Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1004.215.527ON75575532830.0
ZYRO0D12562g5.527ON8183965574e-60
TDEL0A039105.527ON7493825334e-57
SAKL0G04928g5.527ON8923865341e-56
Smik_4.6975.527ON8173825302e-56
Skud_4.6965.527ON8113805222e-55
YDR422C (SIP1)5.527ON8153735223e-55
NCAS0F010905.527ON7873835203e-55
NDAI0H016005.527ON8423875135e-54
Suva_2.5995.527ON8273705082e-53
ADR194C5.527ON6373704932e-52
TBLA0D016505.527ON10163984839e-50
KLTH0G03762g5.527ON7093714742e-49
KNAG0C032305.527ON5613954621e-48
CAGL0F03047g5.527ON7443994691e-48
Kwal_47.186425.527ON3093384352e-47
Ecym_40655.527ON7213794406e-45
KAFR0E033005.527ON4663753943e-40
Kpol_1023.985.527ON6673653073e-28
TPHA0K005305.527ON6461721621e-10
CAGL0A03696g3.517ON4151651431e-08
ZYRO0E08404g3.517ON348571366e-08
KAFR0I023803.517ON4091531368e-08
NCAS0F037303.517ON432541369e-08
KAFR0F041403.517ON348631359e-08
KNAG0E015903.517ON423401351e-07
TBLA0I032703.517ON433541351e-07
Ecym_12103.517ON450611342e-07
TPHA0A058103.517ON424451332e-07
Smik_5.1503.517ON417401323e-07
Kwal_47.190403.517ON429541323e-07
Skud_5.1363.517ON418401313e-07
Suva_5.1233.517ON423401313e-07
YER027C (GAL83)3.517ON417401314e-07
SAKL0F02002g3.517ON503401314e-07
NDAI0B060103.517ON503401305e-07
KNAG0B006003.517ON389521297e-07
KLLA0B00583g3.517ON486401298e-07
Kpol_195.23.517ON435401271e-06
TDEL0D058503.517ON404541252e-06
KLTH0G01848g3.517ON416401243e-06
KNAG0B036905.527ON326591224e-06
NDAI0I028903.517ON582401225e-06
AER361C3.517ON475521216e-06
Smik_7.553.517ON415401191e-05
CAGL0K09350g3.517ON432401191e-05
YGL208W (SIP2)3.517ON415401191e-05
Suva_7.533.517ON414401191e-05
NCAS0E006203.517ON500541191e-05
Skud_7.603.517ON441401181e-05
KLTH0H10296g1.337ON166897743.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1004.21
         (755 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1004.21 s1004 complement(41725..43992) [2268 bp, 755 aa] {O...  1269   0.0  
ZYRO0D12562g Chr4 complement(1061702..1064158) [2457 bp, 818 aa]...   219   4e-60
TDEL0A03910 Chr1 complement(701073..703322) [2250 bp, 749 aa] {O...   209   4e-57
SAKL0G04928g Chr7 complement(405798..408476) [2679 bp, 892 aa] {...   210   1e-56
Smik_4.697 Chr4 complement(1236081..1238534) [2454 bp, 817 aa] {...   208   2e-56
Skud_4.696 Chr4 complement(1236293..1238728) [2436 bp, 811 aa] {...   205   2e-55
YDR422C Chr4 complement(1315326..1317773) [2448 bp, 815 aa] {ON}...   205   3e-55
NCAS0F01090 Chr6 complement(215542..217905) [2364 bp, 787 aa] {O...   204   3e-55
NDAI0H01600 Chr8 complement(387297..389825) [2529 bp, 842 aa] {O...   202   5e-54
Suva_2.599 Chr2 complement(1068063..1070546) [2484 bp, 827 aa] {...   200   2e-53
ADR194C Chr4 complement(1039625..1041538) [1914 bp, 637 aa] {ON}...   194   2e-52
TBLA0D01650 Chr4 (406397..409447) [3051 bp, 1016 aa] {ON} Anc_5....   190   9e-50
KLTH0G03762g Chr7 complement(297935..300064) [2130 bp, 709 aa] {...   187   2e-49
KNAG0C03230 Chr3 (632659..634344) [1686 bp, 561 aa] {ON} Anc_5.5...   182   1e-48
CAGL0F03047g Chr6 complement(298906..301140) [2235 bp, 744 aa] {...   185   1e-48
Kwal_47.18642 s47 (908641..909570) [930 bp, 309 aa] {ON} YDR422C...   172   2e-47
Ecym_4065 Chr4 (144003..146168) [2166 bp, 721 aa] {ON} similar t...   174   6e-45
KAFR0E03300 Chr5 (654349..655749) [1401 bp, 466 aa] {ON} Anc_5.5...   156   3e-40
Kpol_1023.98 s1023 (229891..231894) [2004 bp, 667 aa] {ON} (2298...   122   3e-28
TPHA0K00530 Chr11 (105141..107081) [1941 bp, 646 aa] {ON} Anc_5....    67   1e-10
CAGL0A03696g Chr1 (377255..378502) [1248 bp, 415 aa] {ON} simila...    60   1e-08
ZYRO0E08404g Chr5 complement(672301..673347) [1047 bp, 348 aa] {...    57   6e-08
KAFR0I02380 Chr9 (482219..483448) [1230 bp, 409 aa] {ON} Anc_3.5...    57   8e-08
NCAS0F03730 Chr6 complement(750798..752096) [1299 bp, 432 aa] {O...    57   9e-08
KAFR0F04140 Chr6 complement(814903..815949) [1047 bp, 348 aa] {O...    57   9e-08
KNAG0E01590 Chr5 complement(317054..318325) [1272 bp, 423 aa] {O...    57   1e-07
TBLA0I03270 Chr9 complement(793849..795150) [1302 bp, 433 aa] {O...    57   1e-07
Ecym_1210 Chr1 (423627..424979) [1353 bp, 450 aa] {ON} similar t...    56   2e-07
TPHA0A05810 Chr1 complement(1317530..1318804) [1275 bp, 424 aa] ...    56   2e-07
Smik_5.150 Chr5 complement(213879..215132) [1254 bp, 417 aa] {ON...    55   3e-07
Kwal_47.19040 s47 complement(1073036..1074325) [1290 bp, 429 aa]...    55   3e-07
Skud_5.136 Chr5 complement(206871..208127) [1257 bp, 418 aa] {ON...    55   3e-07
Suva_5.123 Chr5 complement(184865..186136) [1272 bp, 423 aa] {ON...    55   3e-07
YER027C Chr5 complement(208979..210232) [1254 bp, 417 aa] {ON}  ...    55   4e-07
SAKL0F02002g Chr6 (167591..169102) [1512 bp, 503 aa] {ON} simila...    55   4e-07
NDAI0B06010 Chr2 complement(1460221..1461732) [1512 bp, 503 aa] ...    55   5e-07
KNAG0B00600 Chr2 (97910..99079) [1170 bp, 389 aa] {ON} Anc_3.517...    54   7e-07
KLLA0B00583g Chr2 complement(44819..46279) [1461 bp, 486 aa] {ON...    54   8e-07
Kpol_195.2 s195 complement(4330..5637) [1308 bp, 435 aa] {ON} co...    54   1e-06
TDEL0D05850 Chr4 complement(1062927..1064141) [1215 bp, 404 aa] ...    53   2e-06
KLTH0G01848g Chr7 (136780..138030) [1251 bp, 416 aa] {ON} simila...    52   3e-06
KNAG0B03690 Chr2 (708946..709926) [981 bp, 326 aa] {ON} Anc_5.52...    52   4e-06
NDAI0I02890 Chr9 complement(682274..684022) [1749 bp, 582 aa] {O...    52   5e-06
AER361C Chr5 complement(1307677..1309104) [1428 bp, 475 aa] {ON}...    51   6e-06
Smik_7.55 Chr7 (92235..93482) [1248 bp, 415 aa] {ON} YGL208W (REAL)    50   1e-05
CAGL0K09350g Chr11 complement(922651..923949) [1299 bp, 432 aa] ...    50   1e-05
YGL208W Chr7 (97338..98585) [1248 bp, 415 aa] {ON}  SIP2One of t...    50   1e-05
Suva_7.53 Chr7 (93895..95139) [1245 bp, 414 aa] {ON} YGL208W (REAL)    50   1e-05
NCAS0E00620 Chr5 (106661..108163) [1503 bp, 500 aa] {ON} Anc_3.517     50   1e-05
Skud_7.60 Chr7 (102699..104024) [1326 bp, 441 aa] {ON} YGL208W (...    50   1e-05
KLTH0H10296g Chr8 (883534..888540) [5007 bp, 1668 aa] {ON} weakl...    33   3.5  

>Kpol_1004.21 s1004 complement(41725..43992) [2268 bp, 755 aa] {ON}
           complement(41725..43992) [2268 nt, 756 aa]
          Length = 755

 Score = 1269 bits (3283), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 640/755 (84%), Positives = 640/755 (84%)

Query: 1   MGNHLSIGARHTNYISDGDNSNVLGSNSLNDDALFKQRQGSIRSELFTSRNNSNRNKIYS 60
           MGNHLSIGARHTNYISDGDNSNVLGSNSLNDDALFKQRQGSIRSELFTSRNNSNRNKIYS
Sbjct: 1   MGNHLSIGARHTNYISDGDNSNVLGSNSLNDDALFKQRQGSIRSELFTSRNNSNRNKIYS 60

Query: 61  ELAARXXXXXXXXXXXXVKESLFKKDYSMGRHPNTVNHVKNRVDFTRXXXXXXXXXXXXX 120
           ELAAR            VKESLFKKDYSMGRHPNTVNHVKNRVDFTR             
Sbjct: 61  ELAARNNLTTINSSNTNVKESLFKKDYSMGRHPNTVNHVKNRVDFTRNSSNEYSSSSLSS 120

Query: 121 XXXXAYTPSFFSLGPSTATVEQSTEKVIRLDEQHHPHQNLASKKDIVINHEHRPSILALK 180
               AYTPSFFSLGPSTATVEQSTEKVIRLDEQHHPHQNLASKKDIVINHEHRPSILALK
Sbjct: 121 NTDSAYTPSFFSLGPSTATVEQSTEKVIRLDEQHHPHQNLASKKDIVINHEHRPSILALK 180

Query: 181 QNLYESSSGVPLYDSQPSSEVPSELHSPSTRSFERQKSVSIDIPQDNSNKKDLRNPILIN 240
           QNLYESSSGVPLYDSQPSSEVPSELHSPSTRSFERQKSVSIDIPQDNSNKKDLRNPILIN
Sbjct: 181 QNLYESSSGVPLYDSQPSSEVPSELHSPSTRSFERQKSVSIDIPQDNSNKKDLRNPILIN 240

Query: 241 LEYNERNNKNESNFQNEIQPXXXXXXXXXXXXXXXYSADEDMVWNQSLLNGLITSXXXXX 300
           LEYNERNNKNESNFQNEIQP               YSADEDMVWNQSLLNGLITS     
Sbjct: 241 LEYNERNNKNESNFQNEIQPNNLNVNYNNNGNSNNYSADEDMVWNQSLLNGLITSNNDYI 300

Query: 301 XXXXXXXXXXXXXXXXPKFENSISPTFNDSNDGNVHYDGKQHCSGTEGYHFSDKKTSNIV 360
                           PKFENSISPTFNDSNDGNVHYDGKQHCSGTEGYHFSDKKTSNIV
Sbjct: 301 DNNINNKNFNLNHHKYPKFENSISPTFNDSNDGNVHYDGKQHCSGTEGYHFSDKKTSNIV 360

Query: 361 NRTQFSSLASKQISYRNSSAFSSTFSLDLGSENVRVFLKWRDLIDDIENANISIVSNEIL 420
           NRTQFSSLASKQISYRNSSAFSSTFSLDLGSENVRVFLKWRDLIDDIENANISIVSNEIL
Sbjct: 361 NRTQFSSLASKQISYRNSSAFSSTFSLDLGSENVRVFLKWRDLIDDIENANISIVSNEIL 420

Query: 421 SVICMNDLDSENSDSARMVYYPDTSEWVTKYLFLPPGIYKLQFNVNGSLRHSDYLPTATD 480
           SVICMNDLDSENSDSARMVYYPDTSEWVTKYLFLPPGIYKLQFNVNGSLRHSDYLPTATD
Sbjct: 421 SVICMNDLDSENSDSARMVYYPDTSEWVTKYLFLPPGIYKLQFNVNGSLRHSDYLPTATD 480

Query: 481 NLGNIVNWFEVPRGYESIEPFRDNDYVKNEISGGILQPIPNTLGIPXXXXXXXXXXXXXX 540
           NLGNIVNWFEVPRGYESIEPFRDNDYVKNEISGGILQPIPNTLGIP              
Sbjct: 481 NLGNIVNWFEVPRGYESIEPFRDNDYVKNEISGGILQPIPNTLGIPSVSSQLSSFSFHAS 540

Query: 541 RPTTPYSDFAGINRSSPLPLREKSPDVKSTNFDLEFSTAVPEPKYDYTTEIPEIYKAVXX 600
           RPTTPYSDFAGINRSSPLPLREKSPDVKSTNFDLEFSTAVPEPKYDYTTEIPEIYKAV  
Sbjct: 541 RPTTPYSDFAGINRSSPLPLREKSPDVKSTNFDLEFSTAVPEPKYDYTTEIPEIYKAVDL 600

Query: 601 XXXXXXXXXXXXXXXXXXXPPLYLGTGGNSIFNDVIGCSQRDLFEKLSKNTGKGLNTDEL 660
                              PPLYLGTGGNSIFNDVIGCSQRDLFEKLSKNTGKGLNTDEL
Sbjct: 601 DLTTAKATETTTDDEDITKPPLYLGTGGNSIFNDVIGCSQRDLFEKLSKNTGKGLNTDEL 660

Query: 661 EKIFLAKYPITDLPIYLNTDYMNKALEQHRNIVGVDDVMQEEXXXXXXXXXXXXXXXLLT 720
           EKIFLAKYPITDLPIYLNTDYMNKALEQHRNIVGVDDVMQEE               LLT
Sbjct: 661 EKIFLAKYPITDLPIYLNTDYMNKALEQHRNIVGVDDVMQEEINVVNHIVPHVNIKHLLT 720

Query: 721 HNIQDSVIAVACTVRYGGKFITQVVYSPCSVENDD 755
           HNIQDSVIAVACTVRYGGKFITQVVYSPCSVENDD
Sbjct: 721 HNIQDSVIAVACTVRYGGKFITQVVYSPCSVENDD 755

>ZYRO0D12562g Chr4 complement(1061702..1064158) [2457 bp, 818 aa]
           {ON} some similarities with uniprot|P32578 Saccharomyces
           cerevisiae YDR422C SIP1 Alternate beta-subunit of the
           Snf1p kinase complex may confer substrate specificity
           vacuolar protein containing KIS (Kinase-Interacting
           Sequence) and ASC (Association with Snf1 kinase Complex)
           domains involved in protein interactions
          Length = 818

 Score =  219 bits (557), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 140/396 (35%), Positives = 201/396 (50%), Gaps = 53/396 (13%)

Query: 392 ENVRVFLKWRDLIDDIENANISIVSNEILSVICMNDLDSENSDSARMVYYPDTSEWVTKY 451
           ++V V +KWRD +       +S+VS +I S +          ++  M Y  +T EWV   
Sbjct: 437 QDVHVAIKWRDHLPVDGTNRMSMVSEDIASTLSFERQKHGARNTFPMRYEEETKEWVVPD 496

Query: 452 LFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEVPRGYESIEPFRDN------- 504
           L LP G+Y+LQF +NG L HS+YLPTATD++GN VNWFEV  GYE +EP+RD        
Sbjct: 497 LVLPVGVYRLQFLINGELTHSNYLPTATDSVGNFVNWFEVIPGYEKVEPYRDEVELDSGQ 556

Query: 505 --DYVKNEISGGIL-------------QPIPNTLGIPXXXXXXXXXXXXXXRPTTPYSDF 549
             +   N I+G +L             +P+P  + +               R  TPYSD+
Sbjct: 557 PLNAGNNGIAGSVLSLENQGSEGTVLMEPVPGKVNVRPPLASMHHSSNRVIRSNTPYSDY 616

Query: 550 AGINRSSPLPLREKSPDVKSTNFDLEFSTAVPEPKYDYTTEIPEIYKAVXXXXXXXXXXX 609
            GI+RSS   LR KSP +  T   L+  TA+   KY Y+ EIPE++K             
Sbjct: 617 TGISRSSSA-LR-KSP-INCTTSSLDLHTALQPKKYKYSNEIPELFKTA---PITKANDE 670

Query: 610 XXXXXXXXXXPPLYLGTGG----NSIF-NDVIGCSQRDLFEKLSKNTGKGLNTDELEKIF 664
                     PP Y    G    N+ F N V+ C+Q +LF +L +  G  L+ +  E++F
Sbjct: 671 NEDFTFGHMEPPTYDWARGHPSSNAGFGNQVVDCNQDELFTELQQ--GGLLDAETAEQLF 728

Query: 665 LAKYPITDLPIYLNTDYMNKALEQHR-------NIVGVDDVMQEEXXXXXXXXXXXXXXX 717
           L KYP+ DLPIYLN+ Y+N+ + + +          G++ ++                  
Sbjct: 729 LEKYPVPDLPIYLNSYYLNRIISEFQKNNYPGGGSGGINHIIPH-----------VNLNH 777

Query: 718 LLTHNIQDSVIAVACTVRYGGKFITQVVYSPCSVEN 753
           LLT +I+D +I+V CT RY GKFITQV+Y+PC  EN
Sbjct: 778 LLTSSIRDEMISVGCTTRYEGKFITQVIYAPCYYEN 813

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 56/210 (26%), Positives = 81/210 (38%), Gaps = 43/210 (20%)

Query: 1   MGN----HLSIGARHTNYISDGDNSNVLGSNSLNDDALFKQRQGSIRSELFTSRNNSNRN 56
           MGN    H  +G + +    + +NS+   S +     + K RQ SI S+LF SR   +  
Sbjct: 1   MGNTPSAHQRVGRKGSENFQESNNSSNRYSQTKYLLEVDKGRQSSITSQLFPSRKTRHAP 60

Query: 57  KIYSELAARXXXXXXXXXXXXVKESLFKKDYSM------GRHPNTVNHVKNRV------- 103
                L  +               SLFKK+YS+       + PN  N+  + V       
Sbjct: 61  SGLGNLKRKTQNVVPH------PPSLFKKNYSLEEASAGAQGPNNNNNDNHNVTLMAADD 114

Query: 104 ---DF----TRXXXXXXXXXXXXXXXXXAYTPSFFSLGPSTATVEQSTEKVIRLDEQHHP 156
              DF    T                     P FFS GP+T TV+ + E+ I        
Sbjct: 115 DPRDFNDTKTSTESVRENMAGLSIKSSNETGPMFFSPGPATPTVQPTKEEAI-------- 166

Query: 157 HQNLASKKDIVINHEHRPSILALKQNLYES 186
                   D +I H +R S++ALK+NL ES
Sbjct: 167 ----PPMDDNMIFH-NRQSVVALKKNLEES 191

>TDEL0A03910 Chr1 complement(701073..703322) [2250 bp, 749 aa] {ON}
           Anc_5.527 YDR422C
          Length = 749

 Score =  209 bits (533), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 135/382 (35%), Positives = 188/382 (49%), Gaps = 40/382 (10%)

Query: 392 ENVRVFLKWRDLIDDIENANISIVSNEILSVICMNDLDSENSDSARMVYYPDTSEWVTKY 451
           E V V LKWRD I+D     I+I+S +I S +  +  D     +  M Y    + +    
Sbjct: 372 EKVHVILKWRDQIEDPSKCKITIISTDIASALNFDPSDKSFHGTFSMKYDEKENNFYVPN 431

Query: 452 LFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEVPRGYESIEPFRDN-DYVKN- 509
           L LPPGIYK QF +NG +RHS+ LP+ATD++GNIVNWFEV  GYES+EPFR+  DY +N 
Sbjct: 432 LSLPPGIYKFQFVINGEIRHSNLLPSATDSVGNIVNWFEVIPGYESVEPFRNEIDYHENM 491

Query: 510 ------------------EISGGI--LQPIPNTLGIPXXXXXXXXXXXXXXRPTTPYSDF 549
                             E  G +  +QP+P     P              R  TPYSD+
Sbjct: 492 GIDPPQSDSSTSTGKHHDESPGKVPLVQPVPGR--PPLAARHTSSYSNKQERSGTPYSDY 549

Query: 550 AGINRSSPLPLREKSPDVKSTNFDLEFSTAVPEPKYDYTTEIPEIYKAVXXXXXXXXXXX 609
            G++R +      KSP +  T   ++  TA+   KY+Y+ EIPE++KA            
Sbjct: 550 TGVSRCN--SAVRKSPLIHQTLSSIDLVTALQPKKYEYSNEIPELFKAGNVLGQSDENQF 607

Query: 610 XXXXXXXXXXPPLYLGTGGNSIFNDVIGCSQRDLFEKLSKNTGKGLNTDELEKIFLAKYP 669
                               S   +V+ C+Q +LF  L +  G  L+ +  E++FL KY 
Sbjct: 608 PTPPPPPMNP----PSYDQPSFLENVVDCNQDNLFVSLQQ--GGLLDAETAEQLFLEKYT 661

Query: 670 ITDLPIYLNTDYMNKALE--QHRNIVGVDDVMQEEXXXXXXXXXXXXXXXLLTHNIQDSV 727
           + DLP+YLN+ Y+NK     Q  N +G +                     LLT +I+D +
Sbjct: 662 VPDLPVYLNSTYLNKIFNEFQKHNSLGSN------SSGLNHIIPHVNLNHLLTSSIRDEM 715

Query: 728 IAVACTVRYGGKFITQVVYSPC 749
           I+V CT RY GKFITQVVY+PC
Sbjct: 716 ISVGCTTRYEGKFITQVVYAPC 737

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 72/189 (38%), Gaps = 29/189 (15%)

Query: 38  RQGSIRSELFTSRNNSNRNKIYSELAARXXXXXXXXXXXXVKESLFKKDYSMGRHPNTVN 97
           RQ SI S+LF SRN  +       +                  SLFK DYS+    +T  
Sbjct: 37  RQQSITSQLFPSRNTRH-------VGPHSMNAKRNRHPHPQPPSLFKSDYSLR---STAE 86

Query: 98  HVKNRVDFTRXXXXXXXXXXXXXXXXXAYTPSFFSLGPSTATVEQSTEKVIRLDEQHHPH 157
                   T                  A  PSF + G ST TV+ + +  +   +  +  
Sbjct: 87  ETPANTGSTENIRDNMAGLSLKSSNENAQVPSFLTPGHSTPTVQPTRQAAVPAADLKNKL 146

Query: 158 QN-LASKKDIVINHEHRPSILALKQNLYESSSGVPLYDSQPSSEVPSELHSPSTRSFERQ 216
           QN L  +K+I  +   RPS++ALK+ L +                  ELHS S+RS    
Sbjct: 147 QNGLNQQKEISSHRFQRPSVVALKKTLLDD----------------GELHSTSSRSTSGD 190

Query: 217 --KSVSIDI 223
              S S+DI
Sbjct: 191 VVSSASLDI 199

>SAKL0G04928g Chr7 complement(405798..408476) [2679 bp, 892 aa] {ON}
           some similarities with uniprot|P32578 Saccharomyces
           cerevisiae YDR422C SIP1 Alternate beta-subunit of the
           Snf1p kinase complex may confer substrate specificity
           vacuolar protein containing KIS (Kinase-Interacting
           Sequence) and ASC (Association with Snf1 kinase Complex)
           domains involved in protein interactions
          Length = 892

 Score =  210 bits (534), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 142/386 (36%), Positives = 192/386 (49%), Gaps = 53/386 (13%)

Query: 394 VRVFLKWRDLIDDIENANISIVSNEILSVICMNDLDSENSDSARMVYYPDTSEWVTKYLF 453
           V V LKWRD I D +   IS++S++I +V+ +     ++S    M Y      W    L 
Sbjct: 526 VNVVLKWRDCIVDPKTCKISVISSDISAVLAL-----QSSKKIPMEYETTEKSWFVPNLK 580

Query: 454 LPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEVPRGYESIEPFRD---------- 503
           LPPG+YKLQF +NG LRHS++LPTATD+ GN VNWFEV  GY  IEP RD          
Sbjct: 581 LPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLPGYYEIEPLRDVPVDSMNYGS 640

Query: 504 --NDYVKNEISGG----ILQPIPNTLGIPXXXXXXXXXXXXXXRPTTPYSDFAGI----N 553
                +K  ++GG    I  PIP    +               R TTPYSD+ GI    N
Sbjct: 641 DLGVSMKESVNGGSDFTITAPIPRPPLLSQATSSSYRSSKYIERSTTPYSDYTGILSRSN 700

Query: 554 RSSPLPLREKSPDVKSTNFDLEFSTAVPEPKYDYTTEIPEIYKAVXXXXXXXXXXXXXXX 613
            + PL L +K    KS+++D+ F+  +P  KY+Y+T+IPE++K                 
Sbjct: 701 SARPL-LNQK----KSSSYDV-FA-PLPPKKYEYSTDIPELFKV---------NDEEDHD 744

Query: 614 XXXXXXPPLY--LGTGGN----SIFNDVIGCSQRDLFEKLSKNTGKGLNTDELEKIFLAK 667
                 PP Y  L  G      S    V  C+Q  LF  L ++    ++    E+ FL K
Sbjct: 745 HDIPEDPPSYSSLLKGSEAEQPSFHCRVQDCNQDRLFSDLQQH--DRIDAQAAEEFFLQK 802

Query: 668 YPITDLPIYLNTDYMNKALEQHRNIVGVDDVMQEEXXXXXXXXXXXXXXXLLTHNIQDSV 727
           YP+ DLPIYLN+ Y+NK   Q +     D+   E                LLT +I++ +
Sbjct: 803 YPVPDLPIYLNSSYLNKVFNQLQK----DNNAGETKAVVNPVIPHVNLNHLLTSSIREEI 858

Query: 728 IAVACTVRYGGKFITQVVYSPCSVEN 753
           I+V CT RY GKFIT VVY+PC  EN
Sbjct: 859 ISVGCTTRYEGKFITHVVYAPCYYEN 884

>Smik_4.697 Chr4 complement(1236081..1238534) [2454 bp, 817 aa] {ON}
           YDR422C (REAL)
          Length = 817

 Score =  208 bits (530), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 133/382 (34%), Positives = 197/382 (51%), Gaps = 49/382 (12%)

Query: 391 SENVRVFLKWRDLIDDIENANISIVSNEILSVIC-MNDLDSENSDS----------ARMV 439
           +E+  V LKW++  +      +SIVSN+I S +    ++D++ S S           RMV
Sbjct: 449 AESTLVILKWKNYSNMAVTTEVSIVSNDIASALKEQREVDADESASLDSEKQLNPRIRMV 508

Query: 440 YYPDTSEWVTKYLFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEVPRGYESIE 499
           Y     EW    LFLPPGIY+LQF++NG L HS+YLPTATD+ GN VNWFEV  GY +IE
Sbjct: 509 YDNVHKEWFFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPGYHTIE 568

Query: 500 PFRDNDYVKNEISGGILQ--PIPNTLGIPXXXXXXXXXXXXX--XRPTTPYSDFAGINRS 555
           PFR+   + +++   + +  PI   L                   RP+TP+SD+ G++RS
Sbjct: 569 PFRNEADLGSQVEPVLEEESPIRPELKRFSSSSRKSSYYSAKGVERPSTPFSDYRGLSRS 628

Query: 556 SPLPLREKSPDVKSTNFDLEFSTAVPEPKYDYTTEIPEIYKAVXXXXXXXXXXXXXXXXX 615
           S + +R+    +K+++ DL  +   PE K +Y+ EIP ++                    
Sbjct: 629 SSVNMRDSFVRLKASSLDL-MAEIKPE-KLEYSNEIPNLFNIADGGTTSVIRESRDSSPQ 686

Query: 616 XXXXPPLYLGTGGNSIFNDVIGCSQRDLFEKLSKNTGKGLNTDELEKIFLAKYPITDLPI 675
                         S    V+ C+Q DLF  L +  G  ++ +  E +FL++YPI DLPI
Sbjct: 687 EQP-----------SFTYKVVDCNQDDLFATLQQ--GGNIDAETAETVFLSRYPIPDLPI 733

Query: 676 YLNTDYMNKALEQH--------RNIVGVDDVMQEEXXXXXXXXXXXXXXXLLTHNIQDSV 727
           YLN+ Y+NK L Q         R+   ++ ++                  LLT +I+D +
Sbjct: 734 YLNSSYLNKILNQSNPNSEPHDRDEGAINHIIPH-----------VNLNHLLTSSIRDEI 782

Query: 728 IAVACTVRYGGKFITQVVYSPC 749
           I+VACT RY GKFITQV+Y+PC
Sbjct: 783 ISVACTTRYEGKFITQVIYAPC 804

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 86/212 (40%), Gaps = 38/212 (17%)

Query: 36  KQRQGSIRSELFTSRNNSNRNKIY------SELAARXXXXXXXXXXXXVKES-------- 81
           K RQGSI S+LF +R + ++  +         + +R              +S        
Sbjct: 28  KDRQGSITSQLFNNRKSIHKRHVSHTSGHNGTIPSRMQLLASHDSVTDCDDSVNDDTTID 87

Query: 82  -----LFKKDYSMGRHPNTVNHVKNRVDFTRXXXXXXXXXXXXXXXXXAYTPSFFSLGPS 136
                LFKKDYS+       N+  +  D T                    +PSF S GPS
Sbjct: 88  KEPSLLFKKDYSL-------NNTADGNDTTLANLSLIDDHDVGAPEEQVKSPSFLSPGPS 140

Query: 137 TATVEQSTEKVIRLDEQHHPHQNLASKKDIVINH----EHRPSILALKQNLYESSSGVPL 192
            ATV+Q+   +  L   ++   + A+ +D   NH     HR SI+ALK+ L E+S+    
Sbjct: 141 MATVKQTKSDLENLSTSNYTTVDEAT-EDGRTNHPRHERHRSSIIALKKTLLENSAT--- 196

Query: 193 YDSQPSSEVPSELHSPSTRSFERQKSVSIDIP 224
             + PS    S +HS S     +    SID P
Sbjct: 197 --ASPSPTRSSSVHSASMPPLTKMD--SIDTP 224

>Skud_4.696 Chr4 complement(1236293..1238728) [2436 bp, 811 aa] {ON}
           YDR422C (REAL)
          Length = 811

 Score =  205 bits (522), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 133/380 (35%), Positives = 194/380 (51%), Gaps = 48/380 (12%)

Query: 392 ENVRVFLKWRDLIDDIENANISIVSNEILSV------ICMND---LDSEN--SDSARMVY 440
           EN  V LKW+   +      +SIVSN+I S       + ++D   LDSE   +   RM+Y
Sbjct: 447 ENTLVVLKWKSDTNMTATTEVSIVSNDIASALKEQREVNLDDDASLDSEKPLNSRIRMIY 506

Query: 441 YPDTSEWVTKYLFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEVPRGYESIEP 500
                EW    LFLP GIY+LQF++NG L HS++LPTATD+ GN VNWFEV  GY +IEP
Sbjct: 507 DSVHREWFVPDLFLPAGIYRLQFSINGLLTHSNFLPTATDSEGNFVNWFEVLPGYHTIEP 566

Query: 501 FRDNDYVKNEISGGILQ--PI-PNTLGIPXXXXXXXXXXXXXXRPTTPYSDFAGINRSSP 557
           FRD   +  ++   + +  PI P    +               RP TP+SD+ G++RS+ 
Sbjct: 567 FRDEADMDFQMRSTLDEEAPIRPEPKRLSSSRKSSYYSAKDGERPGTPFSDYRGLSRSNS 626

Query: 558 LPLREKSPDVKSTNFDLEFSTAVPEPKYDYTTEIPEIYKAVXXXXXXXXXXXXXXXXXXX 617
           + LR     +K+++ DL  +   PE K +Y+ EIP ++                      
Sbjct: 627 VFLRGSFVRLKASSLDL-MAEIKPE-KLEYSNEIPNLFNIGEASTTTSKDHFERLSPQDR 684

Query: 618 XXPPLYLGTGGNSIFNDVIGCSQRDLFEKLSKNTGKGLNTDELEKIFLAKYPITDLPIYL 677
                       S  + V+ C+Q DLF  L +  G  ++ +  E +FL++YPI DLPIYL
Sbjct: 685 P-----------SFTHKVVDCNQDDLFATLQQ--GGNIDAETAEAVFLSRYPIPDLPIYL 731

Query: 678 NTDYMNKALEQHR--------NIVGVDDVMQEEXXXXXXXXXXXXXXXLLTHNIQDSVIA 729
           N+ Y+N+ L Q          +  G++ ++                  LLT +I+D +I+
Sbjct: 732 NSSYLNRILNQSNPNSEFHDGDEGGINHIIPH-----------VNLNHLLTSSIRDEIIS 780

Query: 730 VACTVRYGGKFITQVVYSPC 749
           VACT RY GKFITQV+Y+PC
Sbjct: 781 VACTTRYEGKFITQVIYAPC 800

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 67/233 (28%), Positives = 88/233 (37%), Gaps = 58/233 (24%)

Query: 32  DALFKQRQGSIRSELF----------TSRNNSNRNKIYSELAARXXXXXXXXXXXXV--- 78
           +A  K RQGSI S+LF          TS  +S++  I   +               V   
Sbjct: 24  EAFNKDRQGSITSQLFNNKKSVHKRHTSHASSHKAAIPHRMQLLASHDVASDCDSSVNND 83

Query: 79  ----KES--LFKKDYSMGRHPNTVNHVKNRVDFTRXXXXXXXXXXXXXXXXXAYTPSFFS 132
               KE   LFKKDYS+        +  +  D T                    +PSF S
Sbjct: 84  TIIDKEPSPLFKKDYSLA-------NAADENDTTLANLSLNDDHDGSAPEEQVKSPSFLS 136

Query: 133 LGPSTATVEQ--------STEKVIRLDEQH------HPHQNLASKKDIVINHE-HRPSIL 177
            GPS ATV+Q        ST     +DE        HPH            HE HR SI+
Sbjct: 137 PGPSMATVKQTKSDLDDLSTVNCTVVDETMENERSGHPH------------HERHRSSII 184

Query: 178 ALKQNLYESSSGVPLYDSQPSSEVPSELHSPSTRSFERQKSVSIDIPQDNSNK 230
           ALK+ L E+S+      + PS    S +HS S     +  S+ I + Q  S K
Sbjct: 185 ALKKTLMENSAT-----ASPSPTRSSSVHSASLPPLTKTGSIDIPVKQTYSKK 232

>YDR422C Chr4 complement(1315326..1317773) [2448 bp, 815 aa] {ON}
           SIP1Alternate beta-subunit of the Snf1p kinase complex,
           may confer substrate specificity; vacuolar protein
           containing KIS (Kinase-Interacting Sequence) and ASC
           (Association with Snf1 kinase Complex) domains involved
           in protein interactions
          Length = 815

 Score =  205 bits (522), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 129/373 (34%), Positives = 188/373 (50%), Gaps = 33/373 (8%)

Query: 392 ENVRVFLKWRDLIDDIENANISIVSNEILSVICMN---------DLDSENS--DSARMVY 440
           EN  V LKW+D         + IVS +I S +             LDSE       RMVY
Sbjct: 450 ENTLVVLKWKDDGTVAATTEVFIVSTDIASALKEQRELTLDENASLDSEKQLNPRIRMVY 509

Query: 441 YPDTSEWVTKYLFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEVPRGYESIEP 500
                EW    LFLP GIY+LQF++NG L HS++LPTATD+ GN VNWFEV  GY +IEP
Sbjct: 510 DDVHKEWFVPDLFLPAGIYRLQFSINGILTHSNFLPTATDSEGNFVNWFEVLPGYHTIEP 569

Query: 501 FRDNDYVKNEISGGILQPIPNTLGIPX----XXXXXXXXXXXXXRPTTPYSDFAGINRSS 556
           FR+   + +++   + + +P    +                   RP+TP+SD+ G++RSS
Sbjct: 570 FRNEADIDSQVEPTLDEELPKRPELKRFPSSSRKSSYYSAKGVERPSTPFSDYRGLSRSS 629

Query: 557 PLPLREKSPDVKSTNFDLEFSTAVPEPKYDYTTEIPEIYKAVXXXXXXXXXXXXXXXXXX 616
            + +R+    +K+++ DL  +   PE +  Y+ EIP ++                     
Sbjct: 630 SINMRDSFVRLKASSLDL-MAEVKPE-RLVYSNEIPNLFNI---GDGSTISVKGDSDDVH 684

Query: 617 XXXPPLYLGTGGNSIFNDVIGCSQRDLFEKLSKNTGKGLNTDELEKIFLAKYPITDLPIY 676
              PP        S  + V+ C+Q DLF  L +  G  ++ +  E +FL++YP+ DLPIY
Sbjct: 685 PQEPP--------SFTHRVVDCNQDDLFATLQQ--GGNIDAETAEAVFLSRYPVPDLPIY 734

Query: 677 LNTDYMNKALEQHRNIVGVDDVMQEEXXXXXXXXXXXXXXXLLTHNIQDSVIAVACTVRY 736
           LN+ Y+N+ L Q        +  + +               LLT +I+D +I+VACT RY
Sbjct: 735 LNSSYLNRILNQSNQ---NSESHERDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRY 791

Query: 737 GGKFITQVVYSPC 749
            GKFITQVVY+PC
Sbjct: 792 EGKFITQVVYAPC 804

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 76/284 (26%), Positives = 114/284 (40%), Gaps = 42/284 (14%)

Query: 32  DALFKQRQGSIRSELFTSRNNSNRNKI------------YSELAARXXXXXXXXXXXXVK 79
           DA  K RQGSI S+LF +R ++++ +               +L A               
Sbjct: 24  DAFNKDRQGSITSQLFNNRKSTHKRRASHTSEHNGAIPPRMQLLASHDPSTDCDGRMSSD 83

Query: 80  ES-------LFKKDYSMGRHPNTVNHVKNRVDFTRXXXXXXXXXXXXXXXXXAYTPSFFS 132
            +       LFKKDYS+    + VN      D T                    +PSF S
Sbjct: 84  TTIDKGPSHLFKKDYSLSSAAD-VN------DTTLANLTLSDDHDVGAPEEQVKSPSFLS 136

Query: 133 LGPSTATVEQSTEKVIRLDEQHHPH--QNLASKKDIVINHE-HRPSILALKQNLYESSSG 189
            GPS ATV+++   +  L   ++    +   ++++   +HE HR SI+ALK+NL ESS+ 
Sbjct: 137 PGPSMATVKRTKSDLDDLSTLNYTMVDETTENERNDKPHHERHRSSIIALKKNLLESSAT 196

Query: 190 VPLYDSQPSSEVPSELHSPSTRSFERQKSVSIDIPQDNSNKKDLRNPILINLEYNERNNK 249
                + PS    S +HS S  +  +  S+ I + Q  S K     P +   +Y   N  
Sbjct: 197 -----ASPSPTRSSSVHSASLPALTKTDSIDIPVRQPYSKK-----PSIHAYQYQYLN-- 244

Query: 250 NESNFQNEIQPXXXXXXXXXXXXXXXYSADEDMVWNQSLLNGLI 293
           N+  F    Q                  + EDMV NQSLL   +
Sbjct: 245 NDETFSENSQMDKEGNSDSVDAEAGVLQS-EDMVLNQSLLQNAL 287

>NCAS0F01090 Chr6 complement(215542..217905) [2364 bp, 787 aa] {ON}
           Anc_5.527 YDR422C
          Length = 787

 Score =  204 bits (520), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 135/383 (35%), Positives = 193/383 (50%), Gaps = 48/383 (12%)

Query: 392 ENVRVFLKWRDLIDDIENANISIVSNEILSVICMNDLDSENSDSARMVYYPDTSEWVTKY 451
           +NV+V LKWRD ID+ ++  ISIVS++I S I      +  +    M++ P   EW    
Sbjct: 426 DNVQVVLKWRDQIDNPKHCKISIVSDDISSAIPAK---ATKAGKLPMLFNPMIKEWYVPN 482

Query: 452 LFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEVPRGYESIEPFRD----NDYV 507
           L LPPGIY+L+F++NG L HS++LPTATD++GNIVNWFEV  GY+++EP+RD      + 
Sbjct: 483 LLLPPGIYRLKFSINGDLTHSNFLPTATDSMGNIVNWFEVLPGYDTVEPYRDEIIETTFH 542

Query: 508 KNEISGGILQPIPNTLGIPXXXXXXXXXXXXXXRPTTPYSDFAGINRS-SPLPLREKSPD 566
            N   G +    P T  I                  TPYSD+ GI+RS S L  +  S  
Sbjct: 543 TNGSQGTLRDNNPTT--IRSRRSSSFVSANGDLASMTPYSDYTGISRSNSALNSKRTSLV 600

Query: 567 VKSTNFDLEFSTAVPEPKYDYTTEIPEIYK---AVXXXXXXXXXXXXXXXXXXXXXPPLY 623
                  L+  T +   K +Y+ EIPE++K   ++                     P   
Sbjct: 601 SLRGVGKLDLFTPMEPKKIEYSNEIPELFKISNSIEDEDDDEGDYGHNETLSPFEEP--- 657

Query: 624 LGTGGNSIFNDVIGCSQRDLFEKLSKNTGKGLNTDELEKIFLAKYPITDLPIYLNTDYMN 683
                 S  N V+ C+Q  LF  L KN    ++ +  E +FL KY + DLPIYLN+ Y+N
Sbjct: 658 ------SFTNRVVDCNQDKLFSDLQKN--GNIDAETAEMLFLNKYQVPDLPIYLNSSYLN 709

Query: 684 KAL----EQHRN---------IVGVDDVMQEEXXXXXXXXXXXXXXXLLTHNIQDSVIAV 730
           K      +QH +          +G+  ++                  LLT +I+D +I+V
Sbjct: 710 KIFLQFQKQHNDPTPSANTASTIGITHIIPH-----------VNLNHLLTSSIRDEIISV 758

Query: 731 ACTVRYGGKFITQVVYSPCSVEN 753
           ACT RY GKFITQV+Y+PC+  N
Sbjct: 759 ACTTRYQGKFITQVMYAPCNYGN 781

 Score = 40.0 bits (92), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 59/158 (37%), Gaps = 25/158 (15%)

Query: 32  DALFKQRQGSIRSELFTSRNNSNRNKIYSELAARXXXXXXXXXXXXVKESLFKKDYSMGR 91
           D L  +R+GSI S LFT++N+S R+       ++            V    FKK YS+ R
Sbjct: 38  DHLQDERKGSISSNLFTNKNSSKRHATSIMSQSKVTNDNIQNPPETV---FFKKGYSISR 94

Query: 92  HPNTVNHVKNRVDFT------RXXXXXXXXXXXXXXXXXAYTPSFFSLGPSTATVEQSTE 145
                + +K     T                          + SF S GP+  TVEQ+  
Sbjct: 95  SMQDDSDIKTEGQATVDSENIHEPMASLSLKTSMENDENRKSFSFMSPGPANPTVEQTKH 154

Query: 146 KVIRLDEQHHPHQNLASKKDIVINHEHRPSILALKQNL 183
            V   +                 + EHRPSI+ LKQ L
Sbjct: 155 DVTNKEN----------------SFEHRPSIVTLKQTL 176

>NDAI0H01600 Chr8 complement(387297..389825) [2529 bp, 842 aa] {ON}
           Anc_5.527 YDR422C
          Length = 842

 Score =  202 bits (513), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 132/387 (34%), Positives = 192/387 (49%), Gaps = 53/387 (13%)

Query: 389 LGSENVRVFLKWRDLIDDIENANISIVSNEILSVICMNDLDSENSDSAR----------- 437
           L ++NV V LKWRD ID+ +   I+I+S++I++ +       E+S S R           
Sbjct: 472 LINDNVHVVLKWRDQIDNPKKCKIAIISDDIVNAL-------ESSSSKRKSNTNNNDNNT 524

Query: 438 --MVYYPDTSEWVTKYLFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEVPRGY 495
             MV+ P   EW    L LPPGIY+L+F++N  + HS++LPTATD++GNIVNWFEV  GY
Sbjct: 525 LPMVFNPMIKEWYMPNLTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGY 584

Query: 496 ESIEPFRD---NDYVKNEISGGILQPIPNTLGIPXXXXXXXXXXXXXXRPTTPYSDFAGI 552
           +++EP+RD           S G L  + +   I                  TPYSD+AGI
Sbjct: 585 DAVEPYRDEIIETTFHTAPSQGTLS-VHDLTMIRSRRSSSFVSAKSDLSSFTPYSDYAGI 643

Query: 553 NRSSP----LPLREKSPDVKSTNFDLEFSTAVPEPKYDYTTEIPEIYKAVXXXXXXXXXX 608
           +RSS        +     ++ TN  L+  T +   K  Y+ EIPE++K            
Sbjct: 644 SRSSSSVGTATKKASLVSLRGTN-KLDLFTPIEPKKIAYSKEIPELFKIANSEDTNK--- 699

Query: 609 XXXXXXXXXXXPPLYLGTGGNSIF------NDVIGCSQRDLFEKLSKNTGKGLNTDELEK 662
                        + +   G+S F      + VI C+Q  LF  L ++    ++ +  E 
Sbjct: 700 -------------MEIDDDGSSPFERPSFTHKVIDCNQDKLFADLQRD--GNIDAETAEA 744

Query: 663 IFLAKYPITDLPIYLNTDYMNKALEQHRNIVGVDDVMQEEXXXXXXXXXXXXXXXLLTHN 722
           +FL +YPI DLPIYLN+ Y+NK   Q +       +                   LLT +
Sbjct: 745 LFLNRYPIPDLPIYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTSS 804

Query: 723 IQDSVIAVACTVRYGGKFITQVVYSPC 749
           I+D +I+VACT RY GKFITQV+Y+PC
Sbjct: 805 IRDEIISVACTTRYQGKFITQVMYAPC 831

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 64/230 (27%), Positives = 102/230 (44%), Gaps = 22/230 (9%)

Query: 36  KQRQGSIRSELFTSRNNSNRNKIYSE-LAARXXXXXXXXXXXXVKESLFKKDYSMGRHPN 94
           K+R+GSI S LF+S+ +S R+ +  + + A+               ++FKKDYSM     
Sbjct: 39  KERKGSITSHLFSSKGSSKRHALMPKPIEAQGNIKS---------HNVFKKDYSMDEPLT 89

Query: 95  TVNHVKNRVDFTRX---XXXXXXXXXXXXXXXXAYTPSFFSLGPSTATVEQSTEKVIRLD 151
               +KN  DF                        + SF   GPST TV+ +   +  L+
Sbjct: 90  NKGGIKNN-DFNDENIHETMASLSLVTSSDNERKKSMSFARPGPSTPTVQPTKHDITSLE 148

Query: 152 EQHHPHQNLASKKDIVINHEHRPSILALKQNLYESSSGVPLYDSQP-SSEVPSELHSPST 210
                +  + +       + HRPSI+ALK  L ESS   P   S+  S+    +  S  +
Sbjct: 149 GSTDVNTGIDNMNVAGDLNSHRPSIVALKNTLAESSIHPPSDLSKTVSTSSNCQSFSTES 208

Query: 211 RSFERQKSVSIDIPQ-------DNSNKKDLRNPILINLEYNERNNKNESN 253
            S    K+ SIDIP+       +N N+  L++P + + +Y   NN+N +N
Sbjct: 209 SSSALHKTESIDIPRRHSQGFNENYNETMLKHPTVHSYQYQYFNNENTNN 258

>Suva_2.599 Chr2 complement(1068063..1070546) [2484 bp, 827 aa] {ON}
           YDR422C (REAL)
          Length = 827

 Score =  200 bits (508), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 131/370 (35%), Positives = 189/370 (51%), Gaps = 38/370 (10%)

Query: 396 VFLKWRDLIDDIENANISIVSNEILSVICMN---------DLDSENS--DSARMVYYPDT 444
           V LKW++  +      +SI+S++I S +             LDSE       RM+Y    
Sbjct: 469 VILKWKNNSNMPATTEVSIISHDIASTLKEQLEVNLDEDASLDSEKQLNPRIRMIYDAVH 528

Query: 445 SEWVTKYLFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEVPRGYESIEPFRDN 504
            EW    LFLPPGIY+LQF++NG L HS++LPTATD+ G  VNWFEV  GY +IEPFRD 
Sbjct: 529 KEWFVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRDE 588

Query: 505 DYVKNEISGGI-----LQPIPNTLGIPXXXXXXXXXXXXXXRPTTPYSDFAGINRSSPLP 559
              ++++   I     ++P P  L                 RP+TP+SD+ G++RS+   
Sbjct: 589 ADTESQVGSTIDVEAPIRPEPKRLSS-SSRKSSYYSAKGVERPSTPFSDYRGLSRSNSAN 647

Query: 560 LREKSPDVKSTNFDLEFSTAVPEPKYDYTTEIPEIYKAVXXXXXXXXXXXXXXXXXXXXX 619
           LR+    +K+++ DL  +   PE   +Y+ EIP ++                        
Sbjct: 648 LRDSFVRLKASSLDL-MAQIKPE-ILEYSNEIPSLF----------TIGNGSATPIQEDL 695

Query: 620 PPLYLGTGGNSIFNDVIGCSQRDLFEKLSKNTGKGLNTDELEKIFLAKYPITDLPIYLNT 679
           P   L     S  + V+ C+Q DLF  L +  G  ++ +  E +FL++YPI DLPIYLN+
Sbjct: 696 PSQDLP----SFTHKVVDCNQDDLFATLQQ--GGNIDAETAEIVFLSRYPIPDLPIYLNS 749

Query: 680 DYMNKALEQHRNIVGVDDVMQEEXXXXXXXXXXXXXXXLLTHNIQDSVIAVACTVRYGGK 739
            Y+NK L Q        D   ++               LLT +I+D +I+VACT RY GK
Sbjct: 750 SYLNKILNQGNPNSESGD---KDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGK 806

Query: 740 FITQVVYSPC 749
           FITQV+Y+PC
Sbjct: 807 FITQVIYAPC 816

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 89/236 (37%), Gaps = 61/236 (25%)

Query: 32  DALFKQRQGSIRSELFTSR------NNSNRNKIYSELAARXXXXXXXXXXXXVKES---- 81
           +A  K RQGSI S+LF +R      ++S+ N   + +  R              +     
Sbjct: 24  EAFNKDRQGSITSQLFNNRKSIHKRHSSHANYDNAAIPPRMQLLASQPSTSSTSDCDDST 83

Query: 82  ------------LFKKDYSMGRHPNTVNHVKNRVDFTRXXXXXXXXXXXXXXXXXAYTPS 129
                       LFKKDYS+ +         +  + T                    +P+
Sbjct: 84  NNDVSAASEPSPLFKKDYSVAK-------AADDNETTLANLSLYDRHDASAPEEQVKSPT 136

Query: 130 FFSLGPSTATVEQS--------------TEKVIRLDEQHHPHQNLASKKDIVINHE-HRP 174
           F S GPS ATV+Q+               ++ I  + + HPH            HE HR 
Sbjct: 137 FLSPGPSMATVKQTKNYPDDLSTVNNTIVDETIGDERKDHPH------------HERHRS 184

Query: 175 SILALKQNLYESSSGVPLYDSQPSSEVPSELHSPSTRSFERQKSVSIDIPQDNSNK 230
           SI+ALK+ L E+S+      + PS    S +HS S     +  S+ I I Q  S K
Sbjct: 185 SIIALKKTLLENSAT-----ASPSPTRSSSIHSTSLLPLSKAGSIDIPIKQTYSKK 235

>ADR194C Chr4 complement(1039625..1041538) [1914 bp, 637 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR422C
           (SIP1)
          Length = 637

 Score =  194 bits (493), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 131/370 (35%), Positives = 183/370 (49%), Gaps = 39/370 (10%)

Query: 388 DLGSENVRVFLKWRDLIDDIENANISIVSNEILSVICMNDLDSENSDSARMVYYPDTSEW 447
           D  +E V V +KWRD + D +   +SIVS +I SVI  N     +     MV+  D   W
Sbjct: 300 DAEAEFVEVIIKWRDCLLDPQRTKLSIVSPDIASVIHKN-----SKRKVAMVFSKDEQFW 354

Query: 448 VTKYLFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEVPRGYESIEPFRD---N 504
           V   L LPPGIYKLQF +NG+LRHS++LPTATD+  NIVNWFEV   Y+  EP+RD    
Sbjct: 355 VAPDLRLPPGIYKLQFLINGALRHSNFLPTATDSHSNIVNWFEVVPWYDRAEPYRDPAPE 414

Query: 505 DYVKNEISGGILQPIPNTLGIPXXXXXXXXXXXXXXRPTTPYSDFAGINRS-SPLPLREK 563
           +      S  +  P      +               R  TP SD+ GI+RS S  PL   
Sbjct: 415 EVAMPPESPQLTAPAAGRPPLLKRGTSSSSRARVVERSNTPISDYTGISRSGSARPLLAH 474

Query: 564 SPDVKSTNFDLEFSTAVPEPKYDYTTEIPEIYKAVXXXXXXXXXXXXXXXXXXXXXPPLY 623
               KS N  +E S  +P     Y+TEIPE++K                       PP  
Sbjct: 475 H---KSAN-SIELS-PIPRCVLQYSTEIPELFKP-------------------EGCPP-D 509

Query: 624 LGTGGNSIFNDVIGCSQRDLFEKLSKNTGKGLNTDELEKIFLAKYPITDLPIYLNTDYMN 683
             T   S   ++  C+Q +LF  L ++    ++  E E++ + KYP+ DLP+YLN+ Y+N
Sbjct: 510 PNTAPGSFNENIQDCNQDELFRFLQEDW--KMSAQEAEEVLVEKYPVPDLPVYLNSSYLN 567

Query: 684 KALEQHRNIVGVDDVMQEEXXXXXXXXXXXXXXXLLTHNIQDSVIAVACTVRYGGKFITQ 743
           +   + +      DV +                 LLT +I+D +I+V CT RY GKFITQ
Sbjct: 568 EIFTKLQRSSVTGDVKR---SSFTHIIPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQ 624

Query: 744 VVYSPCSVEN 753
           ++Y+PC  E+
Sbjct: 625 IMYAPCYYES 634

 Score = 40.0 bits (92), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 66/162 (40%), Gaps = 30/162 (18%)

Query: 25  GSNSLNDDALFKQRQGSIRSELFTSRNNSNRNKIYSELAARXXXXXXXXXXXXVKESLFK 84
           G++    D+  + RQ SI S+LF+ R+++ R+K   + A                 S+FK
Sbjct: 26  GASQWETDSTDRGRQQSITSQLFSGRHHA-RSKWKFQGAGDSATGSSGGIA-----SMFK 79

Query: 85  KDYSMGRHPNTVNHVKNRVDFTRXXXXXXXXXXXXXXXXXAYTPSFFSLGPSTATVEQST 144
            DY++     +++  +                        A T    S GPSTATVE   
Sbjct: 80  CDYTLNADARSISSEQGET--------CQGMPNLAGLVLDACTQGIRSPGPSTATVE--- 128

Query: 145 EKVIRLDEQHHPHQNL-ASKKDIVINHEHRPSILALKQNLYE 185
                       H NL AS    + +  HRPSI ALKQ+L +
Sbjct: 129 ------------HTNLEASMSPELASQTHRPSISALKQSLIQ 158

>TBLA0D01650 Chr4 (406397..409447) [3051 bp, 1016 aa] {ON} Anc_5.527
            YDR422C
          Length = 1016

 Score =  190 bits (483), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 138/398 (34%), Positives = 205/398 (51%), Gaps = 27/398 (6%)

Query: 363  TQFSSLASKQISYRNSSAFSSTFSLDL--GSENVRVFLKWRDLIDD--IENANISIVSNE 418
            ++  SL  +  S  + S  +S FS D    +E   V +K+RD +++  I    I ++S +
Sbjct: 629  SRIGSLKDQLDSPSDLSKVTSYFSTDTESAAELQNVIIKYRDPMEESEIPETKIQLISKD 688

Query: 419  ILSVICMN--DLDSENSDSARMVYYPDTSEWVTKYLFLPPGIYKLQFNVNGSLRHSDYLP 476
            I + +  +  DL +EN +   +VY  D   W+   L LPPGIY++QF VN  L+HSD+LP
Sbjct: 689  INTTLHYDTTDLLTEN-NKMELVYNKDEKAWILPNLMLPPGIYQVQFLVNSDLKHSDFLP 747

Query: 477  TATDNLGNIVNWFEVPRGYESIEPFRDNDYVKNEISGGILQPIPNTLGIPXXXXXXXXXX 536
            TATD+ GNIVNWFEV  GY+ IEPFRD +    + S G L  + N +             
Sbjct: 748  TATDDFGNIVNWFEVLSGYDFIEPFRDENISSADNSDGTL--MQNIIPEKLKTISMTKMA 805

Query: 537  XXXXRPTTPYSDFAGINRSSPLPLREKSPDVKSTNFDLEFSTAVPEPKYDYTTEIPEIYK 596
                + +TP S++ G++RS+ L     S   KS N +L F+   P  K +Y+TEIPEI+K
Sbjct: 806  GNGSKGSTPRSNYTGVSRSNSLSASSSSSVWKSVNVNL-FTPLEPN-KVEYSTEIPEIFK 863

Query: 597  AVXXXXXXXXXXXXXXXXXXXXXPPLYLGTGGNSIFNDVIGCSQRDLFEKLSKNTGKGL- 655
                                    P     G   + ++V+ CSQ +LF  L      GL 
Sbjct: 864  NTTENNTSNAPMQYH---------PERKRPG---LLHNVVDCSQEELFGDL---LADGLM 908

Query: 656  NTDELEKIFLAKYPITDLPIYLNTDYMNKALEQHRNIVGVDDVMQEEXXXXXXXXXXXXX 715
            +T+  E++FL KYP+ +LPIYLN+ YM + + +     G                     
Sbjct: 909  DTETAEQMFLDKYPVPELPIYLNSKYMTQIVGEINQPSGSGPPSSLNNNDLNHIIPHVNL 968

Query: 716  XXLLTHNIQDSVIAVACTVRYGGKFITQVVYSPCSVEN 753
              LLT +I++ +I+VACT RY GKF+TQ++Y+PC  EN
Sbjct: 969  QHLLTSSIREEMISVACTTRYEGKFLTQILYTPCFYEN 1006

>KLTH0G03762g Chr7 complement(297935..300064) [2130 bp, 709 aa] {ON}
           similar to uniprot|P32578 Saccharomyces cerevisiae
           YDR422C SIP1 Alternate beta-subunit of the Snf1p kinase
           complex may confer substrate specificity vacuolar
           protein containing KIS (Kinase-Interacting Sequence) and
           ASC (Association with Snf1 kinase Complex) domains
           involved in protein interactions
          Length = 709

 Score =  187 bits (474), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 127/371 (34%), Positives = 179/371 (48%), Gaps = 38/371 (10%)

Query: 396 VFLKWRDLIDDIENANISIVSNEILSVICMNDLDSENSDSARMVYYPDTSEWVTKYLFLP 455
           V L W+D I D +   +SIVS +I S +  +   S+      MV+  + + W    L+LP
Sbjct: 363 VILNWKDNIVDPKTCKMSIVSKDISSTLNPHKKFSK----IPMVFDMERNCWTAHDLYLP 418

Query: 456 PGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEVPRGYESIEPFRD----NDYVKNEI 511
            G+YK QF +NG LRHSDYLPTATD+ GN VNWFEV  G++SIEP RD     D   ++ 
Sbjct: 419 SGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSRDVISSEDVKLSKD 478

Query: 512 SGGILQPIPNTLGIPX---XXXXXXXXXXXXXRPTTPYSDFAGINRSSPLPLREKSPDVK 568
              + QP P    +                  R  TP+SD+ G+   S L      P+++
Sbjct: 479 QIAVEQPAPERPALGSDGSSSSNWKGSSRHVERSGTPFSDYTGLCSRSEL----TKPELR 534

Query: 569 STN---FDLEFSTAVPEPKYDYTTEIPEIYKA-VXXXXXXXXXXXXXXXXXXXXXPPLYL 624
             N   +DL     VP PKY+YT EIPE++KA                       PP +L
Sbjct: 535 HNNTSSYDL--LAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELTKDGSQKPPSFL 592

Query: 625 GTGGNSIFNDVIGCSQRDLFEKLSKNTGKGLNTDELEKIFLAKYPITDLPIYLNTDYMNK 684
                   + V  C+Q  LF  L +N    +++   E+ FL +YP  DLP+YL++ ++N 
Sbjct: 593 --------HRVQDCNQDVLFADLQQN--GQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNA 642

Query: 685 ALEQHRNIVGVDDVMQEEXXXXXXXXXXXXXXXLLTHNIQDSVIAVACTVRYGGKFITQV 744
                    G  D   +                LLT +I+D +I+V CT RY GKFITQ+
Sbjct: 643 VFS------GFQD-KTDSKTRVNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQI 695

Query: 745 VYSPCSVENDD 755
           +Y+PC   N D
Sbjct: 696 IYTPCYYSNKD 706

>KNAG0C03230 Chr3 (632659..634344) [1686 bp, 561 aa] {ON} Anc_5.527
           YDR422C
          Length = 561

 Score =  182 bits (462), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 132/395 (33%), Positives = 192/395 (48%), Gaps = 69/395 (17%)

Query: 383 STFSLDLGSENVRVFLKWRD-LIDDIENANISIVSNEILSVI--CMNDLDSENSDSARMV 439
           S FS D  +ENVRV LKWRD  +   +    +I S++I S +    ++L +   ++   +
Sbjct: 205 SNFS-DFENENVRVILKWRDPQLQPYQGTGAAIKSHDIYSTLRAIKSELITPERENKEDL 263

Query: 440 YYPD----TSEWVTKYLFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEVPRGY 495
            Y D      +W    L+LPPGIY+L+F +NG L HS++LPTATD  G IVNWFEV  GY
Sbjct: 264 LYLDYDAKKKDWFVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPGY 323

Query: 496 ESIEPFRDNDYVKNEISGGILQPIPNTLGIPXXXXXXXXXXXXXXRPTTPYSDFAGINRS 555
           E+IEP+RD   +  +      QP                      + TT  +D+AGI+RS
Sbjct: 324 ETIEPYRDESMIGQDDESIDSQP---------------------YKSTTDVTDYAGISRS 362

Query: 556 SPLPLRE-----KSPDVKSTNFDLEFSTAV---------------PEPKYDYTTEIPEIY 595
           S +  +      + P++  T+ + E S +V               PEPKY+Y+TEIPE++
Sbjct: 363 SSVVSKHSKSNLRLPNLHITSLNKESSASVNEANETNEGNDIQLLPEPKYEYSTEIPELF 422

Query: 596 KAVXXXXXXXXXXXXXXXXXXXXXPPLYLGTGGNSIFNDVIGCSQRDLFEKLSKNTGKGL 655
           +                         LY     +     V+  +Q  LF  + K  GK +
Sbjct: 423 Q--FDDVNTRKTNDIKEVRKESKLETLYPNGKFDFTLARVVNSNQDALFASIQK-IGK-M 478

Query: 656 NTDELEKIFLAKYPITDLPIYLNTDYMNKALEQHRNIVGVDDVMQEEXXXXXXXXXXXXX 715
            T+E E+ FL K+ ++DLPIYLN+ Y+NK      N +                      
Sbjct: 479 TTEEAEEYFLTKFKVSDLPIYLNSTYLNKNFSGEVNHI----------------IPHVNL 522

Query: 716 XXLLTHNIQDSVIAVACTVRYGGKFITQVVYSPCS 750
             LLT +I++ +I V CT RY GKFITQV+Y+PCS
Sbjct: 523 RHLLTTSIKEDIICVGCTTRYAGKFITQVIYAPCS 557

>CAGL0F03047g Chr6 complement(298906..301140) [2235 bp, 744 aa] {ON}
           similar to uniprot|P32578 Saccharomyces cerevisiae
           YDR422c SIP1 multicopy suppressor of SNF1
          Length = 744

 Score =  185 bits (469), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 123/399 (30%), Positives = 187/399 (46%), Gaps = 60/399 (15%)

Query: 396 VFLKWRDLIDDIENANISI--VSNEILSVICMND--------LDSENSDSAR--MVYYPD 443
           V LKWRD  +   N  + +  VSNEI + +  +D        L ++NS   +  + Y   
Sbjct: 352 VILKWRDSQNQSNNKELKVYLVSNEICASLKNDDKLFAEGKLLATDNSQFNKIPLSYDSH 411

Query: 444 TSEWVTKYLFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEVPRGYESIEPFRD 503
            +EW    L+LP GIY+LQF VNG+L HSD+LPTATD+ GNI+NWFEV RGY+ IEP+RD
Sbjct: 412 NNEWYVPDLYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVLRGYDRIEPYRD 471

Query: 504 NDYVKNEISGGIL-------------------------QPIPNTLGIPXXXXXXXX---- 534
              ++++ +  +                           P+   L  P            
Sbjct: 472 ESEIQSDYTSSVDTTLEGMENNGFQGSSDNSTTSMRNNNPVALNLQAPAPSKAQASRNSS 531

Query: 535 --XXXXXXRPTTPYSDFAGINRSSPLPLREKSP--DVKSTNFDLEFSTAVPEPKYDYTTE 590
                   +  T +SD+ G++R++ + +   SP  +  + + DLEF   +    Y+Y+  
Sbjct: 532 YYSAKSFEKSITQFSDYTGVSRTNSM-VSAVSPINNANTRDNDLEFFPPIKPKVYEYSNN 590

Query: 591 IPEIYKAVXXXXXXXXXXXXXXXXXXXXXPPLYLGTGGNSIFNDVIGCSQRDLFEKLSKN 650
           IP +++                        P        S  N V+ C+Q  LF  L K 
Sbjct: 591 IPALFRISCDMEDVDDDNGTENNPRAFYDRP--------SFTNRVVDCNQDALFGDLQK- 641

Query: 651 TGKGLNTDELEKIFLAKYPITDLPIYLNTDYMNKALEQHRNIVGVDDVMQEEXXXXXXXX 710
            G  ++ +E E +FL KY + DLP+YLN+ Y+NK   +   + G       +        
Sbjct: 642 -GGKMDAEEAENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQVAGP----STQDSSINHII 696

Query: 711 XXXXXXXLLTHNIQDSVIAVACTVRYGGKFITQVVYSPC 749
                  LLT +I+D +++VACT RY GKFITQV+Y+PC
Sbjct: 697 PHVNLKHLLTSSIRDGIVSVACTTRYAGKFITQVIYAPC 735

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%)

Query: 132 SLGPSTATVEQSTEKVIRLDEQHHPHQNLASKKDIVINHEHRPSILALKQNLYE 185
           S GPS ATV+    +V   DE      +  + +      EHRPSI+ALK +L E
Sbjct: 47  SPGPSNATVQTIKREVTHGDESPQGDSDDINAQHSRAMSEHRPSIVALKMSLKE 100

>Kwal_47.18642 s47 (908641..909570) [930 bp, 309 aa] {ON} YDR422C
           (SIP1) - SNF1 protein kinase substrate [contig 191]
           PARTIAL
          Length = 309

 Score =  172 bits (435), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 113/338 (33%), Positives = 167/338 (49%), Gaps = 52/338 (15%)

Query: 438 MVYYPDTSEWVTKYLFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEVPRGYES 497
           MV+  +++ W+   L+LP G+YK QF +NG LRHS++LPTATD+ GN VNWFEV  G++ 
Sbjct: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKV 60

Query: 498 IEPFRD---NDYVKNEISGGI----LQPIPNTLGIPXXXXXXXXXXXXXXRPTTPYSDFA 550
           IEP RD   ND+ +N+++         P P  L                 R  TPYSD+ 
Sbjct: 61  IEPSRDVISNDFTENQVAISANDPSASPRPPILSGSSSFSNWKNSAKHIERSGTPYSDYT 120

Query: 551 GINRSSPLP---LREKSPDVKSTNFDLEFSTAVPEPKYDYTTEIPEIYKAVXXXXXXXXX 607
           G+   + L    LR K+    ++++DL     VP P Y+Y+ EIPE++KA          
Sbjct: 121 GLCSRTDLAKPELRHKN----TSSYDL--LAPVPRPVYEYSNEIPELFKA---------- 164

Query: 608 XXXXXXXXXXXXPPLYLGTGGN--------SIFNDVIGCSQRDLFEKLSKNTGKGLNTDE 659
                       PP Y  +  +        S  + V  C+Q  LF  L KN    +++  
Sbjct: 165 -----NFEGSSTPPPYQESVPSQNPVKNQPSFLHRVQDCNQDVLFADLQKN--GEIDSQA 217

Query: 660 LEKIFLAKYPITDLPIYLNTDYMNKALE--QHRNIVGVDDVMQEEXXXXXXXXXXXXXXX 717
            E+ FL +YP  DLP+YL++ ++N      Q +N         +                
Sbjct: 218 AEEAFLQQYPTPDLPVYLDSSFLNAVFRGFQEKN---------DTKSKLNHIVPHVNLNH 268

Query: 718 LLTHNIQDSVIAVACTVRYGGKFITQVVYSPCSVENDD 755
           LLT +I+D +I+V CT RY GKFITQ++Y+PC   N +
Sbjct: 269 LLTSSIRDEIISVGCTTRYEGKFITQIIYTPCYYGNKE 306

>Ecym_4065 Chr4 (144003..146168) [2166 bp, 721 aa] {ON} similar to
           Ashbya gossypii ADR194C
          Length = 721

 Score =  174 bits (440), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 131/379 (34%), Positives = 189/379 (49%), Gaps = 36/379 (9%)

Query: 392 ENVRVFLKWRDLIDDIENANISIVSNEILSVICMNDLDSENSDSARMVYYPDTSEWVTKY 451
           E V+V +KWRD   D   + ISI+S++I SV+      +       MVY      W  + 
Sbjct: 360 ERVQVIIKWRDTNVDPRTSKISIISSDIASVV----QPTRKRKKIPMVYLEQEQCWAAED 415

Query: 452 LFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEVPRGYESIEPFRDNDYVK--N 509
           L LP GIYKL F +NG +RHS+YLPTATD+L NIVNWFEV  GY+ IEP+RD    +  N
Sbjct: 416 LKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFEVVPGYDQIEPYRDAAIERSPN 475

Query: 510 EISG----GIL----QPIPNTLGIPX--XXXXXXXXXXXXXRPTTPYSDFAGI----NRS 555
           E++      +L     P P  +  P                R  TP SD+ G+    + S
Sbjct: 476 ELAAYNETSLLLTNETPSPANIRPPLINRGTSSSSRARVIERTNTPISDYTGVLARNSCS 535

Query: 556 SPLPLREKSPDVKSTNFDLEFSTAVP-EPKYDYTTEIPEIYKAVXXXXXXXXXXXXXXXX 614
           +P   R KS +  ST+ D+     +P +P   Y++++PE++K                  
Sbjct: 536 NPAIYRHKSNN--STDVDI-----LPKQPTLIYSSDVPELFKV---GNASTGGSQQGSDK 585

Query: 615 XXXXXPPLYLGTGGNSIFNDVIGCSQRDLFEKLSKNTGKGLNTDELEKIFLAKYPITDLP 674
                P  YL    N    +V  C+Q +LF  L +     +N  E E++FL KY + DLP
Sbjct: 586 NKLQNPSKYLQDSPN-FMKNVQDCNQDELFHYLQEKW--NMNAQEAEEVFLEKYSVPDLP 642

Query: 675 IYLNTDYMNKALEQHRNIVGVDDVMQEEXXXXXXXXXXXXXXXLLTHNIQDSVIAVACTV 734
           IYLN+  +N+   + +    + D+ + +               LLT NI+D +I+V CT 
Sbjct: 643 IYLNSTSLNEIFNKLQQNSAMGDLPKRK--SLTHIIPHVNLNHLLTSNIRDEIISVGCTT 700

Query: 735 RYGGKFITQVVYSPCSVEN 753
           RY GKFITQ++Y+PC  EN
Sbjct: 701 RYEGKFITQIMYAPCYYEN 719

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 79/194 (40%), Gaps = 30/194 (15%)

Query: 38  RQGSIRSELFTSRNNSNRNKIYSELAARXXXXXXXXXXXXVKESLFKKDYSMGRHPNTVN 97
           RQ SI S+LF  R+ + R+K  S+   R            V + LFK+DYS+    + V 
Sbjct: 50  RQQSITSQLFPGRHQA-RSKWKSQ---RNVAPGAVSGVGGV-DHLFKRDYSLSDDSSAVG 104

Query: 98  ----HVKNRVDFTRXXXXXXXXXXXXXXXXXAYTPSFFSLGPSTATVEQSTEKVIRLDEQ 153
                 +  VD                    +   +  S GPS+ATVE S     +L+  
Sbjct: 105 MEGVQEEGGVDLI-------GMPNVAGLKLDSRAQAIMSPGPSSATVEHS-----KLEAS 152

Query: 154 HHPHQNLASKKDIVINHEHRPSILALKQNLYESSSGVPLYDSQPSSEVPSELHSPSTRSF 213
             P   LA++        HRPSI+ALKQNL +   G PL+          +    +  S 
Sbjct: 153 ISPE--LAAQV-------HRPSIVALKQNLIQGHMGHPLHSPLRDDYDGDDDDGDTAPSS 203

Query: 214 ERQKSVSIDIPQDN 227
               S +IDIP  N
Sbjct: 204 SYVPSATIDIPYSN 217

>KAFR0E03300 Chr5 (654349..655749) [1401 bp, 466 aa] {ON} Anc_5.527
           YDR422C
          Length = 466

 Score =  156 bits (394), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 121/375 (32%), Positives = 171/375 (45%), Gaps = 91/375 (24%)

Query: 397 FLKWRDLIDDIENANISIVSNEILSVICMNDLDSENSD---------SARMVYYPDTSEW 447
            LKWR+ ID   N+ ++IVS +I+S +       ++S             ++Y   T+EW
Sbjct: 157 ILKWREPID--HNSAVAIVSKDIVSTLLTIAKTHKSSIITFIERKKFKINLLYDIVTNEW 214

Query: 448 VTKYLFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEVPRGYESIEPFRDNDYV 507
               LFLPPGIYKLQF +NG+L HS+YLPTAT+  GNIVNWFEV  GY++IEP+RD + +
Sbjct: 215 YLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVICGYKTIEPYRDEERI 274

Query: 508 KNEISGGILQPIPNTLGIPXXXXXXXXXXXXXXRPTTPYSDFAGINR---SSPLPLREKS 564
            +       + I                       +   +D+AGI+R            S
Sbjct: 275 IHREKSTANESI----------------------SSNSLTDYAGISRSSSIVSNKSSLIS 312

Query: 565 PDVKSTNFDLEFSTAVPEPKYDYTTEIPEIYKAVXXXXXXXXXXXXXXXXXXXXXPPLYL 624
             +K TN +L       + +  YT EIPEI+K                            
Sbjct: 313 SSLKLTNLNLN------DDEIKYTNEIPEIFK---------------------------F 339

Query: 625 GTGGNSIFND---------VIGCSQRDLFEKLSKNTGKGLNTDELEKIFLAKYPITDLPI 675
            +  NS  N+         VI  +Q  +F  L K     +NTDE E  FL ++ I DLPI
Sbjct: 340 DSTANSNVNNQAFDMSLSKVIDLNQDHVFASLQK--IARMNTDEAENYFLNRFKIHDLPI 397

Query: 676 YLNTDYMNKALEQHRNIVGVDDVMQEEXXXXXXXXXXXXXXXLLTHNIQDSVIAVACTVR 735
           YLN++++NK             +                   LLT +I+D  + VACT R
Sbjct: 398 YLNSNFLNKIF-----------IRDNNNETTNNTVPHVNLNHLLTTSIKDDTLCVACTTR 446

Query: 736 YGGKFITQVVYSPCS 750
           Y GKFITQ++Y+P S
Sbjct: 447 YVGKFITQIMYAPSS 461

>Kpol_1023.98 s1023 (229891..231894) [2004 bp, 667 aa] {ON}
           (229891..231894) [2004 nt, 668 aa]
          Length = 667

 Score =  122 bits (307), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 98/365 (26%), Positives = 168/365 (46%), Gaps = 21/365 (5%)

Query: 394 VRVFLKWRD-LIDDIENANISIVSNEILSVICMNDLDSENSDSARMVYYPDTSEWVTKYL 452
           V V L+WRD  I +    ++SI+S +IL+ +   +       +  M Y  + + WV   L
Sbjct: 310 VNVVLRWRDSYIQNETCKSVSIISEDILTSVQAQNSGVLLISNFSMTYDKNENNWVLPDL 369

Query: 453 FLPPGIYKLQFNVNG-SLRHSDYLPTATDNLGNIVNWFEVPRGYESIEPFRDNDYVKNEI 511
           FLPPG Y+L+F ++    R+S+YLP   D LG I+N  E+  GY+S+EPF  N+++   I
Sbjct: 370 FLPPGKYRLRFLIDHHDFRYSNYLPVTEDELGTIINEIEILPGYKSVEPFEHNNHIM--I 427

Query: 512 SGGILQ---PIPNTLGIPXXXXXXXXXXXXXXRPT-TPYSDFAGINRSSPLPLREKSPDV 567
              I+     + N+  +                P  +  S+    N        +++  +
Sbjct: 428 QENIINSELSLNNSRQLQSEPPSYPELEENFSSPIESIISEDELDNDQYSKVYGKRNNSI 487

Query: 568 KSTNFDLEFSTAVPEPKYDYTTEIPEIYKAVXXXXXXXXXXXXXXXXXXXXXPPLYLGTG 627
             +   L     + E  Y  T EIP+++K                       PP Y   G
Sbjct: 488 GQSKTSLSIKPCISEVTY--TNEIPQLFKIT----DNNCIVNENYERYGFVEPPSY---G 538

Query: 628 GNSIFNDVIGCSQRDLFEKLSKNTGKGLNTDELEKIFLAKYPITDLPIYLNTDYMNKALE 687
              + N VI C+Q  LF    +N    ++ +  E++FL KYP+ DLP++L++ +  K  +
Sbjct: 539 EPGLENRVIDCNQDILFATFQQN--GAVDVELAEQLFLEKYPVPDLPVFLDSHFSEKLFD 596

Query: 688 QHRNIVGVDDVMQEEXXXXXXXXX--XXXXXXLLTHNIQDSVIAVACTVRYGGKFITQVV 745
            + +   ++D+  E+                 +LT+ I + +I+VACT RY  KF+T ++
Sbjct: 597 NNDSSKNLNDMNGEDIQIKNNGQDIPHVNLNHVLTNKISNGMISVACTTRYKRKFVTHIL 656

Query: 746 YSPCS 750
           YSP +
Sbjct: 657 YSPST 661

>TPHA0K00530 Chr11 (105141..107081) [1941 bp, 646 aa] {ON} Anc_5.527
           YDR422C
          Length = 646

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 75/172 (43%), Gaps = 19/172 (11%)

Query: 587 YTTEIPEIYKAVXXXXXXXXXXXXXXXXXXXXXPPLYLGTGGNSIFNDVIGCSQRDLFEK 646
           YT +IPE++K                       PP Y   G  S +N+++ CSQ  LF  
Sbjct: 482 YTNQIPELFK----FSEKNIRELSTETEITFLEPPSY---GEPSFYNNIVDCSQEKLFLS 534

Query: 647 LSKNTGKGLNTDELEKIFLAKYPITDLPIYLNTDYMNKALEQHRNIVGVDDVMQ------ 700
           L +N    +++   E++ L +YP+++LPI+     M K L  H N +      +      
Sbjct: 535 LQQN--GAVDSYVAEQVILQRYPVSELPIFFENISMEK-LASHNNNLNKSHTNKHWLEGL 591

Query: 701 ---EEXXXXXXXXXXXXXXXLLTHNIQDSVIAVACTVRYGGKFITQVVYSPC 749
              E                L+T  I  +V++VA T RY  K+ITQ++YSP 
Sbjct: 592 TPNESDNITPKEPPHVILNHLVTQKISRNVVSVAVTTRYKQKYITQILYSPI 643

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 58/113 (51%), Gaps = 2/113 (1%)

Query: 392 ENVRVFLKWRDLIDDIEN-ANISIVSNEILSVICMNDLDSENSDSARMVYYPDTSEWVTK 450
           +  RV L+W D      N  ++SI+S +I+ VI     +++      + Y   T EW   
Sbjct: 310 QKTRVTLRWIDSKFKPNNYQSVSIISEDIIDVINFYRSNNDKIKRLPLKYDSLTHEWKIS 369

Query: 451 YLFLPPGIYKLQFNVNGS-LRHSDYLPTATDNLGNIVNWFEVPRGYESIEPFR 502
            LFLP G Y+  F +N + + HS ++ T  D  G  VN+FEVP+   + EP +
Sbjct: 370 DLFLPAGYYEFSFLINETDVHHSLHICTKMDRFGKRVNYFEVPKYVRTFEPLQ 422

>CAGL0A03696g Chr1 (377255..378502) [1248 bp, 415 aa] {ON} similar
           to uniprot|Q04739 Saccharomyces cerevisiae YER027c GAL83
           glucose repression protein
          Length = 415

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 68/165 (41%), Gaps = 45/165 (27%)

Query: 438 MVYYPDTSEWVTKYLFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEVPRGYES 497
           +V  PD    +   L LPPG ++ +F V+  LR SD+LPTATD +GN VN+ E+      
Sbjct: 188 LVPMPDQPNVLHVKLQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIA----- 242

Query: 498 IEPFRDNDYVKNEISGGILQPIPNTLGIPXXXXXXXXXXXXXXRPTTPYSDFAGINRSSP 557
                        ++G   +P P T  +                     S  +G  R  P
Sbjct: 243 ------------PVAGTDEKPPPLTPQV---------------------SGKSGDERKEP 269

Query: 558 LPLR-------EKSPDVKSTNFDLEFSTAVPEPKYDYTTEIPEIY 595
           +  R       E+ PD     +     T+  E KY+YT +IP ++
Sbjct: 270 MSARSRIALEIEREPDDLGNGYSRFHDTSPLETKYEYTQDIPAVF 314

 Score = 35.0 bits (79), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 22/32 (68%)

Query: 718 LLTHNIQDSVIAVACTVRYGGKFITQVVYSPC 749
           L T +I+ + + VA  VRY  K++TQ++Y+P 
Sbjct: 383 LATSSIKHNTLCVASIVRYKRKYVTQILYAPL 414

>ZYRO0E08404g Chr5 complement(672301..673347) [1047 bp, 348 aa] {ON}
           some similarities with uniprot|Q04739 Saccharomyces
           cerevisiae YER027C GAL83 One of three possible beta-
           subunits of the Snf1 kinase complex allows nuclear
           localization of the Snf1 kinase complex in the presence
           of a nonfermentable carbon source contains
           glycogen-binding domain and some similarities with
           YGL208W uniprot|P34164 Saccharomyces cerevisiae YGL208W
           SIP2 Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation
          Length = 348

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%)

Query: 438 MVYYPDTSEWVTKYLFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEVPRG 494
           +V  PD    +   L LP G ++ +F V+  LR SDYLPTATD +GN VN+ E+ RG
Sbjct: 141 LVPVPDQPGLLHAKLQLPIGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEIGRG 197

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 22/32 (68%)

Query: 718 LLTHNIQDSVIAVACTVRYGGKFITQVVYSPC 749
           L T +I+ + + VA  VRY  K++TQ++Y+P 
Sbjct: 316 LATSSIKHNTLCVASIVRYKRKYVTQILYAPL 347

>KAFR0I02380 Chr9 (482219..483448) [1230 bp, 409 aa] {ON} Anc_3.517
           YER027C
          Length = 409

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 66/153 (43%), Gaps = 31/153 (20%)

Query: 452 LFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEVPRGYESIEPFRDNDYVKNEI 511
           L LPPG ++ +F V+  LR SDYLPTATD +GN VN+ EV      I P         E+
Sbjct: 178 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEV------IAP-------ATEV 224

Query: 512 SGGILQPIPNTLGIPXXXXXXXXXXXXXXRPTTPYSDFAGIN-RSSPLPLR-------EK 563
           +G    P   T G                +        A I   + PL  R       E+
Sbjct: 225 TGA---PTTTTFGTWDSSAQSQQAQQQNLQQNE-----ASIKVENQPLSARSRIALQIER 276

Query: 564 SPDVKSTNFDLEFSTAVPE-PKYDYTTEIPEIY 595
            PD     F   F   +P+ P+YDYT +IP ++
Sbjct: 277 EPDEMGDGFS-RFHDEMPQKPQYDYTQDIPAVF 308

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 22/32 (68%)

Query: 718 LLTHNIQDSVIAVACTVRYGGKFITQVVYSPC 749
           L T +I+ + + VA  VRY  K++TQ++Y+P 
Sbjct: 377 LATSSIKHNTLCVASIVRYRQKYVTQILYAPL 408

>NCAS0F03730 Chr6 complement(750798..752096) [1299 bp, 432 aa] {ON}
           Anc_3.517 YER027C
          Length = 432

 Score = 57.0 bits (136), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (64%)

Query: 438 MVYYPDTSEWVTKYLFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEV 491
           +V  PD    +   L LPPG ++ +F V+  LR SDYLPTATD +GN VN+ E+
Sbjct: 193 LVPMPDQPNILHVKLQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEI 246

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 22/32 (68%)

Query: 718 LLTHNIQDSVIAVACTVRYGGKFITQVVYSPC 749
           L T +I+ + + VA  VRY  K++TQ++Y+P 
Sbjct: 400 LATSSIKHNTLCVASIVRYKRKYVTQILYAPL 431

>KAFR0F04140 Chr6 complement(814903..815949) [1047 bp, 348 aa] {ON}
           Anc_3.517 YER027C
          Length = 348

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 3/63 (4%)

Query: 438 MVYYPDTSEWVTKYLFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEV---PRG 494
           +V +P   +W    L LPPG ++ +F V+  LR SD +P+ATD++GN+VN+ EV    R 
Sbjct: 134 LVEHPTNPDWARVRLKLPPGNHRFRFVVDNELRFSDDVPSATDSMGNLVNYIEVKPSKRQ 193

Query: 495 YES 497
           YES
Sbjct: 194 YES 196

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 24/32 (75%)

Query: 718 LLTHNIQDSVIAVACTVRYGGKFITQVVYSPC 749
           L+ ++++ +++A++ T RY  KFITQV YSP 
Sbjct: 316 LIVNSVKSNMLAISTTTRYKEKFITQVCYSPI 347

>KNAG0E01590 Chr5 complement(317054..318325) [1272 bp, 423 aa] {ON}
           Anc_3.517 YER027C
          Length = 423

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/40 (62%), Positives = 30/40 (75%)

Query: 452 LFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEV 491
           L LPPG +K +F V+  LR SDYLPTATD +GN VN+ EV
Sbjct: 192 LQLPPGTHKFRFIVDNELRFSDYLPTATDQMGNFVNYLEV 231

>TBLA0I03270 Chr9 complement(793849..795150) [1302 bp, 433 aa] {ON}
           Anc_3.517 YER027C
          Length = 433

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (64%)

Query: 438 MVYYPDTSEWVTKYLFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEV 491
           +V  PD    +   L LPPG ++ +F V+  LR SD+LPTATD +GN VN+ EV
Sbjct: 188 LVPVPDQPGLLHVKLQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEV 241

 Score = 35.0 bits (79), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 22/32 (68%)

Query: 718 LLTHNIQDSVIAVACTVRYGGKFITQVVYSPC 749
           L T +I+ + + VA  VRY  K++TQ++Y+P 
Sbjct: 401 LATSSIKHNTLCVASIVRYKSKYVTQILYAPL 432

>Ecym_1210 Chr1 (423627..424979) [1353 bp, 450 aa] {ON} similar to
           Ashbya gossypii AER361C
          Length = 450

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 38/61 (62%), Gaps = 2/61 (3%)

Query: 452 LFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEVPRGYESIE--PFRDNDYVKN 509
           L LPPG ++ +F V+  LR SD+LPTATD +GN VN+ E+     S E  P  D  YV +
Sbjct: 217 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYMEIVASPPSQEQQPASDLQYVSD 276

Query: 510 E 510
           E
Sbjct: 277 E 277

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 21/32 (65%)

Query: 718 LLTHNIQDSVIAVACTVRYGGKFITQVVYSPC 749
           L T +I+ + + VA  VRY  K+ TQ++Y+P 
Sbjct: 418 LATSSIKHNTLCVASIVRYKSKYATQILYAPL 449

>TPHA0A05810 Chr1 complement(1317530..1318804) [1275 bp, 424 aa]
           {ON} Anc_3.517 YER027C
          Length = 424

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/45 (57%), Positives = 33/45 (73%), Gaps = 1/45 (2%)

Query: 452 LFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFE-VPRGY 495
           L LPPG +K +F V+  LR SD+LPTATD +GN VN+ E VPR +
Sbjct: 183 LQLPPGTHKFRFIVDNELRFSDFLPTATDQMGNFVNYLEAVPRTH 227

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 22/32 (68%)

Query: 718 LLTHNIQDSVIAVACTVRYGGKFITQVVYSPC 749
           L T +I+ + + VA  VRY  K++TQ++Y+P 
Sbjct: 392 LATSSIKHNTLCVASIVRYKRKYVTQILYAPL 423

>Smik_5.150 Chr5 complement(213879..215132) [1254 bp, 417 aa] {ON}
           YER027C (REAL)
          Length = 417

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%)

Query: 452 LFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEV 491
           L LPPG ++ +F V+  LR SDYLPTATD +GN VN+ EV
Sbjct: 204 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEV 243

 Score = 34.7 bits (78), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 22/32 (68%)

Query: 718 LLTHNIQDSVIAVACTVRYGGKFITQVVYSPC 749
           L T +I+ + + VA  VRY  K++TQ++Y+P 
Sbjct: 385 LATSSIKHNTLCVASIVRYKQKYVTQILYTPL 416

>Kwal_47.19040 s47 complement(1073036..1074325) [1290 bp, 429 aa]
           {ON} YER027C (GAL83) - glucose repression protein, a
           component of the Snf1 complex [contig 188] FULL
          Length = 429

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 34/54 (62%)

Query: 438 MVYYPDTSEWVTKYLFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEV 491
           +V  PD        L LPPG ++ +F V+  LR SD+LPTATD +GN VN+ E+
Sbjct: 154 LVPVPDQPGLFHIKLQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEI 207

 Score = 35.0 bits (79), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 21/32 (65%)

Query: 718 LLTHNIQDSVIAVACTVRYGGKFITQVVYSPC 749
           L T +I+ S + VA  VRY  K+ TQ++YSP 
Sbjct: 397 LATSSIKHSTLCVASIVRYKRKYATQILYSPL 428

>Skud_5.136 Chr5 complement(206871..208127) [1257 bp, 418 aa] {ON}
           YER027C (REAL)
          Length = 418

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%)

Query: 452 LFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEV 491
           L LPPG ++ +F V+  LR SDYLPTATD +GN VN+ EV
Sbjct: 205 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEV 244

 Score = 34.7 bits (78), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 22/32 (68%)

Query: 718 LLTHNIQDSVIAVACTVRYGGKFITQVVYSPC 749
           L T +I+ + + VA  VRY  K++TQ++Y+P 
Sbjct: 386 LATSSIKHNTLCVASIVRYKQKYVTQILYTPL 417

>Suva_5.123 Chr5 complement(184865..186136) [1272 bp, 423 aa] {ON}
           YER027C (REAL)
          Length = 423

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%)

Query: 452 LFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEV 491
           L LPPG ++ +F V+  LR SDYLPTATD +GN VN+ EV
Sbjct: 207 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEV 246

 Score = 34.7 bits (78), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 22/32 (68%)

Query: 718 LLTHNIQDSVIAVACTVRYGGKFITQVVYSPC 749
           L T +I+ + + VA  VRY  K++TQ++Y+P 
Sbjct: 391 LATSSIKHNTLCVASIVRYKQKYVTQILYTPL 422

>YER027C Chr5 complement(208979..210232) [1254 bp, 417 aa] {ON}
           GAL83One of three possible beta-subunits of the Snf1
           kinase complex, allows nuclear localization of the Snf1
           kinase complex in the presence of a nonfermentable
           carbon source; contains glycogen-binding domain
          Length = 417

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%)

Query: 452 LFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEV 491
           L LPPG ++ +F V+  LR SDYLPTATD +GN VN+ EV
Sbjct: 204 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEV 243

 Score = 34.7 bits (78), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 22/32 (68%)

Query: 718 LLTHNIQDSVIAVACTVRYGGKFITQVVYSPC 749
           L T +I+ + + VA  VRY  K++TQ++Y+P 
Sbjct: 385 LATSSIKHNTLCVASIVRYKQKYVTQILYTPL 416

>SAKL0F02002g Chr6 (167591..169102) [1512 bp, 503 aa] {ON} similar
           to gnl|GLV|CAGL0A03696g Candida glabrata CAGL0A03696g
           and similar to YER027C uniprot|Q04739 Saccharomyces
           cerevisiae YER027C GAL83 One of three possible
           beta-subunits of the Snf1 kinase complex allows nuclear
           localization of the Snf1 kinase complex in the presence
           of a nonfermentable carbon source contains
           glycogen-binding domain and similar to YGL208W
           uniprot|P34164 Saccharomyces cerevisiae YGL208W SIP2
           Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation
          Length = 503

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 30/40 (75%)

Query: 452 LFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEV 491
           L LPPG ++ +F V+  LR SDYLPTATD +GN VN+ E+
Sbjct: 253 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEI 292

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 21/32 (65%)

Query: 718 LLTHNIQDSVIAVACTVRYGGKFITQVVYSPC 749
           L T +I+ + + VA  VRY  K+ TQ++Y+P 
Sbjct: 471 LATSSIKHNTLCVASIVRYKSKYATQILYAPL 502

>NDAI0B06010 Chr2 complement(1460221..1461732) [1512 bp, 503 aa]
           {ON} Anc_3.517 YER027C
          Length = 503

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 30/40 (75%)

Query: 452 LFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEV 491
           L LPPG ++ +F V+  LR SDYLPTATD +GN VN+ E+
Sbjct: 251 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEI 290

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 22/32 (68%)

Query: 718 LLTHNIQDSVIAVACTVRYGGKFITQVVYSPC 749
           L T +I+ + + VA  VRY  K++TQ++Y+P 
Sbjct: 471 LATSSIKHNTLCVASIVRYKRKYVTQILYAPL 502

>KNAG0B00600 Chr2 (97910..99079) [1170 bp, 389 aa] {ON} Anc_3.517
           YER027C
          Length = 389

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%)

Query: 452 LFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEVPRGYESIEPFRD 503
           L LP G +K +F V+  LR SD+LPTATD  GN VN+ EV    E++E  +D
Sbjct: 193 LKLPVGTHKFRFVVDNELRFSDFLPTATDQTGNFVNYIEVKPSEETLELEKD 244

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 25/31 (80%)

Query: 718 LLTHNIQDSVIAVACTVRYGGKFITQVVYSP 748
           LLT +I+++++ + C+VRY  K++TQV Y+P
Sbjct: 357 LLTSSIKNNMLCLGCSVRYRQKYVTQVYYTP 387

>KLLA0B00583g Chr2 complement(44819..46279) [1461 bp, 486 aa] {ON}
           uniprot|Q00995 Kluyveromyces lactis FOG1 protein
          Length = 486

 Score = 54.3 bits (129), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%)

Query: 452 LFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEV 491
           L LPPG ++ +F V+  LR SD+LPTATD +GN VN+ E+
Sbjct: 241 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEI 280

>Kpol_195.2 s195 complement(4330..5637) [1308 bp, 435 aa] {ON}
           complement(4330..5637) [1308 nt, 436 aa]
          Length = 435

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 29/40 (72%)

Query: 452 LFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEV 491
           L LPPG +K +F V+  LR SD+LPTATD +GN VN+ E 
Sbjct: 178 LQLPPGTHKFRFIVDNELRFSDFLPTATDQMGNFVNYLEA 217

 Score = 34.7 bits (78), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 22/32 (68%)

Query: 718 LLTHNIQDSVIAVACTVRYGGKFITQVVYSPC 749
           L T +I+ + + VA  VRY  K++TQ++Y+P 
Sbjct: 403 LATSSIKHNTLCVASIVRYKRKYVTQILYAPL 434

>TDEL0D05850 Chr4 complement(1062927..1064141) [1215 bp, 404 aa]
           {ON} Anc_3.517 YER027C
          Length = 404

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 34/54 (62%)

Query: 438 MVYYPDTSEWVTKYLFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEV 491
           +V  P   + +   L LP G ++ +F V+  LR SDYLPTATD +GN VN+ EV
Sbjct: 173 LVPVPGHPDLLHVKLQLPVGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEV 226

 Score = 34.7 bits (78), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 22/32 (68%)

Query: 718 LLTHNIQDSVIAVACTVRYGGKFITQVVYSPC 749
           L T +I+ + + VA  VRY  K++TQ++Y+P 
Sbjct: 372 LATSSIKHNTLCVASIVRYKRKYVTQILYAPL 403

>KLTH0G01848g Chr7 (136780..138030) [1251 bp, 416 aa] {ON} similar
           to uniprot|P34164 Saccharomyces cerevisiae YGL208W SIP2
           Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation and similar to YER027C uniprot|Q04739
           Saccharomyces cerevisiae YER027C GAL83 One of three
           possible beta-subunits of the Snf1 kinase complex allows
           nuclear localization of the Snf1 kinase complex in the
           presence of a nonfermentable carbon source contains
           glycogen-binding domain
          Length = 416

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 29/40 (72%)

Query: 452 LFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEV 491
           L LPPG ++ +F V+  LR SDYL TATD +GN VN+ E+
Sbjct: 168 LQLPPGTHRFRFIVDNELRFSDYLATATDQMGNFVNYLEI 207

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%)

Query: 718 LLTHNIQDSVIAVACTVRYGGKFITQVVYSPC 749
           L T +I+ + + VA  VRY  K+ TQ++YSP 
Sbjct: 384 LATSSIKHNTLCVASIVRYKRKYATQILYSPL 415

>KNAG0B03690 Chr2 (708946..709926) [981 bp, 326 aa] {ON} Anc_5.527
           YDR422C
          Length = 326

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 35/59 (59%), Gaps = 1/59 (1%)

Query: 443 DTSEWVTKYLFLPPGIYKLQFNVNGSL-RHSDYLPTATDNLGNIVNWFEVPRGYESIEP 500
           D+SEWV   L+LPPG YK +F +N +   HS+YLP  T   G   N+F V    E +EP
Sbjct: 119 DSSEWVAPDLYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVIENDEVVEP 177

>NDAI0I02890 Chr9 complement(682274..684022) [1749 bp, 582 aa] {ON}
           Anc_3.517 YER027C
          Length = 582

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 28/40 (70%)

Query: 452 LFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEV 491
           L LP G ++ +F V+  LR SDYLPTATD  GN VN+ EV
Sbjct: 280 LQLPEGTHRFRFIVDNELRFSDYLPTATDQTGNFVNYLEV 319

>AER361C Chr5 complement(1307677..1309104) [1428 bp, 475 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER027C
           (GAL83) and YGL208W (SIP2)
          Length = 475

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 34/52 (65%), Gaps = 4/52 (7%)

Query: 452 LFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEV----PRGYESIE 499
           L LPPG ++ +F V+  LR SD+L TATD +GN VN+ E+    P G + I+
Sbjct: 236 LQLPPGTHRFRFIVDNELRFSDFLLTATDQMGNFVNYLEIVSPQPAGQQHIQ 287

>Smik_7.55 Chr7 (92235..93482) [1248 bp, 415 aa] {ON} YGL208W (REAL)
          Length = 415

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 29/40 (72%)

Query: 452 LFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEV 491
           L L PG ++ +F V+  LR SD+LPTATD +GN VN+ EV
Sbjct: 206 LRLLPGTHRFRFVVDNELRVSDFLPTATDQMGNFVNYIEV 245

 Score = 35.4 bits (80), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 23/31 (74%)

Query: 718 LLTHNIQDSVIAVACTVRYGGKFITQVVYSP 748
           L+T +I+ + + VA  VRY  K++TQ++Y+P
Sbjct: 381 LITSSIKHNTLCVASIVRYKQKYVTQILYAP 411

>CAGL0K09350g Chr11 complement(922651..923949) [1299 bp, 432 aa]
           {ON} similar to uniprot|P34164 Saccharomyces cerevisiae
           YGL208w SIP2 or uniprot|Q04739 Saccharomyces cerevisiae
           YER027c GAL83
          Length = 432

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 28/40 (70%)

Query: 452 LFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEV 491
           L L PG ++ +F V+  LR SD LPTATD +GN VN+ EV
Sbjct: 213 LQLAPGTHRFRFIVDNQLRFSDNLPTATDQMGNFVNYLEV 252

>YGL208W Chr7 (97338..98585) [1248 bp, 415 aa] {ON}  SIP2One of
           three beta subunits of the Snf1 serine/threonine protein
           kinase complex involved in the response to glucose
           starvation; null mutants exhibit accelerated aging;
           N-myristoylprotein localized to the cytoplasm and the
           plasma membrane
          Length = 415

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 29/40 (72%)

Query: 452 LFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEV 491
           L L PG ++ +F V+  LR SD+LPTATD +GN VN+ EV
Sbjct: 206 LRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVNYIEV 245

 Score = 35.4 bits (80), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 23/31 (74%)

Query: 718 LLTHNIQDSVIAVACTVRYGGKFITQVVYSP 748
           L+T +I+ + + VA  VRY  K++TQ++Y+P
Sbjct: 381 LVTSSIKHNTLCVASIVRYKQKYVTQILYTP 411

>Suva_7.53 Chr7 (93895..95139) [1245 bp, 414 aa] {ON} YGL208W (REAL)
          Length = 414

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 29/40 (72%)

Query: 452 LFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEV 491
           L L PG ++ +F V+  LR SD+LPTATD +GN VN+ EV
Sbjct: 205 LRLLPGTHRFRFVVDNELRVSDFLPTATDQMGNFVNYIEV 244

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 23/32 (71%)

Query: 718 LLTHNIQDSVIAVACTVRYGGKFITQVVYSPC 749
           L+T +I+ + + V+  VRY  K++TQ++Y+P 
Sbjct: 380 LITSSIKHNTLCVSSIVRYKQKYVTQILYTPI 411

>NCAS0E00620 Chr5 (106661..108163) [1503 bp, 500 aa] {ON} Anc_3.517
          Length = 500

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 32/54 (59%)

Query: 438 MVYYPDTSEWVTKYLFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEV 491
           ++  PD        L LP G ++ +F V+  L+ SD+LPTATD  GN VN+ EV
Sbjct: 257 LIPVPDKQGLFHVKLQLPAGTHRFRFIVDNELKFSDFLPTATDQTGNFVNYLEV 310

 Score = 35.4 bits (80), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 23/32 (71%)

Query: 718 LLTHNIQDSVIAVACTVRYGGKFITQVVYSPC 749
           L+T +I+ + + VA  +RY  K++TQ++Y+P 
Sbjct: 468 LVTTSIKHNTLCVASIIRYKHKYVTQILYAPL 499

>Skud_7.60 Chr7 (102699..104024) [1326 bp, 441 aa] {ON} YGL208W
           (REAL)
          Length = 441

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 29/40 (72%)

Query: 452 LFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEV 491
           L L PG ++ +F V+  LR SD+LPTATD +GN VN+ EV
Sbjct: 232 LRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVNYIEV 271

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 23/32 (71%)

Query: 718 LLTHNIQDSVIAVACTVRYGGKFITQVVYSPC 749
           L+T +I+ + + VA  VRY  K++TQ++Y+P 
Sbjct: 407 LVTSSIKHNTLCVASIVRYKQKYVTQILYTPI 438

>KLTH0H10296g Chr8 (883534..888540) [5007 bp, 1668 aa] {ON} weakly
           similar to uniprot|P29539 Saccharomyces cerevisiae
           YBR275C RIF1 Protein that binds to the Rap1p C- terminus
           and acts synergistically with Rif2p to help control
           telomere length and establish telomeric silencing
           deletion results in telomere elongation
          Length = 1668

 Score = 33.1 bits (74), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 41/97 (42%), Gaps = 7/97 (7%)

Query: 429 DSENSDSARMVYYPDTSEWVTKYLFLPPG--IYKLQFNV-----NGSLRHSDYLPTATDN 481
           DSE    +RM     +     K L   P   I KL   +     NG +  +D L T    
Sbjct: 744 DSEQKPRSRMTDALASLMRTFKDLMCEPSPIINKLCMEIATAIKNGEIDCTDMLKTVLKE 803

Query: 482 LGNIVNWFEVPRGYESIEPFRDNDYVKNEISGGILQP 518
             N +++ EV   +  ++  R +D++ N IS  IL P
Sbjct: 804 TSNSISYLEVYSFFLRLKDTRIDDFIYNSISSKILSP 840

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.131    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 77,758,287
Number of extensions: 3418326
Number of successful extensions: 10596
Number of sequences better than 10.0: 83
Number of HSP's gapped: 10912
Number of HSP's successfully gapped: 132
Length of query: 755
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 638
Effective length of database: 40,065,477
Effective search space: 25561774326
Effective search space used: 25561774326
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)