFWIDLMSHIRLCKDY 65
           DF++IQ ERLPTLYEVL+QKT +PVDLWSFYTFLSQFP+A+NYL+FW+DLM+H+RLCKDY
Sbjct: 9   DFEKIQTERLPTLYEVLVQKTRAPVDLWSFYTFLSQFPYAINYLDFWMDLMTHLRLCKDY 68

Query: 66  IRGIRESVLIPNEELKSRRQSEVYENVERNVIETENDIEQPNKENNGDQDNISVTSSILI 125
           + GIRES+++ NE    +  S +  N     +E + D            D+ SV +S+L+
Sbjct: 69  VDGIRESLVVNNER---QGNSSLLNNEHAQQVEADAD------------DSASVRTSVLL 113

Query: 126 DALMDEGYLDFQNPQKVNRFLQGDLEYSPQLSQLLDDWKRHSGYIDHSNDDSYASSGKDN 185
           +AL++EG+ D  NP  V++ LQG + +SP+L+QL+DDW RHS  +D SN +  +++  ++
Sbjct: 114 NALLEEGHFDLTNPAGVSQLLQGQVNHSPKLAQLIDDWNRHSQNVDDSNRNRSSNNNSNS 173

Query: 186 KIVSA---VDGLLQNYTKMHQERPQVTAKLLLQNAQTICSLYLISPEKSEKYLINVPEHI 242
              +    +D +L+  +++ +E+P+VT K LL +A  ICSLYL+SPE+SE+YL N+P+ +
Sbjct: 174 NNNNLSSILDDILKRQSQL-EEKPKVTTKQLLNSALKICSLYLLSPEQSERYLTNIPDEV 232

Query: 243 RNETLQLVEIGGRHDPEVFESMRSLAYQFLEIDCFSKFLNRVALHNIHDQISDWKYHPVK 302
           R + + L++   RHDPEVF+ ++S++YQFLEIDCF KFL+ VALHNIHD+ISDW++H   
Sbjct: 233 RLKAVNLIQRNSRHDPEVFDELKSVSYQFLEIDCFPKFLSTVALHNIHDEISDWRFHA-- 290

Query: 303 PHSHNDNNTEKKQPKKNLKIFGMNLSNASDDESVNEVEYSRHQSRSPFSNYTTISRICFG 362
            HS   N                N S AS  E   ++E  RH S+SPFS YTT+SRI FG
Sbjct: 291 -HSTGGNR---------------NKSQASLTE--KDLESMRHISKSPFSTYTTLSRIMFG 332

Query: 363 TFWMGIGFWIGYVLIFLNYNRGIRVVTIVPFAIGSYFIVCGIYQVDVVYSWFGVTQELMF 422
             W+G+GFWIGY LIFL Y+RGIRVVTIVPF IGSYF+VCG+YQVD++YSWFG+TQ L++
Sbjct: 333 LLWLGVGFWIGYTLIFLKYDRGIRVVTIVPFCIGSYFVVCGLYQVDILYSWFGITQRLLY 392

Query: 423 RHKSSDEE--NGH-PMNLDKNNKGVPGILKVLGGKSRLIRIDHQFIRNLLFKRGLWCCAI 479
           + +   E+  +G+ P+++ ++   +P I  +LGG++RLI + H FIR  LF+RGLWCC +
Sbjct: 393 KDRKVTEDGYDGNVPVDVKESKDKIPFIFGILGGRNRLIEVKHPFIRKFLFQRGLWCCLL 452

Query: 480 ITISTAIFTVIFSCVPGRRV 499
           + IST +FTV+FSCVPG RV
Sbjct: 453 VLISTGVFTVVFSCVPGHRV 472

>KAFR0D01490 Chr4 (297425..298756) [1332 bp, 443 aa] {ON} Anc_8.774
           YOR301W
          Length = 443

 Score =  492 bits (1266), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 252/500 (50%), Positives = 331/500 (66%), Gaps = 66/500 (13%)

Query: 6   DFDRIQQERLPTLYEVLIQKTDSPVDLWSFYTFLSQFPHALNYLEFWIDLMSHIRLCKDY 65
           DF +IQ+ERLPTLYEVLIQKT  PVDLWSFYT+LSQFP+A+NYL+FWIDLM+H+RL KDY
Sbjct: 4   DFAKIQEERLPTLYEVLIQKTSVPVDLWSFYTYLSQFPYAINYLDFWIDLMAHLRLSKDY 63

Query: 66  IRGIRESVLIPNEELKSRRQSEVYENVERNVIETENDIEQPNKENNGDQDNISVTSSILI 125
           I GIR S+L                  E N  E EN  +   ++ N + +N+SVT+S+L+
Sbjct: 64  INGIRGSLL-----------------EESNFNELENQ-QSSQEDQNSNSENVSVTTSVLL 105

Query: 126 DALMDEGYLDFQNPQKVNRFLQGDLEYSPQLSQLLDDWKRHSGYIDHSNDDSYASSGKDN 185
           +ALM+EG+LDF+NP +V++FLQG  +YSP+LSQLLD WKRHSG  D +N      +  + 
Sbjct: 106 NALMEEGHLDFENPDRVSKFLQGKADYSPKLSQLLDGWKRHSGIYDANN----NLNIDNG 161

Query: 186 KIVSAVDGLLQNYTKMHQERPQVTAKLLLQNAQTICSLYLISPEKSEKYLINVPEHIRNE 245
            + + +D +L+N +K   E  Q+T K LL NA  IC+ YL S EKS KYL N+ E  R +
Sbjct: 162 NLPTLLDEMLKNKSK-RNETSQITTKQLLNNALQICNTYLYSTEKSAKYLSNISEETRMK 220

Query: 246 TLQLVEIGGRHDPEVFESMRSLAYQFLEIDCFSKFLNRVALHNIHDQISDWKYHPVKPHS 305
            L  V    R+DPEVFE +++  YQ LE DCF KFL+ VALHNIHD++SDW++H      
Sbjct: 221 VLDSVVNQNRYDPEVFEELKATTYQLLETDCFPKFLSTVALHNIHDELSDWRFH------ 274

Query: 306 HNDNNTEKKQPKKNLKIFGMNLSNASDDESVNEVEYSRHQSRSPFSNYTTISRICFGTFW 365
                                    S+  +++        SRSPFSN+TT+SR+ FG  W
Sbjct: 275 -------------------------SEKGAIDNTTLRYRGSRSPFSNHTTLSRLIFGLVW 309

Query: 366 MGIGFWIGYVLIFLNYNRGIRVVTIVPFAIGSYFIVCGIYQVDVVYSWFGVTQELMFRH- 424
           +GIGFWIGYVLIFL Y+R IRVVT+VPFAIG Y I+CG+YQVD++YSWFGVTQ L ++  
Sbjct: 310 LGIGFWIGYVLIFLKYSRAIRVVTVVPFAIGCYLIICGMYQVDIIYSWFGVTQVLTYKDS 369

Query: 425 -----KSSDEENGHPMNLDKNNKGVPGILKVLGGKSRLIRIDHQFIRNLLFKRGLWCCAI 479
                +S+DEE  H    +K    VP ++ +LGG  R ++I+H FI+ LL +RGLWC  +
Sbjct: 370 DSKILRSNDEE--HTTTKEK----VPFLIALLGGGKRTVKIEHTFIKKLLQRRGLWCLLL 423

Query: 480 ITISTAIFTVIFSCVPGRRV 499
           + ISTAIFTVIFSCVPG R+
Sbjct: 424 VVISTAIFTVIFSCVPGFRI 443

>CAGL0A03828g Chr1 (390687..392117) [1431 bp, 476 aa] {ON} similar
           to uniprot|Q08760 Saccharomyces cerevisiae YOR301w RAX1
          Length = 476

 Score =  491 bits (1264), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 247/507 (48%), Positives = 334/507 (65%), Gaps = 42/507 (8%)

Query: 2   AQVTDFDRIQQERLPTLYEVLIQKTDSPVDLWSFYTFLSQFPHALNYLEFWIDLMSHIRL 61
           +   DFD+IQ +RLPTLYEV I KT+ PVDLWSFYT+LSQFP+A+NYL+FWIDLM+HIRL
Sbjct: 3   STAIDFDQIQHQRLPTLYEVFILKTEPPVDLWSFYTYLSQFPYAINYLDFWIDLMAHIRL 62

Query: 62  CKDYIRGIRESVLIPNEELKSRRQSEVYENVERNVIETENDIEQPNKENNGDQDNISVTS 121
           CKDY+  +R+SV+          Q    E   RN+ E  N     N+  N D+D  SVT+
Sbjct: 63  CKDYVSTVRQSVV----------QGSALEEF-RNLDERSN----VNRHMNNDED-ASVTT 106

Query: 122 SILIDALMDEGYLDFQNPQKVNRFLQGDLEYSPQLSQLLDDWKRH--------SGYIDHS 173
           SIL++ L+ EGYLDF+NP+KV++FLQG+   SP +++++ DWK H        + ++  +
Sbjct: 107 SILMNTLLSEGYLDFENPEKVSQFLQGNTHTSPMVTRMIQDWKLHNERNSVAATSHLQST 166

Query: 174 NDDSYASSGKDNKIVSA-VDGLLQNYTKMHQERPQVTAKLLLQNAQTICSLYLISPEKSE 232
                 S  +  + VSA VD  L+  +++  E+  +T K L  NAQ IC+ YL+S + S 
Sbjct: 167 QAGIDISRKESMQSVSAIVDEFLKRQSQL-GEKGNITTKQLYNNAQQICNTYLMSQQHSP 225

Query: 233 KYLINVPEHIRNETLQLVEIGGRHDPEVFESMRSLAYQFLEIDCFSKFLNRVALHNIHDQ 292
           +YL N+P+ ++N+ +   +   RHDPEVF  ++ + YQFLE DCF KFL  VALHNIHD+
Sbjct: 226 RYLANIPDDLKNQVIHNFKANRRHDPEVFRELKEVTYQFLETDCFPKFLKEVALHNIHDE 285

Query: 293 ISDWKYHPVKPHSHNDNNTEKKQPKKNLKIFGMNLSNASDDESVNEVEYSRHQSRSPFSN 352
           +SDW++HP   + H  ++      K+NL      + N              H S SPFS 
Sbjct: 286 LSDWRFHPSNKNPHRTSSPSGS--KENLNGHKQLMQN--------------HISWSPFST 329

Query: 353 YTTISRICFGTFWMGIGFWIGYVLIFLNYNRGIRVVTIVPFAIGSYFIVCGIYQVDVVYS 412
           YT++SR+ FG  WMGIGFWIGYVLIFL+Y+R IRV T+VPF +G Y+IVCGIYQVD++YS
Sbjct: 330 YTSLSRVLFGCMWMGIGFWIGYVLIFLHYSRAIRVTTVVPFGLGCYYIVCGIYQVDIIYS 389

Query: 413 WFGVTQELMFRHKSSDEENGHPMNLDKNNKGVPGILKVLGGKSRLIRIDHQFIRNLLFKR 472
           WFG+TQ LM+ HK  + E G  +     N  VP I  +LGGKSRLI I+H FI+ +L+KR
Sbjct: 390 WFGLTQRLMYSHKKGNIEEGRQVYGATYNDDVPLIFTLLGGKSRLIHIEHPFIKKILYKR 449

Query: 473 GLWCCAIITISTAIFTVIFSCVPGRRV 499
           GLWC  ++ I TAIFTVIF CVPGRR+
Sbjct: 450 GLWCLTLVVIFTAIFTVIFCCVPGRRL 476

>TDEL0B03350 Chr2 complement(599587..600867) [1281 bp, 426 aa] {ON}
           Anc_8.774 YOR301W
          Length = 426

 Score =  484 bits (1247), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 247/497 (49%), Positives = 336/497 (67%), Gaps = 81/497 (16%)

Query: 6   DFDRIQQERLPTLYEVLIQKTDSPVDLWSFYTFLSQFPHALNYLEFWIDLMSHIRLCKDY 65
           D+++IQ+ERLPTLYEVLIQ T +PVD W FYT+LSQFP+A++YL+FWIDLM+HIRLCKDY
Sbjct: 8   DYEQIQRERLPTLYEVLIQVTKAPVDSWEFYTYLSQFPYAIDYLDFWIDLMAHIRLCKDY 67

Query: 66  IRGIRESVLIPNEELKSRRQSEVYENVERNVIETENDIEQPNKENNGDQDNISVTSSILI 125
           ++G+RESV   NE + SR + EV                      N + DN SV+SS+L+
Sbjct: 68  VKGVRESVEF-NETIASRNRDEV----------------------NIEDDNESVSSSVLL 104

Query: 126 DALMDEGYLDFQNPQKVNRFLQGDLEYSPQLSQLLDDWKRHSGYIDHSNDDSYASSGKDN 185
           DAL++EGYLDFQN ++V++FLQGD   SP++S+L+D WKR SG  D          G+++
Sbjct: 105 DALLNEGYLDFQNTKRVSQFLQGDTNDSPRVSRLVDGWKRQSGIAD----------GQNH 154

Query: 186 KIVSAVDGLLQNYTKMHQERPQVTAKLLLQNAQTICSLYLISPEKSEKYLINVPEHIRNE 245
            +   VD +L+  T+  ++ P++T K L+ NA  IC++YL+   +  KYLINVPE ++N+
Sbjct: 155 PLALMVDEMLRKETRKLKQ-PKITRKQLVNNALQICNIYLLKSAEDNKYLINVPERVKNQ 213

Query: 246 TLQLVEIGGRHDPEVFESMRSLAYQFLEIDCFSKFLNRVALHNIHDQISDWKYHPVKPHS 305
            L  V+   RHDP VFE ++++AYQFLEIDCF KFL+ VALHNIHDQIS+W+Y       
Sbjct: 214 VLYDVQQEQRHDPAVFEPLKTVAYQFLEIDCFPKFLSTVALHNIHDQISNWRY------- 266

Query: 306 HNDNNTEKKQPKKNLKIFGMNLSNASDDESVNEVEYSRHQSRSPFSNYTTISRICFGTFW 365
                   + P       G+                 RH+S+SPFSNYT +SR+  G  W
Sbjct: 267 --------QSP-------GLR----------------RHRSKSPFSNYTVLSRVLIGLIW 295

Query: 366 MGIGFWIGYVLIFLNYNRGIRVVTIVPFAIGSYFIVCGIYQVDVVYSWFGVTQELMFRHK 425
           +GIGFWIGY LIFL+Y+R IRVVTIVPFA+GSY IVCG+YQVD++Y++FG+TQ LM++ K
Sbjct: 296 LGIGFWIGYTLIFLHYSRAIRVVTIVPFALGSYSIVCGLYQVDILYAFFGLTQALMYQEK 355

Query: 426 ---SSDEENGHPMNLDKNNKGVPGILKVLGGKSRLIRIDHQFIRNLLFKRGLWCCAIITI 482
               +D ++ H      +   +P I K+LGG+SRLI+I H FI+ LL+KR LWC  + T+
Sbjct: 356 DGSQTDRKHSH------DYSEIPTIFKLLGGRSRLIKIQHDFIKKLLWKRALWCGFLTTL 409

Query: 483 STAIFTVIFSCVPGRRV 499
           +TAI TVIFSCVPG R+
Sbjct: 410 ATAILTVIFSCVPGYRL 426

>Smik_15.482 Chr15 (830795..832072) [1278 bp, 425 aa] {ON} YOR301W
           (REAL)
          Length = 425

 Score =  457 bits (1175), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 241/500 (48%), Positives = 321/500 (64%), Gaps = 76/500 (15%)

Query: 1   MAQVTDFDRIQQERLPTLYEVLIQKTDSPVDLWSFYTFLSQFPHALNYLEFWIDLMSHIR 60
           M +V DF++IQ+ERLPTLYEVLIQ+T  PVDLW+FYTFLSQFP+A+NYL+FW+DLM+H R
Sbjct: 1   MNRVQDFEKIQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWVDLMAHTR 60

Query: 61  LCKDYIRGIRESVLIPNEELKSRRQSEVYENVERNVIETENDIEQPNKENNGDQDNISVT 120
           LCK Y+  + +S+                             I  P KEN G     S T
Sbjct: 61  LCKSYVELVTKSL-----------------------------INFP-KENGG----ASTT 86

Query: 121 SSILIDALMDEGYLDFQNPQKVNRFLQGDLEYSPQLSQLLDDWKRHSGYIDHSNDDSYAS 180
           +  L++AL++EG+LD + P ++ +    D+ +SP+L+QLL DWKR SG    S D     
Sbjct: 87  TLDLLNALIEEGHLDLEAPGRLLKSDGQDMPFSPKLNQLLGDWKRQSGM---SQD----- 138

Query: 181 SGKDNKIVSAVDGLLQNYTKMHQERPQVTAKLLLQNAQTICSLYLISPEKSEKYLINVPE 240
           S + + I   VD +L+  ++     PQ+T K L  +A  +C+ YL+SPE+SE+YL N+P 
Sbjct: 139 SLRRDDIALIVDEILKRRSQ-QDGIPQITTKQLFHSAVGLCNTYLVSPEQSERYLSNIPT 197

Query: 241 HIRNETLQLVEIGGRHDPEVFESMRSLAYQFLEIDCFSKFLNRVALHNIHDQISDWKYHP 300
             RN  ++ +++  ++D EVF+ +++L YQFLE+DCF KFL+RVALHNIHD+ISDW++H 
Sbjct: 198 ETRNRIIEDIQVQQKYDIEVFDDIKNLTYQFLEMDCFPKFLSRVALHNIHDEISDWRFHS 257

Query: 301 VKPHSHNDNNTEKKQPKKNLKIFGMNLSNASDDESVNEVEYSRHQSRSPFSNYTTISRIC 360
           V     N  N + K+ +                          H SRSPFSN+T+ISRI 
Sbjct: 258 V-----NATNEKGKRFRGQA-----------------------HISRSPFSNHTSISRIG 289

Query: 361 FGTFWMGIGFWIGYVLIFLNYNRGIRVVTIVPFAIGSYFIVCGIYQVDVVYSWFGVTQEL 420
           FG  W+GIGFWIGYVLIFL Y R IRVVT+VPFA+G Y IVCG+YQVD+VYSWFGVTQ L
Sbjct: 290 FGLLWLGIGFWIGYVLIFLAYGRAIRVVTVVPFALGCYCIVCGMYQVDIVYSWFGVTQRL 349

Query: 421 MFRHK-SSDEENGHPMNLDKNNKGVPGILKVLGGKSRLIRIDHQFIRNLLFKRGLWCCAI 479
           + RHK SS +++G    +   +  VP +L V GGK RL R+ H F R LL KRGLWC  +
Sbjct: 350 LHRHKNSSSDQDG----VSAGSDHVPVLLAVFGGKRRLTRVKHPFTRQLLRKRGLWCLLL 405

Query: 480 ITISTAIFTVIFSCVPGRRV 499
           +  +TA FTVIFSCVPGRRV
Sbjct: 406 VVGATAAFTVIFSCVPGRRV 425

>YOR301W Chr15 (880965..882272) [1308 bp, 435 aa] {ON}  RAX1Protein
           involved in bud site selection during bipolar budding;
           localization requires Rax2p; has similarity to members
           of the insulin-related peptide superfamily
          Length = 435

 Score =  451 bits (1161), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 230/500 (46%), Positives = 317/500 (63%), Gaps = 73/500 (14%)

Query: 1   MAQVTDFDRIQQERLPTLYEVLIQKTDSPVDLWSFYTFLSQFPHALNYLEFWIDLMSHIR 60
           ++ + +F+ IQ+ERLPTLYEVLIQ+T  PVDLW+FYTFLSQFP+A+NYL+FW+DLM+H R
Sbjct: 8   VSSMQNFEMIQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWVDLMTHTR 67

Query: 61  LCKDYIRGIRESVL-IPNEELKSRRQSEVYENVERNVIETENDIEQPNKENNGDQDNISV 119
           LCK+YI  +R+S++  P E+                             + NG   + S 
Sbjct: 68  LCKNYIELVRKSLINFPQEQ-----------------------------QQNG---STST 95

Query: 120 TSSILIDALMDEGYLDFQNPQKVNRFLQGDLEYSPQLSQLLDDWKRHSGYIDHSNDDSYA 179
            +  L++AL++EG+LD + P K+      D+ +SP+L++LL DWK  SG    +      
Sbjct: 96  ATFDLLNALIEEGHLDPEAPDKLLENSGPDVPFSPKLNELLGDWKHQSGIGQEAL----- 150

Query: 180 SSGKDNKIVSAVDGLLQNYTKMHQERPQVTAKLLLQNAQTICSLYLISPEKSEKYLINVP 239
              ++  +   VD +++  ++    +PQ+T K LL +A  +C+ YL+SPE+SE+YL N+P
Sbjct: 151 ---RNEDVALIVDEIMKRRSQ-QDGKPQITTKQLLHSAVGLCNTYLVSPEQSERYLSNIP 206

Query: 240 EHIRNETLQLVEIGGRHDPEVFESMRSLAYQFLEIDCFSKFLNRVALHNIHDQISDWKYH 299
              RN  ++ V+I  ++D E+F+ +++L YQFLE+DCF KFL+RVALHNIHD+ISDW++H
Sbjct: 207 METRNRIIESVQIERKYDIEIFDDLKNLTYQFLEMDCFPKFLSRVALHNIHDEISDWRFH 266

Query: 300 PVKPHSHNDNNTEKKQPKKNLKIFGMNLSNASDDESVNEVEYSRHQSRSPFSNYTTISRI 359
            V                               +E  N      H SRSPFSN+T+ISRI
Sbjct: 267 SV----------------------------GVTNEKSNRSRGQTHISRSPFSNHTSISRI 298

Query: 360 CFGTFWMGIGFWIGYVLIFLNYNRGIRVVTIVPFAIGSYFIVCGIYQVDVVYSWFGVTQE 419
            FG  W+GIGFWIGYVLIFL Y+R IRVVT+VPF +G Y IVCG+YQVD+VYSWFGVTQ 
Sbjct: 299 GFGLLWLGIGFWIGYVLIFLAYSRAIRVVTVVPFTLGCYCIVCGMYQVDIVYSWFGVTQR 358

Query: 420 LMFRHKSSDEENGHPMNLDKNNKGVPGILKVLGGKSRLIRIDHQFIRNLLFKRGLWCCAI 479
           L+ RHK++  + G   +   +   VP IL V GG+ RL RI+H F R LL KRGLWC  +
Sbjct: 359 LLHRHKNAGNDEG---DASSDTDHVPMILAVFGGRRRLTRIEHPFTRQLLRKRGLWCLLL 415

Query: 480 ITISTAIFTVIFSCVPGRRV 499
           +  +TA FTVIFSCVPGRRV
Sbjct: 416 VVGATAAFTVIFSCVPGRRV 435

>ZYRO0F12232g Chr6 (994273..995553) [1281 bp, 426 aa] {ON} similar
           to uniprot|Q08760 Saccharomyces cerevisiae YOR301W RAX1
           Protein involved in bud site selection during bipolar
           budding localization requires Rax2p
          Length = 426

 Score =  451 bits (1159), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 228/496 (45%), Positives = 321/496 (64%), Gaps = 75/496 (15%)

Query: 6   DFDRIQQERLPTLYEVLIQKTDSPVDLWSFYTFLSQFPHALNYLEFWIDLMSHIRLCKDY 65
           DF  I+ +RLPTLYEVL+++T  PVDLWSFYTFLSQFP+A+++L+FWIDLM+H+RLC+DY
Sbjct: 4   DFTPIENQRLPTLYEVLLRQTSPPVDLWSFYTFLSQFPYAIDFLDFWIDLMAHVRLCRDY 63

Query: 66  IRGIRESVLIPNEELKSRRQSEVYENVERNVIETENDIEQPNKENNGDQDNISVTSSILI 125
           +RG++ES+   N EL +                                D  S  S++L+
Sbjct: 64  VRGVKESIEARNSELIA-------------------------------DDAHSDESNVLL 92

Query: 126 DALMDEGYLDFQNPQKVNRFLQGDLEYSPQLSQLLDDWKRHSGYIDHSNDDSYASSGKDN 185
           DAL+ EGYLDF+N ++V++FL+G++E S ++S+LLD +K+       S+ ++      D 
Sbjct: 93  DALLTEGYLDFKNARRVSQFLRGNVEESMRISRLLDTFKQDHRLSTQSDREA------DE 146

Query: 186 KIVSAVDGLLQNYTKMHQER-PQVTAKLLLQNAQTICSLYLISPEKSEKYLINVPEHIRN 244
            + + VD +L+   K+H+++ P++T K L+ NA  IC  YL+SP++S +YLINVP+ IR 
Sbjct: 147 FLAAMVDDMLKQ--KIHKDKQPKMTRKQLINNASQICRQYLLSPQESPRYLINVPDEIRM 204

Query: 245 ETLQLVEIGGRHDPEVFESMRSLAYQFLEIDCFSKFLNRVALHNIHDQISDWKYHPVKPH 304
           + L  V+   R DPE+FE +R+L+Y FLE+DCF KFLNRVALHN+HDQ+SDW++      
Sbjct: 205 KALHAVQSERRFDPELFEDLRNLSYDFLEMDCFPKFLNRVALHNLHDQLSDWRFQ----- 259

Query: 305 SHNDNNTEKKQPKKNLKIFGMNLSNASDDESVNEVEYSRHQSRSPFSNYTTISRICFGTF 364
                                  + A+  +S  ++   R  S SP S Y+ + RI  G  
Sbjct: 260 -----------------------TTAAIGKSKGDIRGQR--SASPLSTYSGLGRIALGLC 294

Query: 365 WMGIGFWIGYVLIFLNYNRGIRVVTIVPFAIGSYFIVCGIYQVDVVYSWFGVTQELMFRH 424
           W+GIGFWIGYVLIFL+Y+R IRV TIVPF IG YF VCGIYQVD++YSWFGVTQ LM+  
Sbjct: 295 WLGIGFWIGYVLIFLHYSRAIRVTTIVPFGIGCYFSVCGIYQVDILYSWFGVTQRLMYEK 354

Query: 425 K-SSDEENGHPMNLDKNNKGVPGILKVLGGKSRLIRIDHQFIRNLLFKRGLWCCAIITIS 483
           K  SD E   P    K+   VP I  +LGG+SRL+ + H FI+ LL +RG+WC  ++ +S
Sbjct: 355 KLPSDREEDVP----KSRTRVPTIFALLGGRSRLMPVHHPFIKKLLLRRGMWCFLLVVVS 410

Query: 484 TAIFTVIFSCVPGRRV 499
           TA+ TV+FSCVPG+R+
Sbjct: 411 TAVLTVLFSCVPGKRI 426

>Skud_15.468 Chr15 (820871..822142) [1272 bp, 423 aa] {ON} YOR301W
           (REAL)
          Length = 423

 Score =  444 bits (1141), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 238/500 (47%), Positives = 315/500 (63%), Gaps = 78/500 (15%)

Query: 1   MAQVTDFDRIQQERLPTLYEVLIQKTDSPVDLWSFYTFLSQFPHALNYLEFWIDLMSHIR 60
           M  V DF+ +Q+ RLPTLYEVLIQ+T  PVDLW+FYTFLSQFP+A+NYL+FWIDLM+H R
Sbjct: 1   MNSVHDFEELQRVRLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWIDLMAHTR 60

Query: 61  LCKDYIRGIRESVLIPNEELKSRRQSEVYENVERNVIETENDIEQPNKENNGDQDNISVT 120
           LC+ Y+  +R+S++                           +  Q  +EN G     SV 
Sbjct: 61  LCQSYVELVRKSLV---------------------------NYPQEQQENGG----ASVK 89

Query: 121 SSILIDALMDEGYLDFQNPQKVNRFLQGDLEYSPQLSQLLDDWKRHSGYIDHSNDDSYAS 180
           +  L+ AL++EG+LD + P+K+ +    DL +SP+L+QLL+ WKR SG     ++DS   
Sbjct: 90  THDLLSALVEEGHLDPETPEKLLQNSGPDLPFSPKLNQLLEGWKRQSGI----SEDSL-- 143

Query: 181 SGKDNKIVSAVDGLLQNYTKMHQERPQVTAKLLLQNAQTICSLYLISPEKSEKYLINVPE 240
             ++  +   VD +L+  ++     PQ+T K LL +A  +C+ YL S E+ E+YL N+P 
Sbjct: 144 --RNEDMTLIVDEILKRRSQ-QDGVPQITTKQLLHSAMGLCTTYLASSEQRERYLSNIPT 200

Query: 241 HIRNETLQLVEIGGRHDPEVFESMRSLAYQFLEIDCFSKFLNRVALHNIHDQISDWKYHP 300
             RN  ++ V++  R+D EVF+ +++LAYQFLE+DCF KFL+RVALHNIHD+ISDW++H 
Sbjct: 201 ETRNRIVKDVQVKRRYDIEVFDDVKNLAYQFLEMDCFPKFLSRVALHNIHDEISDWRFHS 260

Query: 301 VKPHSHNDNNTEKKQPKKNLKIFGMNLSNASDDESVNEVEYSRHQSRSPFSNYTTISRIC 360
           V                             + +E    V    H SRSPFSN+T+ISRI 
Sbjct: 261 V----------------------------GATNEKNKRVRGQTHISRSPFSNHTSISRIG 292

Query: 361 FGTFWMGIGFWIGYVLIFLNYNRGIRVVTIVPFAIGSYFIVCGIYQVDVVYSWFGVTQEL 420
           FG  W+GIGFWIGYVLIFL Y+R IRVVT+VPFA+G Y IVCG+YQVD+VYSWFGVTQ L
Sbjct: 293 FGLLWLGIGFWIGYVLIFLAYSRAIRVVTVVPFALGCYCIVCGMYQVDIVYSWFGVTQRL 352

Query: 421 MFRHK-SSDEENGHPMNLDKNNKGVPGILKVLGGKSRLIRIDHQFIRNLLFKRGLWCCAI 479
           + RHK  SD E+    + D     VP IL     KSRL  + H FIR LL KRGLWC  +
Sbjct: 353 LHRHKDGSDNEDDSSEDFDH----VPAIL-----KSRLTCVQHPFIRQLLRKRGLWCLLL 403

Query: 480 ITISTAIFTVIFSCVPGRRV 499
           +  +TA FTVIFSCVPGRRV
Sbjct: 404 VVGATAAFTVIFSCVPGRRV 423

>SAKL0B05456g Chr2 (470064..471362) [1299 bp, 432 aa] {ON} similar
           to uniprot|Q08760 Saccharomyces cerevisiae YOR301W RAX1
           Protein involved in bud site selection during bipolar
           budding localization requires Rax2p
          Length = 432

 Score =  430 bits (1106), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 230/499 (46%), Positives = 320/499 (64%), Gaps = 73/499 (14%)

Query: 5   TDFDRIQQERLPTLYEVLIQKTDSPVDLWSFYTFLSQFPHALNYLEFWIDLMSHIRLCKD 64
           T+  ++Q +RLPTLYEVL Q+T +PVDLWSFYT+LSQFPHA+NYL+FWID+M+H+RLCKD
Sbjct: 3   TESTKLQSDRLPTLYEVLNQQTTTPVDLWSFYTYLSQFPHAINYLDFWIDIMAHLRLCKD 62

Query: 65  YIRGIRESVLIPNEELKSRRQSEVYENVERNVIETENDIEQPNKENNGDQDNI--SVTSS 122
           Y++GIRESVL                     V E  N   +  K ++G  DN   SV++S
Sbjct: 63  YVKGIRESVL---------------------VWEEANRPPRIPKHDSGVSDNYRSSVSTS 101

Query: 123 ILIDALMDEGYLDFQNPQKVNRFLQGDLEYSPQLSQLLDDWKRHSGYIDHSNDDSYASSG 182
           +L++ALM++G LDFQ+ ++V++FLQG  + SP+LSQL+++WKR S   D           
Sbjct: 102 LLLEALMNDGVLDFQDSKRVSQFLQGQTD-SPRLSQLMENWKRQSALED----------- 149

Query: 183 KDNKIVSAVDGLLQNYTKMHQERPQVTAKLLLQNAQTICSLYLISPEKSEKYLINVPEHI 242
            ++++   +D  L+   K  Q+ P++T K LL NA  I ++YL SP++S K+L+NVPE I
Sbjct: 150 -NDRLTEVLDDFLKQEMKESQQ-PRITTKQLLNNALQIVNMYLSSPQQSPKFLVNVPEKI 207

Query: 243 RNETLQLVEIGGRHDPEVFESMRSLAYQFLEIDCFSKFLNRVALHNIHDQISDWKYHPVK 302
           R + +  V++  RHDP+VFES++S+A+QFLE+DCF KFL  VALHN+HD ++D       
Sbjct: 208 RLDAIHTVQVQQRHDPDVFESLKSVAFQFLEMDCFPKFLGCVALHNLHDDMTDHS----S 263

Query: 303 PHSHNDNNTEKKQPKKNLKIFGMNLSNASDDESVNEVEYSRHQSRSPFSNYTTISRICFG 362
           P       T+                              RH+  S FS YT +SR+  G
Sbjct: 264 PLGGKTATTQ------------------------------RHRKSSLFSTYTILSRVFLG 293

Query: 363 TFWMGIGFWIGYVLIFLNYNRGIRVVTIVPFAIGSYFIVCGIYQVDVVYSWFGVTQELMF 422
              +GIGFWIGYVLIFL+Y+RGIRVVTIVPF +G Y++VCGIYQ+DVVY+ FGVTQ L+ 
Sbjct: 294 LLLLGIGFWIGYVLIFLDYSRGIRVVTIVPFFLGFYYVVCGIYQLDVVYALFGVTQNLVT 353

Query: 423 RHKSSDEENGHPMNLDK--NNKGVPGILKVLGGKSRLIRIDHQFIRNLLFKRGLWCCAII 480
                D E G+  N  K  N + +P I +VLGG+ RL+++ H F+  +L +R +WC  +I
Sbjct: 354 NKDKRDLELGYQRNSSKSSNVRRLPVIFRVLGGRGRLVKVRHPFVDRILKRRSVWCWFLI 413

Query: 481 TISTAIFTVIFSCVPGRRV 499
            + TAIFTVIFSCVPG R+
Sbjct: 414 LLGTAIFTVIFSCVPGHRL 432

>TBLA0D00840 Chr4 (221070..222803) [1734 bp, 577 aa] {ON} Anc_8.774
           YOR301W
          Length = 577

 Score =  429 bits (1103), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 241/583 (41%), Positives = 345/583 (59%), Gaps = 98/583 (16%)

Query: 6   DFDRIQQERLPTLYEVLIQKTDSPVDLWSFYTFLSQFPHALNYLEFWIDLMSHIRLCKDY 65
           D+ +IQ ERLPTLYEVLIQK+ +P DLWSFYT+LSQFP+A+NYLEFWIDLM+H RLC+  
Sbjct: 4   DYKQIQHERLPTLYEVLIQKSSAPADLWSFYTYLSQFPYAINYLEFWIDLMNHNRLCRHL 63

Query: 66  IRGIRESVLIPNE---ELKSRRQSEVYENVERNVI------------------ETENDIE 104
           I  I+ S++  N+    L      ++ +    N I                  +T +++E
Sbjct: 64  INEIKNSLIQNNKNNPHLNEEDLQKIIDKYSNNDILPPSMPLPQAVSTPPADFDTIDEVE 123

Query: 105 Q--------PNKENNGDQDNISVTSSILIDALMDEGYLDFQNPQKVNRFLQGDLEYSP-- 154
           +        P ++ + D DN S+TSSIL++ LM+EGYL+  +  ++++F QG++  S   
Sbjct: 124 RESLSNMPIPEQDEDIDNDNDSITSSILLNVLMNEGYLNPDDHYRMSKFFQGNIGGSNDY 183

Query: 155 QLSQLLDDWKRHSGYIDHSNDDSYASSGK-----------------DNKIVSAVDGLLQN 197
           ++SQL+ +W+RH+    +SN+    ++G+                   +  + VD LLQN
Sbjct: 184 RMSQLMQNWQRHNDN-SNSNNTRQTNTGETNNAGNNSNSNSYTNNTTERFAAMVDELLQN 242

Query: 198 -------------YTKMHQERPQ-----------VTAKLLLQNAQTICSLYLISPEKSEK 233
                           + ++  Q           +T + L++NA+ IC+LYLISPEKS+K
Sbjct: 243 NRIPMPSPILPNTQENIQEQEDQANASSSSFLNGLTTRDLIKNARNICNLYLISPEKSKK 302

Query: 234 YLINVPEHIRNETLQLVEIGGRHDPEVFESMRSLAYQFLEIDCFSKFLNRVALHNIHDQI 293
           YLIN+PE I+ + ++ ++   R DP +F+ +++L Y FLE+DCF KFL+++ALHNIHDQI
Sbjct: 303 YLINIPETIKFDIIKKIKFENRFDPLIFDDLQNLTYNFLEVDCFPKFLSKIALHNIHDQI 362

Query: 294 SDWKYHPV-----------KPHSHNDNNTEKKQPKKNLKIFGMNLSNASDDESVNEVEYS 342
           SDW++H             +  S NDN++     K        N  + +DD         
Sbjct: 363 SDWRFHSSFKLTSQNRKSNRGLSENDNSSSTDNEK--------NYQSDNDDNDSMIYNID 414

Query: 343 RHQSRSPFSNYTTISRICFGTFWMGIGFWIGYVLIFLNYNRGIRVVTIVPFAIGSYFIVC 402
            H SRSPFSNYT ISR+  G  W+GIGFWIGY LIFLNY+RGIRV T+ PF  G Y+I+C
Sbjct: 415 NHISRSPFSNYTIISRLFVGFIWLGIGFWIGYTLIFLNYSRGIRVTTLPPFLFGCYYIIC 474

Query: 403 GIYQVDVVYSWFGVTQELMFR------HKSSDEENGHPMNLDKNNKGVPGILKVLGGKSR 456
           G+YQ+D+ YS FGVTQ+LMF+      H +   +     NL    +G+P    + GGK R
Sbjct: 475 GLYQLDIFYSLFGVTQDLMFQPKRNLLHANKKIDKTTKKNLKHLKRGIPFFFNLFGGKKR 534

Query: 457 LIRIDHQFIRNLLFKRGLWCCAIITISTAIFTVIFSCVPGRRV 499
           LI+IDH +IRNLLFKRG+WC  ++ +STA  TVIFS VPG RV
Sbjct: 535 LIKIDHPYIRNLLFKRGIWCAILVALSTAGLTVIFSVVPGWRV 577

>KNAG0G03100 Chr7 (673022..674413) [1392 bp, 463 aa] {ON} Anc_8.774
           YOR301W
          Length = 463

 Score =  414 bits (1064), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 225/510 (44%), Positives = 313/510 (61%), Gaps = 66/510 (12%)

Query: 6   DFDRIQQERLPTLYEVLIQKTDSPVDLWSFYTFLSQFPHALNYLEFWIDLMSHIRLCKDY 65
           +F +IQ+ERLPTLYEVLIQK+ +P+DLWSFYT+LSQFP A+NYL+FWIDLM+HIRLCKD+
Sbjct: 4   NFAQIQKERLPTLYEVLIQKSGAPLDLWSFYTYLSQFPFAINYLDFWIDLMAHIRLCKDF 63

Query: 66  IRGIRESVLIPNEELKSRRQSEVYENVERNVIETENDIEQPNKENNGDQDNISVTSSILI 125
           I+G+R S+                E  ERN         +  +   G  D  SVT+S+L+
Sbjct: 64  IKGVRRSI---------------GEAAERN---------EEQQGGGGADDTASVTTSVLM 99

Query: 126 DALMDEGYLDFQNPQKVNRF-------------LQGDLEYSPQLSQLLDDWKRHSG--YI 170
             +M+E  LD   P  V  F             L+    YS ++SQ+LD+W   +   Y 
Sbjct: 100 QTIMEEAQLDLNRPDDVYSFFRNSHQQDGLGDNLRASSRYSARVSQMLDEWNGRTSHRYT 159

Query: 171 DHSNDDSYASSGKDNKIVSAVDGLLQNYTKMHQERPQ-VTAKLLLQNAQTICSLYLISPE 229
            HS D S      +  + + +D  L  ++K   +    +T K LL NA  +C  YLIS E
Sbjct: 160 GHSVDIS------NGNLTTLMDEFLNEHSKTRGDGGAYITTKQLLHNATHMCRTYLISRE 213

Query: 230 KSEKYLINVPEHIRNETLQLVEIGGRHDPEVFESMRSLAYQFLEIDCFSKFLNRVALHNI 289
           +SE+YL N+P  IR   L  V    ++DP +F+ +++L YQFLEIDCF KFL++VALHN+
Sbjct: 214 ESERYLTNIPTEIREYILVGVLDAKKYDPGIFDDLKTLTYQFLEIDCFPKFLSQVALHNL 273

Query: 290 HDQISDWKYHPVKPHSHNDNNTEKKQPKKNLKIFGMNLSNASDDESVNEVEYSRHQSRSP 349
           HD+IS+W+++ +    ++                G  L+   + ++V         + +P
Sbjct: 274 HDEISNWRFNKLDSTKYSGG--------------GGALTGDPEKDAVG-----YRGAHTP 314

Query: 350 FSNYTTISRICFGTFWMGIGFWIGYVLIFLNYNRGIRVVTIVPFAIGSYFIVCGIYQVDV 409
           FSNYTT+SRI FG  W+GIGFWIGY LIFL Y+R IRVVT+VPFA+G Y+ +CG+YQVD+
Sbjct: 315 FSNYTTLSRILFGLLWLGIGFWIGYTLIFLKYSRAIRVVTVVPFALGCYYCICGLYQVDI 374

Query: 410 VYSWFGVTQELMFRHKSSDEENGHPMNLDKNNKGVPGILKVLGGKSRLIRIDHQFIRNLL 469
           +YS FGVTQ L+ R  ++  E+  P + D     VP +L + GG+ RL++I+H+F R LL
Sbjct: 375 IYSIFGVTQRLLQRETAAAGED-PPTHTDATTAKVPSLLVLFGGRGRLLKIEHEFTRRLL 433

Query: 470 FKRGLWCCAIITISTAIFTVIFSCVPGRRV 499
            +RGLWC  ++T STA FTVIFSCVPG RV
Sbjct: 434 LRRGLWCLLLVTFSTAAFTVIFSCVPGYRV 463

>KLLA0F24904g Chr6 complement(2319858..2321132) [1275 bp, 424 aa]
           {ON} similar to uniprot|Q08760 Saccharomyces cerevisiae
           YOR301W RAX1 Protein involved in bud site selection
           during bipolar budding localization requires Rax2p
          Length = 424

 Score =  408 bits (1049), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 217/495 (43%), Positives = 316/495 (63%), Gaps = 84/495 (16%)

Query: 11  QQERLPTLYEVLIQKTDSPVDLWSFYTFLSQFPHALNYLEFWIDLMSHIRLCKDYIRGIR 70
           Q+ RLPTLYEVL Q+T +P+DLWSFYT+LSQ+PHA+ YL+FW D+M+++RLCKDY++GIR
Sbjct: 8   QRARLPTLYEVLNQQTAAPLDLWSFYTYLSQYPHAIVYLDFWTDVMAYLRLCKDYVKGIR 67

Query: 71  ESVLIPNEELKSRRQSEVYENVERNVIETENDIEQPNKENNGDQDNISVTSSILIDALMD 130
           ESVL                  + N +ET   ++    E NGD    SV+S++L++ALM+
Sbjct: 68  ESVL------------------DVNKLETPTVLQ----EGNGDDKRESVSSAMLLEALMN 105

Query: 131 EGYLDFQNPQKVNRFLQGDLEYSPQLSQLLDDWKR-HSGYIDHSNDDSYASSGKDNKIVS 189
           +GYLD+ + Q+V++FL+G+ + SP+LSQLL DWK+ ++  ID S+               
Sbjct: 106 DGYLDYNDSQRVSQFLKGETD-SPRLSQLLQDWKQVNNDQIDFSD--------------- 149

Query: 190 AVDGLLQ-NYTKMHQERPQVTAKLLLQNAQTICSLYLISPEKSEKYLINVPEHIRNETLQ 248
            VDGL++ N TK H  +P++T K L+ +AQ I S YL+S E+S+++L  +P ++RN+T++
Sbjct: 150 FVDGLVKSNVTKDH--KPKLTTKQLISSAQDIVSTYLLSQEQSDRFLFEIPAYLRNDTIR 207

Query: 249 LVEIGGRHDPEVFESMRSLAYQFLEIDCFSKFLNRVALHNIHDQISDWKYHPVKPHSHND 308
           L+    RHDPEVFE ++ + YQFLE+DCF +FL  VALHN+HD+I               
Sbjct: 208 LIMEEKRHDPEVFEPIKEIVYQFLEVDCFPRFLGCVALHNLHDEIV-------------- 253

Query: 309 NNTEKKQPKKNLKIFGMNLSNASDDESVNEVEYSRHQSRSPFSNYTTISRICFGTFWMGI 368
                ++PKKN              +S N       +S SPFS ++T SR+  G  W  +
Sbjct: 254 ----LQRPKKN--------------KSYNS------RSNSPFSQWSTASRLTIGLAWWLV 289

Query: 369 GFWIGYVLIFLNYNRGIRVVTIVPFAIGSYFIVCGIYQVDVVYSWFGVTQELMFRHKSSD 428
           G WIGY LIF+NY++GIRVV IVPF +GSY+I+CGIY VD++Y++ GVTQ L+ + K  D
Sbjct: 290 GLWIGYTLIFMNYSKGIRVVCIVPFFLGSYYIICGIYLVDIIYAFSGVTQTLVSKRKLDD 349

Query: 429 EE----NGHPMNLDKNNKGVPGILKVLGGKSRLIRIDHQFIRNLLFKRGLWCCAIITIST 484
            E    N H  N   ++  VP  L + GG+SRL ++ H F+ +++ +R LWC  ++ I T
Sbjct: 350 LELRSMNNHRSNSLHSSNEVPWWLTIFGGRSRLCKVKHPFVNSIMIRRALWCLLLVLIMT 409

Query: 485 AIFTVIFSCVPGRRV 499
           AI T IF+ VPGRR+
Sbjct: 410 AILTAIFAAVPGRRI 424

>Kwal_34.15943 s34 complement(128372..129670) [1299 bp, 432 aa] {ON}
           YOR301W (RAX1) - Similar to B-chains of the
           insulin-related hormone superfamily. [contig 272] FULL
          Length = 432

 Score =  385 bits (989), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 211/491 (42%), Positives = 310/491 (63%), Gaps = 74/491 (15%)

Query: 14  RLPTLYEVLIQKTDSPVDLWSFYTFLSQFPHALNYLEFWIDLMSHIRLCKDYIRGIRESV 73
           RLPTL+EVL +++ +PVDLWSFY FLSQ+P+A+N+L+FWID+M+H+RLCKDY++GIRESV
Sbjct: 11  RLPTLFEVLNRQSAAPVDLWSFYIFLSQYPYAINFLDFWIDVMAHLRLCKDYVKGIRESV 70

Query: 74  LIPNEELKSRRQSEVYENVERNVIETENDIEQPNKENNGDQDNISVTSSILIDALMDEGY 133
                                  IE E+ +E   +         S++SS+L++ALM++GY
Sbjct: 71  -----------------------IEWEDSLE---RSGANRDSRDSLSSSLLLEALMNDGY 104

Query: 134 LDFQNPQKVNRFLQGDLEYSPQLSQLLDDWKRHSGYIDHSNDDSYASSGKDNKIVSAVDG 193
           LD+++ ++V+RFLQG  + SP+L++LLD+W++H+       D   A +   + +   VD 
Sbjct: 105 LDYEDSKRVSRFLQGHTD-SPRLTRLLDNWQKHA-------DQDSAGAPFKSPLTGLVDD 156

Query: 194 LLQNYTKMHQ-ERPQVTAKLLLQNAQTICSLYLISPEKSEKYLINVPEHIRNETLQLVEI 252
            L+  T+ H   + ++T+K LL NAQ I + YL+SPE S +YLIN+P+H+R  TL++V  
Sbjct: 157 FLK--TQAHDFHKARITSKELLNNAQNIVNTYLLSPETSVRYLINLPDHMRENTLRMVRD 214

Query: 253 GGRHDPEVFESMRSLAYQFLEIDCFSKFLNRVALHNIHDQISDWKYHPVKPHSHNDNNTE 312
             RHDPE+FE ++SLA+QFLE+DCF KFL  VALHN+HD I+     P+         T 
Sbjct: 215 EKRHDPELFEQLKSLAFQFLEMDCFPKFLTSVALHNLHDDITT---PPL---------TA 262

Query: 313 KKQPKKNLKIFGMNLSNASDDESVNEVEYSRHQSRSPFSNYTTISRICFGTFWMGIGFWI 372
            + P                    +E  ++R    SPF+++TT+SR+  G  ++ +G W+
Sbjct: 263 PQTP-------------------AHEPSFTRRH--SPFAHHTTLSRVALGMLFLWMGLWL 301

Query: 373 GYVLIFLNYNRGIRVVTIVPFAIGSYFIVCGIYQVDVVYSWFGVTQELMFRHKSSDEENG 432
           GY LIFL+Y+RGIRV TIVPF +G YFI CGIY++D++Y+  GVTQ L+   + S ++  
Sbjct: 302 GYTLIFLDYSRGIRVTTIVPFFLGFYFICCGIYRIDILYALAGVTQTLVSNEQVSLKDLE 361

Query: 433 HPMNLDKNN----KGVPGILKVLGGKSRLIRIDHQFIRNLLFKRGLWCCAIITISTAIFT 488
             +N +  N       P + ++LGG  RL+RI H FI  LL KRG WC  ++   T +FT
Sbjct: 362 IGLNRNSVNHRMSHNAPFVFRILGGTGRLVRIKHPFINKLLKKRGYWCLLLVLTLTGVFT 421

Query: 489 VIFSCVPGRRV 499
           VIFSCVPGRR+
Sbjct: 422 VIFSCVPGRRL 432

>KLTH0H15070g Chr8 (1304724..1306040) [1317 bp, 438 aa] {ON} similar
           to uniprot|Q08760 Saccharomyces cerevisiae YOR301W RAX1
           Protein involved in bud site selection during bipolar
           budding localization requires Rax2p
          Length = 438

 Score =  377 bits (967), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 204/494 (41%), Positives = 309/494 (62%), Gaps = 73/494 (14%)

Query: 13  ERLPTLYEVLIQKTDSPVDLWSFYTFLSQFPHALNYLEFWIDLMSHIRLCKDYIRGIRES 72
           +RLPTLYEVL ++T +PVDLWSFYTFLSQ+P+A+N+L+FWID M+H+RLCKDY++G+RES
Sbjct: 11  QRLPTLYEVLNRQTCAPVDLWSFYTFLSQYPYAINFLDFWIDAMAHLRLCKDYVKGVRES 70

Query: 73  VLIPNEELKSRRQSEVYENVERNVIETENDIEQ--PNKENNGDQDNI-SVTSSILIDALM 129
                                   +E E+  E+   N+++    DN  S++SS+L++ALM
Sbjct: 71  F-----------------------VEWEDSQERSGANRDSRDSHDNRDSLSSSLLLEALM 107

Query: 130 DEGYLDFQNPQKVNRFLQGDLEYSPQLSQLLDDWKRHSGYIDHSNDDSYASSGKDNKIVS 189
           ++G+LD+++ ++V+RFLQG  + SP+L++LLD+W++ +   +H +D  + S      +  
Sbjct: 108 NDGFLDYEDSKRVSRFLQGQTD-SPRLTKLLDNWQKQT---EHDSDAPFKS-----PLTG 158

Query: 190 AVDGLLQNYTKMHQERPQVTAKLLLQNAQTICSLYLISPEKSEKYLINVPEHIRNETLQL 249
            VD  L+   +  Q + ++T+K LL NA+ I   YL++PE+S +YLIN+P+H+R   + +
Sbjct: 159 LVDEFLKTQAQDFQ-KARITSKELLNNARNIVHTYLLAPEESSRYLINLPDHMRQNAVHM 217

Query: 250 VEIGGRHDPEVFESMRSLAYQFLEIDCFSKFLNRVALHNIHDQISDWKYHPVKPHSHNDN 309
           V    RHDP+VFE ++++++QFLE+DCF KFL+ VALHN+HD I+               
Sbjct: 218 VLEEKRHDPDVFEQLKAISFQFLEMDCFPKFLSCVALHNLHDDIT--------------- 262

Query: 310 NTEKKQPKKNLKIFGMNLSNASDDESVNEVEYSRHQSRSPFSNYTTISRICFGTFWMGIG 369
           ++    P   L I G +                  + RS F+ YTT+SR+  G  ++ +G
Sbjct: 263 SSSLSDP---LAILGSSAPG---------------RRRSLFARYTTLSRVVLGMIFLWMG 304

Query: 370 FWIGYVLIFLNYNRGIRVVTIVPFAIGSYFIVCGIYQVDVVYSWFGVTQELMFRH--KSS 427
            W+GY L+FLNY+RGIRV TIVPF +G YFI CGIY++D++Y+  GVTQ L+      S 
Sbjct: 305 LWLGYTLVFLNYSRGIRVTTIVPFFLGFYFIWCGIYKIDILYALCGVTQTLVSNELVSSK 364

Query: 428 DEENGHPMNL--DKNNKGVPGILKVLGGKSRLIRIDHQFIRNLLFKRGLWCCAIITISTA 485
           D E G   N   +K  +    + +V GG SRL+ I   F+ ++L +R LWC  ++   TA
Sbjct: 365 DLEIGLNRNAVHNKTRQSTSPVFRVFGGSSRLVSIQQPFVNSMLRRRALWCLVLVLAGTA 424

Query: 486 IFTVIFSCVPGRRV 499
           IFTVIFSCVPG R+
Sbjct: 425 IFTVIFSCVPGHRL 438

>Suva_8.352 Chr8 (621701..623104) [1404 bp, 467 aa] {ON} YOR301W
           (REAL)
          Length = 467

 Score =  374 bits (960), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 207/465 (44%), Positives = 289/465 (62%), Gaps = 80/465 (17%)

Query: 1   MAQVTDFDRIQQERLPTLYEVLIQKTDSPVDLWSFYTFLSQFPHALNYLEFWIDLMSHIR 60
           M  V DF++IQ ERLPTLYEVLIQ+T  PVDLW+FYTFLSQFP+A+NYL+FW+DLM+H R
Sbjct: 1   MNNVEDFEKIQYERLPTLYEVLIQRTSRPVDLWTFYTFLSQFPYAINYLDFWVDLMAHTR 60

Query: 61  LCKDYIRGIRESVL-IPNEELKSRRQSEVYENVERNVIETENDIEQPNKENNGDQDNISV 119
           LC+ Y++ +R+S+   P E                              +  GD    S 
Sbjct: 61  LCQSYVKMVRKSLANFPQEH-----------------------------QQKGDG---SA 88

Query: 120 TSSILIDALMDEGYLDFQNPQKVNRFLQGDLEYSPQLSQLLDDWKRHSGYIDHSNDDSYA 179
           T+  L+DAL++EG+L+ Q+P+ + +    D+ +SP+L+++L +WK HSG    S D   A
Sbjct: 89  TTFNLLDALIEEGHLNLQSPENLLQNEPSDVPFSPKLNEMLGNWKHHSGI---SQD---A 142

Query: 180 SSGKDNKIVSAVDGLLQNYTKMHQERPQVTAKLLLQNAQTICSLYLISPEKSEKYLINVP 239
              +D  ++  +D +L+  ++     PQ+T K LL +A  +C+ YL+SPE+SE+YL N+P
Sbjct: 143 LQNEDMALI--LDEILKRRSQ-QDGVPQITTKQLLHSAMGLCTTYLVSPEQSERYLSNIP 199

Query: 240 EHIRNETLQLVEIGGRHDPEVFESMRSLAYQFLEIDCFSKFLNRVALHNIHDQISDWKYH 299
              R   L+ +++  ++D  +F+ +++L YQFLE+DCF KFL+RVALHNIHD+ISDW++H
Sbjct: 200 AETRTRILEDIQVDRKYDVAIFDDVKALTYQFLEMDCFPKFLSRVALHNIHDEISDWRFH 259

Query: 300 PVKPHSHNDNNTEKKQPKKNLKIFGMNLSNASDDESVNEVEYSRHQSRSPFSNYTTISRI 359
                             KN +  G                   H SRSPFSN+T+ISRI
Sbjct: 260 -----------------SKNSRSRGQT-----------------HISRSPFSNHTSISRI 285

Query: 360 CFGTFWMGIGFWIGYVLIFLNYNRGIRVVTIVPFAIGSYFIVCGIYQVDVVYSWFGVTQE 419
             G  W+GIGFWIGYVLIFL Y R IRVVT+VPFA+G Y +VCG+YQVD+VYSWFGVTQ 
Sbjct: 286 GLGLLWLGIGFWIGYVLIFLAYGRAIRVVTVVPFALGCYCVVCGMYQVDIVYSWFGVTQR 345

Query: 420 LMFRHKSSDEENGHPMNLDKNNKGVPGILKVLGGKSRLIRIDHQF 464
           L+ RHK+S+++         +   VPG+L V GGKSRL  + H F
Sbjct: 346 LLHRHKNSNDD----AGAATDADHVPGVLAVFGGKSRLTSVQHPF 386

>AFR532W Chr6 (1391215..1392483) [1269 bp, 422 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR301W (RAX1)
          Length = 422

 Score =  352 bits (903), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 188/493 (38%), Positives = 284/493 (57%), Gaps = 79/493 (16%)

Query: 9   RIQQERLPTLYEVLIQKTDSPVDLWSFYTFLSQFPHALNYLEFWIDLMSHIRLCKDYIRG 68
           R+Q ERLPTL+EVL  +T +PVD WSFYTFL Q+P ALNY++FW+D+M+H+RLCKDY++G
Sbjct: 7   RLQSERLPTLFEVLNNQTAAPVDSWSFYTFLFQYPGALNYMDFWVDVMAHLRLCKDYVKG 66

Query: 69  IRESVLIPNEELKSRRQSEVYENVERNVIETENDIEQPNKENNGDQDNISVTSSILIDAL 128
           IRES+++   E +  R                       +     +   S++SS+L+DAL
Sbjct: 67  IRESMMLLEVEEQQGRSR--------------------GRPAGSTEKRQSLSSSVLLDAL 106

Query: 129 MDEGYLDFQNPQKVNRFLQGDLEYSPQLSQLLDDWKRHSGYIDHSNDDSYASSGKDNKIV 188
           +++GYLD+ + +++++FL+GD E S +LSQL +     S       ++ + S   D  +V
Sbjct: 107 LNDGYLDYHDNRRISQFLKGDGE-SARLSQLFEGRGGDSSGEKAPTEEPHLSLMLDEFLV 165

Query: 189 SAVDGLLQNYTKMHQERPQVTAKLLLQNAQTICSLYLISPE--KSEKYLINVPEHIRNET 246
             +            +RP++T K L+ +A TI   YL+S +  +SE+ L  VPEH+R E 
Sbjct: 166 RQMK---------ESQRPKLTTKQLVASANTIVDRYLVSKDSMRSERLLTTVPEHMRLEV 216

Query: 247 LQLVEIGGRHDPEVFESMRSLAYQFLEIDCFSKFLNRVALHNIHDQISDWKYHPVKPHSH 306
           + LV+   R+DP+VFE ++ +++QFLEI CF KFL+ VALHN+H  IS            
Sbjct: 217 INLVKGEQRYDPDVFEPLKIISFQFLEIYCFPKFLSSVALHNLHYDIS------------ 264

Query: 307 NDNNTEKKQPKKNLKIFGMNLSNASDDESVNEVEYSRHQSRSPFSNYTTISRICFGTFWM 366
                                              S+  SRSP+S  TT++R+  G F+ 
Sbjct: 265 ----------------------------------LSQKASRSPYSQCTTLARVATGFFFW 290

Query: 367 GIGFWIGYVLIFLNYNRGIRVVTIVPFAIGSYFIVCGIYQVDVVYSWFGVTQELMFRHKS 426
            +GFW+GY LIFL+Y R +R VT+VPF IGSY+IVCG+Y +D++Y+  GVTQ L+   + 
Sbjct: 291 AVGFWVGYSLIFLDYPRRVRTVTLVPFLIGSYYIVCGVYHLDIIYAVCGVTQTLISPRRY 350

Query: 427 SDEENGHPMNLDKNNKGVPGILKVLGGKSRLIRIDHQFIRNLLFKRGLWCCAIITISTAI 486
            + E G     +   K VP     LGG+ RL ++ H F+ N++ KR LWC  ++ ++TA+
Sbjct: 351 EEPELGLDQKQNSATK-VPFFFTFLGGRKRLTKVRHPFVLNIMRKRALWCLFLVIVTTAV 409

Query: 487 FTVIFSCVPGRRV 499
            TVIF+ VP  R+
Sbjct: 410 LTVIFTAVPSVRL 422

>Ecym_1476 Chr1 (980938..982299) [1362 bp, 453 aa] {ON} similar to
           Ashbya gossypii AFR532W
          Length = 453

 Score =  329 bits (843), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 190/506 (37%), Positives = 302/506 (59%), Gaps = 66/506 (13%)

Query: 5   TDFDRIQQERLPTLYEVLIQKTDSPVDLWSFYTFLSQFPHALNYLEFWIDLMSHIRLCKD 64
           T+  R Q ERLPTLYEVL  +T +PVD WSFYTFL Q+P ALNY++FW+D+M+H+RLCKD
Sbjct: 3   TEERRFQSERLPTLYEVLTNQTAAPVDSWSFYTFLFQYPGALNYMDFWVDVMAHLRLCKD 62

Query: 65  YIRGIRESVLIPNEELKSRRQSEVYENVERNVIETENDIEQPNKENNGDQDNISVTSSIL 124
           Y+RGIRES+L+   E++ ++Q + +     + +         +  N    + +SV+SS+L
Sbjct: 63  YVRGIRESMLL--LEVEEQQQQQKHRQKRHSQVSAAGSDAAADNNN---NNRMSVSSSLL 117

Query: 125 IDALMDEGYLDFQNPQKVNRFLQGDLEYSPQLSQLLDDWKRHSGYIDHSNDDSY------ 178
           +DAL+++GYLD+ + +++++FL+G+ + S + SQLL++   H       N+  Y      
Sbjct: 118 LDALLNDGYLDYHDNKRISQFLKGEAD-SDRFSQLLENLP-HGAEGGEGNNKGYDGEEPG 175

Query: 179 ---ASSGKDNKIVSAVDGLLQNYTKMHQERPQVTAKLLLQNAQTICSLYLISPE--KSEK 233
               ++ +D  +   +D  L    K  Q RP++T K L+ +A  I   YL++ +  +SE+
Sbjct: 176 HGDYATAEDAHLSVMLDEYLVRQMKESQ-RPKLTTKQLIASANAIVDRYLVAKDNMRSER 234

Query: 234 YLINVPEHIRNETLQLVEIGGRHDPEVFESMRSLAYQFLEIDCFSKFLNRVALHNIHDQI 293
            L +VPEH+R E + +V+   R+DP+VFE ++ +++QFLEI CF KFL+ VALHN+H  +
Sbjct: 235 LLTSVPEHMRLEVINMVKGEQRYDPDVFEPLKIISFQFLEIYCFPKFLSSVALHNLHYDV 294

Query: 294 SDWKYHPVKPHSHNDNNTEKKQPKKNLKIFGMNLSNASDDESVNEVEYSRHQSRSPFSNY 353
           S                                               ++    SP+S  
Sbjct: 295 S----------------------------------------------LTQKTRTSPYSQC 308

Query: 354 TTISRICFGTFWMGIGFWIGYVLIFLNYNRGIRVVTIVPFAIGSYFIVCGIYQVDVVYSW 413
           TT+SR+  G F+ GIGFW+GY LIFL+YNR +R VT++PF +G Y+IVCGIY +D++Y+ 
Sbjct: 309 TTLSRVATGFFFWGIGFWVGYTLIFLDYNRKVRTVTLLPFFVGCYYIVCGIYHLDIIYAI 368

Query: 414 FGVTQELMFRHKSSDEENGHPMNLDKNNKGVPGILKVLGGKSRLIRIDHQFIRNLLFKRG 473
            GVTQ L+   + ++ E G   +   N+  VP +  +LGG++RL ++ H F+ N++ KR 
Sbjct: 369 CGVTQTLVSPRRFAEPELGLKKS-KTNSAKVPLLFSLLGGRNRLTKVRHPFVLNIMRKRA 427

Query: 474 LWCCAIITISTAIFTVIFSCVPGRRV 499
           LWC  ++ ++TA+ T IF+ VP  R+
Sbjct: 428 LWCLFLVLVTTAVLTTIFTAVPSTRL 453

>TBLA0I02370 Chr9 (543496..544509) [1014 bp, 337 aa] {ON} Anc_6.334
           YNR027W
          Length = 337

 Score = 37.0 bits (84), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 30/67 (44%), Gaps = 2/67 (2%)

Query: 334 ESVNEVEYSRHQSRSPFSNYTTISRICFGTFWMGI--GFWIGYVLIFLNYNRGIRVVTIV 391
           ++VN VEYS H     F+ Y + S         G+  G  I Y  I + Y   I  +T V
Sbjct: 56  DTVNTVEYSNHPGYGSFAGYKSSSDTITTIIEKGLLSGLEIAYDSILIGYMSNIETLTKV 115

Query: 392 PFAIGSY 398
              IGSY
Sbjct: 116 STIIGSY 122

>KLTH0E00352g Chr5 (33232..34779) [1548 bp, 515 aa] {ON} similar to
           uniprot|P43634 Saccharomyces cerevisiae YLR098C CHA4
           Zinc-finger protein with Zn[2]-Cys[6] fungal- type
           binuclear cluster domain DNA-binding transcriptional
           activator or CHA1 and to YOR337W uniprot|P47988
           Saccharomyces cerevisiae YOR337W TEA1 Mutants are
           defective in Ty1 Enhancer-mediated Activation Ty1
           enhancer activator
          Length = 515

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 321 KIFGMNLSNASDDESVNEVEYSRHQSRSPFSNYTTISRICFGTF---WMGIGFWIGYVLI 377
           KIFG   S    DES+N++  S H+ R    +    S+ C  TF         WI + ++
Sbjct: 327 KIFGPCSSLTQRDESLNKLNMSFHEWRCNLPSSLKWSKTCLKTFDFDPTKAFVWIHFYVV 386

Query: 378 FLNYNR 383
            L+YN+
Sbjct: 387 SLSYNK 392

>TBLA0B01940 Chr2 (445353..448736) [3384 bp, 1127 aa] {ON} Anc_1.519
           YKL205W
          Length = 1127

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 50/110 (45%), Gaps = 11/110 (10%)

Query: 30  VDLWSFYTFLSQFPHALNYLEFWIDLMSHIRLCKDYIRGIRESVLIPNEELKSRRQSEVY 89
           V++  F +FL QF H  N  E   +L +++ +       I E + +  + L +  + E  
Sbjct: 827 VEMIDFLSFLGQFVHMFNKEEECFNLFNNLLI------SIIEKIHLIMDTLINEEKIEAT 880

Query: 90  ENVERNVIETENDIEQPNKENNG---DQDNISVTSSILIDALMDEGYLDF 136
            N+ +N     NDI + N  NN     ++++ +T S     L+ + Y  F
Sbjct: 881 GNISKN--NENNDINRSNSNNNTGTPTKNSVVITDSFRDQVLLKKAYFTF 928

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,129,981
Number of extensions: 2774407
Number of successful extensions: 12874
Number of sequences better than 10.0: 99
Number of HSP's gapped: 13272
Number of HSP's successfully gapped: 107
Length of query: 499
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 385
Effective length of database: 40,409,475
Effective search space: 15557647875
Effective search space used: 15557647875
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)