Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1004.225.528ON47547516330.0
Kpol_1023.975.528ON591612594e-23
TPHA0D023405.528ON506602575e-23
SAKL0G04950g5.528ON5671822496e-22
KLLA0A01760g5.528ON5831672489e-22
Skud_13.1475.528ON6651102472e-21
TDEL0A039205.528ON466602414e-21
NDAI0C010605.528ON637612417e-21
KAFR0C054005.528ON481612381e-20
NCAS0H025605.528ON587612391e-20
TBLA0G009305.528ON608552354e-20
ZYRO0D12584g5.528ON5791832345e-20
Smik_13.1445.528ON639602355e-20
YML007W (YAP1)5.528ON650602346e-20
Suva_13.1555.528ON645602346e-20
KLTH0G03784g5.528ON569592311e-19
CAGL0H04631g5.528ON588612311e-19
KNAG0B036805.528ON482612292e-19
Kwal_47.186315.528ON584592231e-18
TPHA0K005205.528ON560592203e-18
TBLA0D016405.528ON599541972e-15
NCAS0F011005.528ON475551509e-10
NDAI0H016105.528ON519641402e-08
YDR423C (CAD1)5.528ON409531161e-05
Suva_2.600singletonOFF382531124e-05
Smik_4.6985.528ON3931311115e-05
CAGL0F03069g5.528ON486661072e-04
KNAG0C032105.528ON38455920.009
KAFR0E032905.528ON26567810.16
Ecym_40645.528ON42633780.55
CAGL0L08756g8.78ON121958723.1
YPR199C (ARR1)na 1ON29455704.5
KLTH0D01386g7.41ON48283688.9
NOTE: 2 genes in the same pillar as Kpol_1004.22 were not hit in these BLAST results
LIST: ADR195C Skud_4.697

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1004.22
         (475 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {O...   633   0.0  
Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON} (2250...   104   4e-23
TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {O...   103   5e-23
SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {...   100   6e-22
KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON} unipro...   100   9e-22
Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007...   100   2e-21
TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {O...    97   4e-21
NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.5...    97   7e-21
KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa] ...    96   1e-20
NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {O...    97   1e-20
TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.5...    95   4e-20
ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]...    95   5e-20
Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007...    95   5e-20
YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic...    95   6e-20
Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007...    95   6e-20
KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {...    94   1e-19
CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {...    94   1e-19
KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.5...    93   2e-19
Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007...    91   1e-18
TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5....    89   3e-18
TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.5...    80   2e-15
NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {O...    62   9e-10
NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {O...    59   2e-08
YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}...    49   1e-05
Suva_2.600 Chr2 complement(1070824..1071000,1071004..1071024,107...    48   4e-05
Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1...    47   5e-05
CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {...    46   2e-04
KNAG0C03210 Chr3 (631277..632431) [1155 bp, 384 aa] {ON} Anc_5.5...    40   0.009
KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.52...    36   0.16 
Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar t...    35   0.55 
CAGL0L08756g Chr12 (954860..958519) [3660 bp, 1219 aa] {ON} high...    32   3.1  
YPR199C Chr16 complement(938148..939032) [885 bp, 294 aa] {ON}  ...    32   4.5  
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    31   8.9  

>Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {ON}
           complement(45952..47379) [1428 nt, 476 aa]
          Length = 475

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/475 (71%), Positives = 339/475 (71%)

Query: 1   MDANNDIDFMDFLTESSSIDSRKNYLNLSTSNKIRKNDIDAEXXXXXXXXXXXXXXXXXX 60
           MDANNDIDFMDFLTESSSIDSRKNYLNLSTSNKIRKNDIDAE                  
Sbjct: 1   MDANNDIDFMDFLTESSSIDSRKNYLNLSTSNKIRKNDIDAEARIRRTAQNRAAQRAFRE 60

Query: 61  XXXXXXXXXXXXVNSLENIHQKNEVETEFLRSQVLTLVNELKKYRSETTSDSKILKLVSN 120
                       VNSLENIHQKNEVETEFLRSQVLTLVNELKKYRSETTSDSKILKLVSN
Sbjct: 61  RKEKKMKELENKVNSLENIHQKNEVETEFLRSQVLTLVNELKKYRSETTSDSKILKLVSN 120

Query: 121 SRENTRDLRHDSITSLDSDQSPLNDISKFNLNLGHXXXXXXXXXXXXXXXXXTASNNLPN 180
           SRENTRDLRHDSITSLDSDQSPLNDISKFNLNLGH                 TASNNLPN
Sbjct: 121 SRENTRDLRHDSITSLDSDQSPLNDISKFNLNLGHINLSNSPNSSSIMSLSPTASNNLPN 180

Query: 181 ASDSGLXXXXXXXXXXXXEQVSTFCAKMNNNFENRKKIIKKTYDEKIKLKSEFSDXXXXX 240
           ASDSGL            EQVSTFCAKMNNNFENRKKIIKKTYDEKIKLKSEFSD     
Sbjct: 181 ASDSGLFSNDFNFNNQFDEQVSTFCAKMNNNFENRKKIIKKTYDEKIKLKSEFSDVNSVL 240

Query: 241 XXXXXXXXXXXXXXXXTYFXXXXXXXXXXXXXXXXXXXXXXXQSMKSEFPPLIFFSDNNY 300
                           TYF                       QSMKSEFPPLIFFSDNNY
Sbjct: 241 ASPSLSSSRFSDDNSSTYFNTRHHHNNDHNNTTTTKNHNYNNQSMKSEFPPLIFFSDNNY 300

Query: 301 MDSPDNSFPLIDASLAFPXXXXXXXXXXXXXXXXVLFRDISTAEMQFMDESPLQNVEFNS 360
           MDSPDNSFPLIDASLAFP                VLFRDISTAEMQFMDESPLQNVEFNS
Sbjct: 301 MDSPDNSFPLIDASLAFPNNSNSNRNNNNNNNNNVLFRDISTAEMQFMDESPLQNVEFNS 360

Query: 361 EDAIKRLISEEPSPHYSNSVPHLHNNNVNSASLHPLTXXXXXXXXXXXXXXXXXSTDSQL 420
           EDAIKRLISEEPSPHYSNSVPHLHNNNVNSASLHPLT                 STDSQL
Sbjct: 361 EDAIKRLISEEPSPHYSNSVPHLHNNNVNSASLHPLTVLVQEPDDELDEDVVVPSTDSQL 420

Query: 421 MRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVLAKHMA 475
           MRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVLAKHMA
Sbjct: 421 MRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVLAKHMA 475

>Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON}
           (225050..226825) [1776 nt, 592 aa]
          Length = 591

 Score =  104 bits (259), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 54/61 (88%)

Query: 415 STDSQLMRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVLAKHM 474
           ++D +L++CSE+WDRIT +PRY+D+DIDGLC+ELM +AKCSDKGVVV SKDV K L+ HM
Sbjct: 531 TSDGKLLKCSEVWDRITAHPRYSDIDIDGLCQELMHNAKCSDKGVVVDSKDVQKALSNHM 590

Query: 475 A 475
           +
Sbjct: 591 S 591

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 40/52 (76%)

Query: 73  VNSLENIHQKNEVETEFLRSQVLTLVNELKKYRSETTSDSKILKLVSNSREN 124
           V+ LE + Q+N+VE+EFLR+Q+  +++ELKKYR E +SD K+L+ ++   EN
Sbjct: 86  VHELEKVKQQNDVESEFLRNQLTLMIDELKKYRPEKSSDIKVLEYLAKHEEN 137

>TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {ON}
           Anc_5.528 YDR423C
          Length = 506

 Score =  103 bits (257), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 51/60 (85%)

Query: 416 TDSQLMRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVLAKHMA 475
           TD +L+ C EIWDRITT PRY+D+DIDGLCEELM SAKCSDKGV+V+S DV KVL++ + 
Sbjct: 447 TDGRLLECGEIWDRITTYPRYSDIDIDGLCEELMASAKCSDKGVLVSSDDVQKVLSRRLV 506

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 37/47 (78%)

Query: 73  VNSLENIHQKNEVETEFLRSQVLTLVNELKKYRSETTSDSKILKLVS 119
           V  LENI++KNE+ET FLR+Q+L+LVNELKKYR +   D ++ K+ S
Sbjct: 48  VRKLENINEKNEIETVFLRTQLLSLVNELKKYRIDKNDDFRLKKIGS 94

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 26/30 (86%)

Query: 199 EQVSTFCAKMNNNFENRKKIIKKTYDEKIK 228
           EQVSTFCAKMN  FENRK++IK+ Y EK++
Sbjct: 276 EQVSTFCAKMNKTFENRKEMIKQFYTEKVR 305

>SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 567

 Score =  100 bits (249), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 94/182 (51%), Gaps = 25/182 (13%)

Query: 302 DSPDNS---FPLIDASLAFPXXXXXXXXXXXXXXXXVLFRDI-----STAEMQFMDESPL 353
           ++P NS    P ID S+AFP                ++FRD      ST   +F++E P+
Sbjct: 403 NTPSNSADILPFIDTSIAFPTEQNE-----------LVFRDTAANNSSTVFDEFLEEDPV 451

Query: 354 QNVEFNSEDAIKRLISEEPSPHYSNSVPHLHNNNVNSASLHPLTXXXXXXXXXXXXXXXX 413
            + +  +E+++  + S +         P     N  + +  PL+                
Sbjct: 452 VH-QLTTEESVYDVFSNDYGAKKGK--PFSPEENKGNYTTLPLSQESSNPLVSDDVVP-- 506

Query: 414 XSTDSQLMRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVLAKH 473
            S D +L++C EIWDRIT++P+Y+DLDIDGLC EL   AKCS+KGVVV + DV K LAKH
Sbjct: 507 -SRDGKLLKCGEIWDRITSHPKYSDLDIDGLCMELRTKAKCSEKGVVVNADDVQKALAKH 565

Query: 474 MA 475
           M+
Sbjct: 566 MS 567

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 43/59 (72%)

Query: 73  VNSLENIHQKNEVETEFLRSQVLTLVNELKKYRSETTSDSKILKLVSNSRENTRDLRHD 131
           V  LE + ++NEVETEFLRSQ++TL++ELKKYR E + D+++L+ ++   E  +D   D
Sbjct: 88  VTHLETVREQNEVETEFLRSQLMTLISELKKYRPEQSMDTQVLEYLAKREEEKKDNSQD 146

>KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON}
           uniprot|P56095 Kluyveromyces lactis KLLA0A01760g YAP1
           AP- 1-like transcription factor
          Length = 583

 Score =  100 bits (248), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 63/167 (37%), Positives = 83/167 (49%), Gaps = 28/167 (16%)

Query: 308 FPLIDASLAFPXXXXXXXXXXXXXXXXVLFRDISTAEMQFMDESPLQNVEFNSEDAIKRL 367
            P ID  LAFP                    DI        +E   + VE +S D I+ L
Sbjct: 444 IPFIDTGLAFPDYDDP-------------LLDI------LKEEQENEQVEGDS-DPIQAL 483

Query: 368 ISEEPSPHYSNSVPHLHNNNVNSASLHPLTXXXXXXXXXXXXXXXXXSTDSQLMRCSEIW 427
           I+EEPS      +P  H+   N+ +   ++                 S D +L++CSE+W
Sbjct: 484 INEEPS------MPLCHDPAANAGA--SVSETDKLSNQEEIVQDIIPSNDGKLLKCSEVW 535

Query: 428 DRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVLAKHM 474
           DRIT +PRY+DLDIDGLC EL   AKCS+KGVVV ++DV K L  HM
Sbjct: 536 DRITAHPRYSDLDIDGLCLELRTKAKCSEKGVVVNAEDVQKALISHM 582

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 40/57 (70%), Gaps = 2/57 (3%)

Query: 73  VNSLENIHQKNEVETEFLRSQVLTLVNELKKYRSE--TTSDSKILKLVSNSRENTRD 127
           V+ LE++++++E+ET+FLR+QV  L++ELK+Y  E     DS +L  ++  R+ + D
Sbjct: 83  VSQLESLNKQSELETKFLRNQVTNLLSELKRYNPELPKKRDSILLDYLAKQRKASID 139

>Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007W
           (REAL)
          Length = 665

 Score = 99.8 bits (247), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 49/110 (44%), Positives = 66/110 (60%), Gaps = 1/110 (0%)

Query: 366 RLISEEPSPHYSNSVPHLHNNNVNSASLH-PLTXXXXXXXXXXXXXXXXXSTDSQLMRCS 424
           +LI+EEP P   NS+  L+N    S   +   T                 S +  L+RCS
Sbjct: 555 QLINEEPQPLNQNSLSSLNNEKETSPKTNSGGTQNANDSDGNDNDNDVVPSKEGSLLRCS 614

Query: 425 EIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVLAKHM 474
           EIWDRITT+P+Y+D+D+DGLC ELM  AKCS++GVV+ ++DV   L KHM
Sbjct: 615 EIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKHM 664

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/47 (63%), Positives = 38/47 (80%)

Query: 73  VNSLENIHQKNEVETEFLRSQVLTLVNELKKYRSETTSDSKILKLVS 119
           V  LENI Q+NEVE  FLR Q++TLVNELKKYR ET +DSK+L+ ++
Sbjct: 96  VQGLENIQQQNEVEATFLRDQLVTLVNELKKYRPETRNDSKVLEYLA 142

>TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {ON}
           Anc_5.528 YDR423C
          Length = 466

 Score = 97.4 bits (241), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 51/60 (85%)

Query: 415 STDSQLMRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVLAKHM 474
           S D +L++CSE+WDRITT+P+Y+ +DIDGLC ELM  AKCS+KGVVV ++DV +VL KHM
Sbjct: 405 SRDGKLLKCSEVWDRITTHPKYSAIDIDGLCGELMTKAKCSEKGVVVQAEDVQRVLDKHM 464

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 32/43 (74%)

Query: 73  VNSLENIHQKNEVETEFLRSQVLTLVNELKKYRSETTSDSKIL 115
           V SLE  ++   VE+EFLRSQ+LTLVNELKKYR    +D ++L
Sbjct: 88  VQSLEQANRDTVVESEFLRSQLLTLVNELKKYRPAKANDLQVL 130

>NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.528
           YDR423C
          Length = 637

 Score = 97.4 bits (241), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 39/61 (63%), Positives = 49/61 (80%)

Query: 415 STDSQLMRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVLAKHM 474
           S D  L+RCSEIWDRIT +P+Y++LDIDGLC ELM  AKCS++GVVV ++DV   L KHM
Sbjct: 577 SRDGGLLRCSEIWDRITAHPKYSELDIDGLCSELMTKAKCSERGVVVNAEDVQMALTKHM 636

Query: 475 A 475
           +
Sbjct: 637 S 637

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 35/46 (76%)

Query: 73  VNSLENIHQKNEVETEFLRSQVLTLVNELKKYRSETTSDSKILKLV 118
           V +L  I ++NE+E+EFLRSQ++TLVNELKKY+    + SK+L  +
Sbjct: 106 VANLTKIQKQNEIESEFLRSQLITLVNELKKYKPNNENASKVLNYI 151

>KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa]
           {ON} Anc_5.528 YDR423C
          Length = 481

 Score = 96.3 bits (238), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 50/61 (81%)

Query: 415 STDSQLMRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVLAKHM 474
           S D  L+RCSE+WDRIT +P+Y+D+DIDGLC ELM  AKCS+KGVVV ++DV   L+KH+
Sbjct: 421 SKDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSALSKHL 480

Query: 475 A 475
           +
Sbjct: 481 S 481

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 39/47 (82%)

Query: 73  VNSLENIHQKNEVETEFLRSQVLTLVNELKKYRSETTSDSKILKLVS 119
           V+ L NI ++NE+E+EFLRSQ++TLV ELKKYR ET +DS++L  ++
Sbjct: 76  VDHLSNIQKQNEIESEFLRSQLITLVKELKKYRPETANDSQVLNYLA 122

>NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {ON}
           Anc_5.528 YDR423C
          Length = 587

 Score = 96.7 bits (239), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 39/61 (63%), Positives = 49/61 (80%)

Query: 415 STDSQLMRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVLAKHM 474
           S D  L+RCSEIWDRI+ +P+Y+DLDIDGLC ELM  AKCS++GVVV ++DV   L KHM
Sbjct: 527 SRDGGLLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERGVVVNAEDVQLALTKHM 586

Query: 475 A 475
           +
Sbjct: 587 S 587

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 41/56 (73%)

Query: 73  VNSLENIHQKNEVETEFLRSQVLTLVNELKKYRSETTSDSKILKLVSNSRENTRDL 128
           VN+L  I ++NE+E+EFLR Q++TLVNELKKYR    ++SK+L+ +S    N +D 
Sbjct: 97  VNNLTKIQKQNEIESEFLRGQLITLVNELKKYRDPNPNESKVLEYLSQHNGNNKDF 152

>TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.528
           YDR423C
          Length = 608

 Score = 95.1 bits (235), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 47/55 (85%)

Query: 421 MRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVLAKHMA 475
           M+CSE+WDRIT++P+Y+DLDIDGLC ELM  AKCS+KGVVV + DV K L KH++
Sbjct: 554 MQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQKALTKHLS 608

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 36/47 (76%)

Query: 73  VNSLENIHQKNEVETEFLRSQVLTLVNELKKYRSETTSDSKILKLVS 119
           V SLE +H+K+E+E++FLR Q+  L+ EL++YR E  +D+K+ + +S
Sbjct: 79  VKSLEEVHKKSEIESQFLRDQLKVLLGELQRYRPERQNDAKVKEYLS 125

>ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]
           {ON} weakly similar to uniprot|P19880 YML007W
           Saccharomyces cerevisiae YAP1 bZip transcription factor
           required for oxidative stress tolerance
          Length = 579

 Score = 94.7 bits (234), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 90/183 (49%), Gaps = 33/183 (18%)

Query: 301 MDSPD--NSFPLIDASLAFPXXXXXXXXXXXXXXXXVLFRDISTAEM--QFMDESPLQNV 356
           M+SP+  +  P ID SLAFP                 LFR+     M  +F++  P ++ 
Sbjct: 412 MNSPEKNSELPFIDTSLAFPEEQD-------------LFREQQPDNMFAEFIEHDPQRDT 458

Query: 357 EFNSED---------AIKRLISEEPSPHYSNSVPHLHNNNVNSASLHPLTXXXXXXXXXX 407
              +E              ++ EEP+   +  V    N+NV    +              
Sbjct: 459 TNGNEGNTSPDQDEFLASGMVQEEPA-VTTGEVKDNTNDNVKDGKIQ------DEGKEAP 511

Query: 408 XXXXXXXSTDSQLMRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVH 467
                  S+D +L++CSE+WDRIT++P+Y+D+DIDGLC+ELM  AKCS++GVVV ++DV 
Sbjct: 512 NSDVVVPSSDGKLLKCSEVWDRITSHPKYSDMDIDGLCQELMAKAKCSERGVVVQAEDVQ 571

Query: 468 KVL 470
             L
Sbjct: 572 YAL 574

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 45/54 (83%), Gaps = 1/54 (1%)

Query: 73  VNSLENIHQKNEVETEFLRSQVLTLVNELKKYRSETTSDSKILKLVSNSRENTR 126
           V++LE ++Q++ VETEFLRSQ++TLV ELK+YR E  +DS++L+ ++ + EN++
Sbjct: 78  VHALEELNQQSLVETEFLRSQLVTLVTELKRYRPENPNDSQVLQYLAKT-ENSK 130

>Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007W
           (REAL)
          Length = 639

 Score = 95.1 bits (235), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 37/60 (61%), Positives = 49/60 (81%)

Query: 415 STDSQLMRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVLAKHM 474
           S +  L+RCSEIWDRITT+P+Y+D+D+DGLC ELM  AKCS++GVV+ ++DV   L KHM
Sbjct: 579 SKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKHM 638

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/47 (63%), Positives = 39/47 (82%)

Query: 73  VNSLENIHQKNEVETEFLRSQVLTLVNELKKYRSETTSDSKILKLVS 119
           V SLE+I Q+NEVE  FLR Q++TLVNELKKYR ET +DSK+L+ ++
Sbjct: 96  VQSLESIQQQNEVEATFLRDQLVTLVNELKKYRPETRNDSKVLEYLA 142

>YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic
           leucine zipper (bZIP) transcription factor required for
           oxidative stress tolerance; activated by H2O2 through
           the multistep formation of disulfide bonds and transit
           from the cytoplasm to the nucleus; mediates resistance
           to cadmium
          Length = 650

 Score = 94.7 bits (234), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 37/60 (61%), Positives = 49/60 (81%)

Query: 415 STDSQLMRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVLAKHM 474
           S +  L+RCSEIWDRITT+P+Y+D+D+DGLC ELM  AKCS++GVV+ ++DV   L KHM
Sbjct: 590 SKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKHM 649

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/47 (63%), Positives = 39/47 (82%)

Query: 73  VNSLENIHQKNEVETEFLRSQVLTLVNELKKYRSETTSDSKILKLVS 119
           V SLE+I Q+NEVE  FLR Q++TLVNELKKYR ET +DSK+L+ ++
Sbjct: 96  VQSLESIQQQNEVEATFLRDQLITLVNELKKYRPETRNDSKVLEYLA 142

>Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007W
           (REAL)
          Length = 645

 Score = 94.7 bits (234), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 37/60 (61%), Positives = 49/60 (81%)

Query: 415 STDSQLMRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVLAKHM 474
           S +  L+RCSEIWDRITT+P+Y+D+D+DGLC ELM  AKCS++GVV+ ++DV   L KHM
Sbjct: 585 SKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKHM 644

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/47 (61%), Positives = 40/47 (85%)

Query: 73  VNSLENIHQKNEVETEFLRSQVLTLVNELKKYRSETTSDSKILKLVS 119
           V+SLE+I Q+NEVE  FLR Q++TLV+ELKKYR ET +DSK+L+ ++
Sbjct: 96  VHSLESIQQENEVEATFLRDQLVTLVSELKKYRPETRNDSKVLEYLA 142

>KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 569

 Score = 93.6 bits (231), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (79%)

Query: 417 DSQLMRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVLAKHMA 475
           D  L++CSEIWDRIT +P+Y+D+DIDGLC EL   AKCS+KGVVV S DV   LAKHM+
Sbjct: 511 DGLLLKCSEIWDRITAHPKYSDIDIDGLCMELRTKAKCSEKGVVVNSDDVQSALAKHMS 569

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 40/54 (74%)

Query: 73  VNSLENIHQKNEVETEFLRSQVLTLVNELKKYRSETTSDSKILKLVSNSRENTR 126
           V  LE + +++E+E+EFLRSQ+  L+ E++KYR + +SDS++LK ++ + E  +
Sbjct: 64  VERLEKVREQSEMESEFLRSQLQMLIAEIQKYRPQQSSDSQVLKYLAEAEERCK 117

>CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {ON}
           similar to uniprot|P19880 Saccharomyces cerevisiae
           YML007w YAP1
          Length = 588

 Score = 93.6 bits (231), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 48/61 (78%)

Query: 415 STDSQLMRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVLAKHM 474
           S D  L+RCSEIWDRIT +P+Y+D+DIDGLC ELM  AKCS++GVV+ + DV   L KHM
Sbjct: 528 SRDDGLLRCSEIWDRITAHPKYSDIDIDGLCSELMAKAKCSERGVVINADDVQVALNKHM 587

Query: 475 A 475
           +
Sbjct: 588 S 588

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 31/43 (72%)

Query: 76  LENIHQKNEVETEFLRSQVLTLVNELKKYRSETTSDSKILKLV 118
           LEN+ + NEVET FLR Q+  LV EL+KYR ET  D K+LK +
Sbjct: 60  LENLTKLNEVETNFLRDQLSILVKELRKYRPETKQDHKVLKYL 102

>KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.528
           YDR423C
          Length = 482

 Score = 92.8 bits (229), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 49/61 (80%)

Query: 415 STDSQLMRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVLAKHM 474
           S D +L++CSEIWDRIT +P+Y+DLDIDGLC ELM  AKCS++GVVV + DV   L +H+
Sbjct: 422 SKDGKLLKCSEIWDRITAHPKYSDLDIDGLCGELMTKAKCSERGVVVNADDVKDALNRHI 481

Query: 475 A 475
           A
Sbjct: 482 A 482

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 48/70 (68%), Gaps = 9/70 (12%)

Query: 73  VNSLENIHQKNEVETEFLRSQVLTLVNELKKYRSETTSDSKILKLVSNSRENTRDLRHDS 132
           V+ L  I ++NEVE+EFLR Q++TLV+ELKKYR ET++DSK+L+ ++         +HD+
Sbjct: 79  VDKLTRIQKQNEVESEFLRGQLVTLVHELKKYRPETSNDSKVLEYLA---------KHDN 129

Query: 133 ITSLDSDQSP 142
           +      Q+P
Sbjct: 130 VPPNQQGQAP 139

>Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007W
           (YAP1) - jun-like transcription factor [contig 192] FULL
          Length = 584

 Score = 90.5 bits (223), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 47/59 (79%)

Query: 417 DSQLMRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVLAKHMA 475
           D  L++CSE+WDRIT++P+Y+D+DIDGLC EL   AKCS+KGVVV   DV + L KHM+
Sbjct: 526 DGTLLKCSEVWDRITSHPKYSDIDIDGLCLELRTKAKCSEKGVVVNIDDVQRALTKHMS 584

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 38/54 (70%)

Query: 73  VNSLENIHQKNEVETEFLRSQVLTLVNELKKYRSETTSDSKILKLVSNSRENTR 126
           V  LE + +++E+E+EFLRSQ+  L+ E++KYR   +SDS++L  ++ + E  +
Sbjct: 64  VERLERVREQSELESEFLRSQLQKLLAEIQKYRPRQSSDSQVLNFLAKAEERRK 117

>TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5.528
           YDR423C
          Length = 560

 Score = 89.4 bits (220), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 33/59 (55%), Positives = 48/59 (81%)

Query: 417 DSQLMRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVLAKHMA 475
           D   ++CS++W R+T +P+Y++LDIDGLC ELM  AKCS+KGVVV S+DV K L+K+++
Sbjct: 501 DGSYLKCSQVWSRLTEHPKYSELDIDGLCTELMLQAKCSEKGVVVESRDVQKALSKYLS 559

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 35/47 (74%)

Query: 73  VNSLENIHQKNEVETEFLRSQVLTLVNELKKYRSETTSDSKILKLVS 119
           V +LE +++  E+ET FLRS++ ++ +ELKKYR   +SD ++L+ ++
Sbjct: 70  VLALEQVNEAKELETNFLRSRLKSMADELKKYRPAQSSDLEVLEYLA 116

>TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.528
           YDR423C
          Length = 599

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 34/54 (62%), Positives = 42/54 (77%)

Query: 417 DSQLMRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVL 470
           D +++ C++IWDRIT  P+YT  DI+ LC ELM  AKCSDKGVVV+S DV KVL
Sbjct: 533 DPEMLPCTKIWDRITALPKYTSADIENLCNELMSKAKCSDKGVVVSSLDVDKVL 586

>NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {ON}
           Anc_5.528 YDR423C
          Length = 475

 Score = 62.4 bits (150), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 38/55 (69%), Gaps = 2/55 (3%)

Query: 422 RCSEIWDRITTN-PRYTDLDIDGLCEELMFSAKCSDKG-VVVASKDVHKVLAKHM 474
           +CS IW R  T  P+++D DID LC+EL+  AKCSD+G +V+ S+DV   L KH 
Sbjct: 421 KCSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVKNTLRKHF 475

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 42/64 (65%)

Query: 73  VNSLENIHQKNEVETEFLRSQVLTLVNELKKYRSETTSDSKILKLVSNSRENTRDLRHDS 132
           ++ LE I   NEVE+ FLR  ++ L+ +++KYR   ++DSK+LK +S  ++N   ++  S
Sbjct: 63  ISDLERIKDNNEVESTFLRDYMMDLICDMQKYRPNNSTDSKVLKYLSLKKKNQPSMKATS 122

Query: 133 ITSL 136
           I SL
Sbjct: 123 IDSL 126

>NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {ON}
           Anc_5.528 YDR423C
          Length = 519

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 38/64 (59%), Gaps = 9/64 (14%)

Query: 419 QLMRCSEIWDRIT--------TNPRYTDLDIDGLCEELMFSAKCSDKG-VVVASKDVHKV 469
           +  +CS+IW+RI         + PR+ D DID LC ELM  A+CS  G +V+ + D+ + 
Sbjct: 455 RFAKCSKIWERINNKMNIETNSGPRFKDSDIDDLCNELMTKARCSTNGSIVIKTGDIKQS 514

Query: 470 LAKH 473
           L KH
Sbjct: 515 LMKH 518

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 35/47 (74%)

Query: 73  VNSLENIHQKNEVETEFLRSQVLTLVNELKKYRSETTSDSKILKLVS 119
           ++SLE I  +N +ET FLRS +  L+NE+ K+R + T+DSKILK +S
Sbjct: 8   ISSLEKIKDENSIETSFLRSYMTDLINEVNKFRPKNTTDSKILKYLS 54

>YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}
           CAD1AP-1-like basic leucine zipper (bZIP)
           transcriptional activator involved in stress responses,
           iron metabolism, and pleiotropic drug resistance;
           controls a set of genes involved in stabilizing
           proteins; binds consensus sequence TTACTAA
          Length = 409

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 423 CSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKG-VVVASKDVHKVLAKHM 474
           C  I + I++ P+Y+ LDID LC EL+  AKC+D   +VV ++D+   L + +
Sbjct: 356 CYHILEEISSLPKYSSLDIDDLCSELIIKAKCTDDCKIVVKARDLQSALVRQL 408

>Suva_2.600 Chr2
           complement(1070824..1071000,1071004..1071024,
           1071028..1071144,1071132..1071362,1071366..1071527,
           1071531..1071734,1071738..1071752,1071756..1071953,
           1071957..1071977) [1146 bp, 382 aa] {OFF} YDR423C
           (PSEUDO)
          Length = 382

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 423 CSEIWDRITTNPRYTDLDIDGLCEELMFSAKCS-DKGVVVASKDVHKVLAKHM 474
           CS I   I++ P+++ LDID LC ELM  AKCS D  ++V +  +  VLA+ +
Sbjct: 329 CSHILRHISSIPKHSSLDIDNLCCELMVKAKCSGDCQIMVQAHGLQSVLARQL 381

>Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1182
           bp, 393 aa] {ON} YDR423C (REAL)
          Length = 393

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 60/131 (45%), Gaps = 18/131 (13%)

Query: 346 QFMDESPLQNVEFNSEDAIKRLISEEP-SPHYSNSVPHLHNNNVNSASLHPLTXXXXXXX 404
           +  +++PL N E   E   KRL+++E        S P+  N  + S ++  ++       
Sbjct: 278 KCAEDTPLLNKEIKCELITKRLLNQESLDSIVPASAPYRENIGIRSEAIRRISS------ 331

Query: 405 XXXXXXXXXXSTDSQLMRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKG-VVVAS 463
                     +  +Q   C  I   I++ P+Y+ LDID LC ELM  A+ +D   +VV +
Sbjct: 332 ----------AISNQNTSCCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRA 381

Query: 464 KDVHKVLAKHM 474
            D+   L K +
Sbjct: 382 HDLQTTLVKQL 392

>CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {ON}
           some similarities with uniprot|P24813 Saccharomyces
           cerevisiae YDR423c CAD1 transcriptional activator
          Length = 486

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 10/66 (15%)

Query: 420 LMRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKG----------VVVASKDVHKV 469
           ++RC +I   +  +  Y  LD + LC ELM  AK SD G          VV+ + D+ + 
Sbjct: 420 VLRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKAGDLQRT 479

Query: 470 LAKHMA 475
           LAKH++
Sbjct: 480 LAKHIS 485

>KNAG0C03210 Chr3 (631277..632431) [1155 bp, 384 aa] {ON} Anc_5.528
           YDR423C gene spans a gap in the genome sequence
          Length = 384

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 423 CSEIWDRITTNPRYTDLDIDGLCEELMFSAK--CSDKGVVVASKDVHKVLAKHMA 475
           C+ +   +T +P Y + D++ LC+ELM   K    D  + V  +DV   L +H+A
Sbjct: 329 CAHVIRTLTQSPHYQENDLEDLCQELMVKCKFDTHDASITVGREDVRSALERHIA 383

>KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.528
           YDR423C
          Length = 265

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 5/67 (7%)

Query: 75  SLENIHQKNEVETEFLRSQVLTLVNELKKYRSETTSDSKILKLVSNSRENTRD---LRHD 131
            LEN+  K E+  EFL+  V+TL+ E+K YR +T  D K+L  +     +  D   L+H 
Sbjct: 55  QLENLS-KAEI-IEFLKQNVMTLLGEIKNYRKQTNKDKKLLDTIGKLENDGMDATTLQHS 112

Query: 132 SITSLDS 138
            +++  S
Sbjct: 113 PVSNYGS 119

>Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar to
           Ashbya gossypii ADR195C
          Length = 426

 Score = 34.7 bits (78), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 23/33 (69%)

Query: 73  VNSLENIHQKNEVETEFLRSQVLTLVNELKKYR 105
           V  LE    ++E E + LR+QV++L+ ELKKYR
Sbjct: 84  VRKLEEQRLQSEREVQSLRNQVVSLLRELKKYR 116

>CAGL0L08756g Chr12 (954860..958519) [3660 bp, 1219 aa] {ON} highly
           similar to uniprot|Q12754 Saccharomyces cerevisiae
           YPL012w
          Length = 1219

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 33/58 (56%)

Query: 418 SQLMRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVLAKHMA 475
           S+++R   + + + +  ++    I+ LC+ L+   K SD+ +V AS +  +VL K MA
Sbjct: 236 SRIIRALRLINAVVSTGQWPATKIEPLCDSLLEVTKSSDQYLVSASFECFEVLFKSMA 293

>YPR199C Chr16 complement(938148..939032) [885 bp, 294 aa] {ON}
           ARR1Transcriptional activator of the basic leucine
           zipper (bZIP) family, required for transcription of
           genes involved in resistance to arsenic compounds
          Length = 294

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 29/55 (52%)

Query: 420 LMRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVLAKHM 474
           L+   +IW  +  +P+    D++ L  EL  SA CS+  ++++ K   KV +  +
Sbjct: 240 LLSAMDIWSFMKVHPKVNTFDLEILGTELKKSATCSNFDILISLKHFIKVFSSKL 294

>KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 aa]
           {ON} similar to uniprot|P24719 Saccharomyces cerevisiae
           YOR351C MEK1 Meiosis-specific serine/threonine protein
           kinase functions in meiotic checkpoint phosphorylates
           Red1p interacts with Hop1p required for meiotic
           recombination and normal spore viability
          Length = 482

 Score = 30.8 bits (68), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 18/83 (21%)

Query: 88  EFLRSQVLTLVNELKKYRSETTSD---------SKILKLVSNSRENTRDLRHDSITSL-- 136
           E LR QVL ++  L  YR++  ++         +K++K+  NSRE      H SI+S+  
Sbjct: 7   ESLRGQVLGVLEPLPVYRNQDVNENFAAVPIFKNKLVKIGRNSRECDIIFPHPSISSIHC 66

Query: 137 -------DSDQSPLNDISKFNLN 152
                  D D  P++ +   +LN
Sbjct: 67  MFWAIRFDDDSVPMHYVKDCSLN 89

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.127    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,454,372
Number of extensions: 1334084
Number of successful extensions: 5033
Number of sequences better than 10.0: 45
Number of HSP's gapped: 5143
Number of HSP's successfully gapped: 71
Length of query: 475
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 362
Effective length of database: 40,524,141
Effective search space: 14669739042
Effective search space used: 14669739042
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)