Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1003.422.293ON49049022980.0
NCAS0B062202.293ON48648312751e-172
Smik_9.892.293ON49148912631e-170
TDEL0G022302.293ON48849012461e-168
ZYRO0A02024g2.293ON48648812401e-167
Skud_9.832.293ON49148912241e-164
Suva_9.1092.293ON49148912181e-163
YIL090W (ICE2)2.293ON49148912171e-163
NDAI0B035202.293ON50149012071e-162
CAGL0D04202g2.293ON49950011831e-158
KAFR0J013302.293ON49149111741e-157
SAKL0E07524g2.293ON47948711361e-151
KNAG0A053902.293ON49748411301e-150
TPHA0C034402.293ON57954411281e-149
KLTH0G10516g2.293ON47448510671e-141
Kwal_27.115002.293ON47548510471e-138
TBLA0B059802.293ON4935019811e-128
ADL208W2.293ON5025159491e-123
Ecym_33322.293ON5135189171e-118
KLLA0E08207g2.293ON4864929061e-116
TBLA0B069902.293ON5365329021e-115
TDEL0E017404.199ON42343810.20
Kwal_33.137581.166ON571107761.0
NCAS0B061402.306ON44339732.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1003.42
         (490 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON} (1007...   889   0.0  
NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa] ...   495   e-172
Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W (...   491   e-170
TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.2...   484   e-168
ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} simila...   482   e-167
Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W (...   476   e-164
Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W ...   473   e-163
YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integr...   473   e-163
NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {O...   469   e-162
CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} simila...   460   e-158
KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {...   456   e-157
SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {...   442   e-151
KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {O...   439   e-150
TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.2...   439   e-149
KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} simila...   415   e-141
Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {...   407   e-138
TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON} Anc_2...   382   e-128
ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic ho...   370   e-123
Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar t...   357   e-118
KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {...   353   e-116
TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON}            352   e-115
TDEL0E01740 Chr5 complement(335052..336323) [1272 bp, 423 aa] {O...    36   0.20 
Kwal_33.13758 s33 (380210..381925) [1716 bp, 571 aa] {ON} YJL172...    34   1.0  
NCAS0B06140 Chr2 complement(1162144..1163475) [1332 bp, 443 aa] ...    33   2.0  

>Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON}
           (100704..102176) [1473 nt, 491 aa]
          Length = 490

 Score =  889 bits (2298), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/490 (90%), Positives = 441/490 (90%)

Query: 1   MRRVLKNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGXXXXXXXXXXXXXXXXXNII 60
           MRRVLKNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCG                 NII
Sbjct: 1   MRRVLKNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGLTFTVTLFYLYFTSTTLNII 60

Query: 61  ARRWGSKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPKETFLDLLRG 120
           ARRWGSKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPKETFLDLLRG
Sbjct: 61  ARRWGSKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPKETFLDLLRG 120

Query: 121 DIPVSVKNWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHER 180
           DIPVSVKNWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHER
Sbjct: 121 DIPVSVKNWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHER 180

Query: 181 NSNIWXXXXXXXXXXXXXXXXYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIVS 240
           NSNIW                YYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIVS
Sbjct: 181 NSNIWIISSLLTSGGLITGSLYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIVS 240

Query: 241 HNGSVIESSLFFAYIVRCIYXXXXXXXXXXXXXXXXGIKEVWQSHHANLNVADGFISYFY 300
           HNGSVIESSLFFAYIVRCIY                GIKEVWQSHHANLNVADGFISYFY
Sbjct: 241 HNGSVIESSLFFAYIVRCIYEIAPELATTATEEFLEGIKEVWQSHHANLNVADGFISYFY 300

Query: 301 DSFHMQAHKFWTLFTSRTPYYGYLHNYCMDYPSLVMIRSNFYPIWETLKTLTFSVPTSIS 360
           DSFHMQAHKFWTLFTSRTPYYGYLHNYCMDYPSLVMIRSNFYPIWETLKTLTFSVPTSIS
Sbjct: 301 DSFHMQAHKFWTLFTSRTPYYGYLHNYCMDYPSLVMIRSNFYPIWETLKTLTFSVPTSIS 360

Query: 361 ELFHLTVRMAIDSVSPAIIINLCFRLMIFYSATRIIPAIQKRTRSETRKIRGIMKALYWY 420
           ELFHLTVRMAIDSVSPAIIINLCFRLMIFYSATRIIPAIQKRTRSETRKIRGIMKALYWY
Sbjct: 361 ELFHLTVRMAIDSVSPAIIINLCFRLMIFYSATRIIPAIQKRTRSETRKIRGIMKALYWY 420

Query: 421 SPCILIAMYTHLILQYSGELKKDLCLWGCDSTWFGEDQERINVDAWSFWNWCNIFWTIII 480
           SPCILIAMYTHLILQYSGELKKDLCLWGCDSTWFGEDQERINVDAWSFWNWCNIFWTIII
Sbjct: 421 SPCILIAMYTHLILQYSGELKKDLCLWGCDSTWFGEDQERINVDAWSFWNWCNIFWTIII 480

Query: 481 YGSELIGGKK 490
           YGSELIGGKK
Sbjct: 481 YGSELIGGKK 490

>NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa]
           {ON} Anc_2.293 YIL090W
          Length = 486

 Score =  495 bits (1275), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 253/483 (52%), Positives = 319/483 (66%), Gaps = 8/483 (1%)

Query: 6   KNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGXXXXXXXXXXXXXXXXXNIIARRWG 65
            + IR +++    FYLL  + +IPISFKIGGL+CG                 +I AR++G
Sbjct: 4   SSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWARKYG 63

Query: 66  SKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPKETFLDLLRGDIPVS 125
           S+  I++T+  +YFQ+FII SLL+LFL+GF+NE L   +R G +P ++  D+ + ++  S
Sbjct: 64  SRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNVASS 123

Query: 126 VK-NWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHERNSNI 184
            + NW+L+YYYY + V+PWQ ILSYSTP FTL EGFFTIL IQ IGE N WL +E NSN 
Sbjct: 124 TQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEINSNT 183

Query: 185 WXXXXXXXXXXXXXXXXYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIVSHNGS 244
           W                YYLYRIY TPIW LSV  A+LLGFTLSLVG LGIYGIV+  GS
Sbjct: 184 WVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTDKGS 243

Query: 245 VIESSLFFAYIVRCIYXXXXXXXXXXXXXXXXGIKEVWQSHHANLNVADGFISYFYDSFH 304
           VIESS+FFAYIVRCIY                  KEVWQ H ANL   +  +SY+++   
Sbjct: 244 VIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHNVVL 303

Query: 305 MQAHKFWTLFTSRTPYYGYLHNYCMDYPSLVMIRSNFYPIWETLKTLTFSVPTSISELFH 364
                 W  F           N  +   S   + + F PIW+ LKT T +VP+SI+EL  
Sbjct: 304 KNIETIWESFKIN-------DNSFITSFSTERVITIFMPIWKLLKTFTITVPSSINELCF 356

Query: 365 LTVRMAIDSVSPAIIINLCFRLMIFYSATRIIPAIQKRTRSETRKIRGIMKALYWYSPCI 424
           +T +MA +S+SPA+I+NLCFR++IFYSATRIIPA+Q+R  +E RK R IMK LYWYSPCI
Sbjct: 357 VTYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYSPCI 416

Query: 425 LIAMYTHLILQYSGELKKDLCLWGCDSTWFGEDQERINVDAWSFWNWCNIFWTIIIYGSE 484
           LIAMY HLILQYSGELK +LCLWGC+S  F  DQ +I VD+W FWNWCNIF+TI++Y SE
Sbjct: 417 LIAMYAHLILQYSGELKDELCLWGCNSKIFPSDQPKIIVDSWGFWNWCNIFFTILVYASE 476

Query: 485 LIG 487
           LIG
Sbjct: 477 LIG 479

>Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  491 bits (1263), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 244/489 (49%), Positives = 312/489 (63%), Gaps = 1/489 (0%)

Query: 1   MRRVLKNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGXXXXXXXXXXXXXXXXXNII 60
           M  + K+ ++S ++   CFYLL  + +IPISFK+GGL CG                 N++
Sbjct: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVL 60

Query: 61  ARRWGSKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPKETFLDLLRG 120
           ARR+G K  I +TS  +Y Q+FII SLL+LFL+GF+N++L   ++      E+FL+ L+ 
Sbjct: 61  ARRYGGKLYIFLTSCLYYSQHFIIASLLYLFLSGFSNDELGNVLKKRPNESESFLEALKN 120

Query: 121 DIPVSVKNWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHER 180
            +  +  N++L+YYY+ + V+PWQ IL+ STP FTL EGFFTIL IQ +GE N WL ++ 
Sbjct: 121 SLNSNQINYVLYYYYFRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180

Query: 181 NSNIWXXXXXXXXXXXXXXXXYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIVS 240
           NSN W                YYLYRIY TPIW LS+  A+LLGF LS+V  LG+YGIVS
Sbjct: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240

Query: 241 HNGSVIESSLFFAYIVRCIYXXXXXXXXXXXXXXXXGIKEVWQSHHANLNVADGFISYFY 300
             GSVIESSLFFAYIVRCIY                  K+VWQ H  NL  AD  + YF+
Sbjct: 241 QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300

Query: 301 DSFHMQAHKFWTLFTSR-TPYYGYLHNYCMDYPSLVMIRSNFYPIWETLKTLTFSVPTSI 359
           +     A   W  F  R     G  H+  +   S   +     P W+  K  TFSVP SI
Sbjct: 301 NVILKNAEMLWGSFIPRGRKKTGDFHDKLISVLSFEKVSLISKPFWKFFKNFTFSVPLSI 360

Query: 360 SELFHLTVRMAIDSVSPAIIINLCFRLMIFYSATRIIPAIQKRTRSETRKIRGIMKALYW 419
           +E   +T++MA +SVSPAI++NLCFR+++FYSATRIIPA+Q++   + RK R IMK LYW
Sbjct: 361 NEFCQVTIKMASESVSPAIVVNLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYW 420

Query: 420 YSPCILIAMYTHLILQYSGELKKDLCLWGCDSTWFGEDQERINVDAWSFWNWCNIFWTII 479
           YSPCILIAMYTHLILQYSGELKKDLC+WGC   WFG DQ  I VD+W FWNWCNIF TI+
Sbjct: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGSDQPEIIVDSWGFWNWCNIFCTIL 480

Query: 480 IYGSELIGG 488
           +Y +ELIG 
Sbjct: 481 VYATELIGS 489

>TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.293
           YIL090W
          Length = 488

 Score =  484 bits (1246), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 244/490 (49%), Positives = 319/490 (65%), Gaps = 2/490 (0%)

Query: 1   MRRVLKNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGXXXXXXXXXXXXXXXXXNII 60
           M  + K+ ++  ++ L  FYLL+ + TIPISFK+GGLYCG                 +++
Sbjct: 1   MTTISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMV 60

Query: 61  ARRWGSKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPKETFLDLLRG 120
           A+ +G+K  I+ T+  +Y Q+F+I SLL+LFL+GF+NE+L K +  G QP+++ +++LR 
Sbjct: 61  AQSYGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPEQSLVNVLRN 120

Query: 121 DIPVSVKNWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHER 180
           ++  +  +W+L+YYYY Y V+PWQ +L++ST  F L EGFFT+LGIQ IGE N WL  E 
Sbjct: 121 NVFSNHSSWMLYYYYYRYVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEM 180

Query: 181 NSNIWXXXXXXXXXXXXXXXXYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIVS 240
           NSN W                YYLYRIY TPIWNLSV  A+LLGFTLS+V  +G++GIVS
Sbjct: 181 NSNTWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIVS 240

Query: 241 HNGSVIESSLFFAYIVRCIYXXXXXXXXXXXXXXXXGIKEVWQSHHANLNVADGFISYFY 300
            NGSVIESSLFFAYIVRCIY                 IK  WQ H  NL+  +  +SY+ 
Sbjct: 241 KNGSVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQ 300

Query: 301 DSFHMQAHKFWTLFTSRTPYYGYLHNYCMDYPSLVMIRSNFYPIWETLKTLTFSVPTSIS 360
           D     A   W     RT        +    P L  +   F PIW+  K    SVP+SI 
Sbjct: 301 DVVLKNAEMVWESIVLRTKNSD-ATTFTAIQP-LNKLWHAFTPIWKFFKGFVLSVPSSIG 358

Query: 361 ELFHLTVRMAIDSVSPAIIINLCFRLMIFYSATRIIPAIQKRTRSETRKIRGIMKALYWY 420
            +F +T+++A +SVSPAI++NLCFR+++FYSATRIIPA+Q++   E RK R IM  LYWY
Sbjct: 359 GVFQVTLKLASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRRIMNVLYWY 418

Query: 421 SPCILIAMYTHLILQYSGELKKDLCLWGCDSTWFGEDQERINVDAWSFWNWCNIFWTIII 480
           SPCILIAMYTHLILQYSGEL  DLCLWGC   WFG  Q +I ++ W FWNWCNIFWT++I
Sbjct: 419 SPCILIAMYTHLILQYSGELNSDLCLWGCSEKWFGSGQPKIEINTWVFWNWCNIFWTVLI 478

Query: 481 YGSELIGGKK 490
           YGSELIGGK+
Sbjct: 479 YGSELIGGKR 488

>ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 486

 Score =  482 bits (1240), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 251/488 (51%), Positives = 322/488 (65%), Gaps = 10/488 (2%)

Query: 8   LIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGXXXXXXXXXXXXXXXXXNIIARRWGSK 67
           +++SV+V+L CFYLL+I+ TIPISFK+GGLYCG                 ++  R + S+
Sbjct: 4   VVQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASR 63

Query: 68  PAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPKETFLDLLRGDIPVSVK 127
             +  T++ +Y Q+ II SLL+LFL+GF+NE+L K + SG QP+++ L++L+ +   +  
Sbjct: 64  FYVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPEQSLLEVLKSNPFSAHS 123

Query: 128 NWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHERNSNIWXX 187
           NW+L+YYYY Y V+PWQ ILS+ST  F+L EGFFTIL IQ +GE + WL +E NSNIW  
Sbjct: 124 NWILYYYYYCYIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNIWNI 183

Query: 188 XXXXXXXXXXXXXXYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIVSHNGSVIE 247
                         YYLYRIY TP+W LS+  A+LLGFTLSLV  LG+YGIVS NGSVIE
Sbjct: 184 TSLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGSVIE 243

Query: 248 SSLFFAYIVRCIYXXXXXXXXXXXXXXXXGIKEVWQSHHANLNVADGFISYFYDSFHMQA 307
           SSLFFAYIVRCIY                  KE WQ H  N +  +  +SY++D     A
Sbjct: 244 SSLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVLDSA 303

Query: 308 HKFWTLFTSRT-----PYYGYLHNYCMDYPSLVMIRSNFYPIWETLKTLTFSVPTSISEL 362
              W    S+T     P+Y     +   +P L      F P+    K  T SVP+SI  L
Sbjct: 304 EMMWESIVSKTVTTSDPFY-----HTSMFPPLRKFTDIFKPVGIFFKNFTISVPSSIEGL 358

Query: 363 FHLTVRMAIDSVSPAIIINLCFRLMIFYSATRIIPAIQKRTRSETRKIRGIMKALYWYSP 422
           F +T++MA DSVSPAI++NL FR++IFYSAT+IIPA+Q +   +  K R IM  LYWYSP
Sbjct: 359 FQVTLKMASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIMNVLYWYSP 418

Query: 423 CILIAMYTHLILQYSGELKKDLCLWGCDSTWFGEDQERINVDAWSFWNWCNIFWTIIIYG 482
           CILIAMYTHLILQYSGEL +DLCLWGC+S WF  +Q +I VD+W FWNWCNIFWTI++YG
Sbjct: 419 CILIAMYTHLILQYSGELNRDLCLWGCNSMWFSLNQTKIVVDSWGFWNWCNIFWTILVYG 478

Query: 483 SELIGGKK 490
           SELIGGKK
Sbjct: 479 SELIGGKK 486

>Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  476 bits (1224), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 242/489 (49%), Positives = 312/489 (63%), Gaps = 1/489 (0%)

Query: 1   MRRVLKNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGXXXXXXXXXXXXXXXXXNII 60
           M  + K+ ++S +V   CFYLL  + +IPISFK+GGL CG                 N++
Sbjct: 1   MTSLSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVL 60

Query: 61  ARRWGSKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPKETFLDLLRG 120
           A+R G K  I +T+  +Y Q+F+I SLL+LFL+GF+N++L   +++     E+FLD L+ 
Sbjct: 61  AKRHGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSNESESFLDALKD 120

Query: 121 DIPVSVKNWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHER 180
            +  +  N++L+YYYY + V+PWQ +L+ STP FTL EGFFTIL IQ +GE N WL ++ 
Sbjct: 121 SLNSNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180

Query: 181 NSNIWXXXXXXXXXXXXXXXXYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIVS 240
           NSN W                YYLYRIY TPIW LS+  A+LLGF LS+V  LG+YGIVS
Sbjct: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240

Query: 241 HNGSVIESSLFFAYIVRCIYXXXXXXXXXXXXXXXXGIKEVWQSHHANLNVADGFISYFY 300
             GSVIESSLFFAYIVRCIY                  K+VWQ H  NL  AD  + YF+
Sbjct: 241 QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300

Query: 301 DSFHMQAHKFWTLFTSR-TPYYGYLHNYCMDYPSLVMIRSNFYPIWETLKTLTFSVPTSI 359
           +     A   W  F  R     G  H+  +   S   +     P W+  K  TFSVP SI
Sbjct: 301 NVVLKNAEMLWGSFIPRGRKKTGDFHDKIISILSFEKVSLISRPFWKFFKNFTFSVPLSI 360

Query: 360 SELFHLTVRMAIDSVSPAIIINLCFRLMIFYSATRIIPAIQKRTRSETRKIRGIMKALYW 419
           +E   +T++MA +SVSPAI+INLCFR+++FYSATRIIPA+Q++   + RK R IM+ LYW
Sbjct: 361 NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMRGLYW 420

Query: 420 YSPCILIAMYTHLILQYSGELKKDLCLWGCDSTWFGEDQERINVDAWSFWNWCNIFWTII 479
           YSPCILIAMYTHLILQYSGELKKDLC+WGC   WFG +Q  I VD+W FWNWCNIF TI+
Sbjct: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGAEQPEIIVDSWGFWNWCNIFCTIL 480

Query: 480 IYGSELIGG 488
           +Y +ELIG 
Sbjct: 481 VYATELIGS 489

>Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  473 bits (1218), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 243/489 (49%), Positives = 309/489 (63%), Gaps = 1/489 (0%)

Query: 1   MRRVLKNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGXXXXXXXXXXXXXXXXXNII 60
           M  + K+ ++S ++   CFYLL  + +IPISFK+GGL CG                 N++
Sbjct: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVL 60

Query: 61  ARRWGSKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPKETFLDLLRG 120
           ARR G +  I +TS  +Y Q+F+I SLL LFL+GF+N++L   +++     E+FL+ L+ 
Sbjct: 61  ARRNGGRLYIFLTSCLYYSQHFVIASLLFLFLSGFSNDELGNVLKNRSNESESFLEALKN 120

Query: 121 DIPVSVKNWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHER 180
            +  +  N++L+YYYY + V+PWQ IL+ STP FTL EGFFTIL IQ +GE N WL ++ 
Sbjct: 121 SLNSNQINYVLYYYYYRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180

Query: 181 NSNIWXXXXXXXXXXXXXXXXYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIVS 240
           NSN W                YYLYRIY TPIW LS+  A+LLGF LS+V  LG+YGIVS
Sbjct: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240

Query: 241 HNGSVIESSLFFAYIVRCIYXXXXXXXXXXXXXXXXGIKEVWQSHHANLNVADGFISYFY 300
             GSVIESSLFFAYIVRCIY                  K+VWQ H  NL  AD  + YF+
Sbjct: 241 QRGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300

Query: 301 DSFHMQAHKFWTLF-TSRTPYYGYLHNYCMDYPSLVMIRSNFYPIWETLKTLTFSVPTSI 359
           +     A   W  F   R      LH   +   S   +     P W   K  TFSVP SI
Sbjct: 301 NVILKNAEVLWGSFIPRRRKTTSDLHEKIISILSFEKVSLISKPFWRFCKNFTFSVPLSI 360

Query: 360 SELFHLTVRMAIDSVSPAIIINLCFRLMIFYSATRIIPAIQKRTRSETRKIRGIMKALYW 419
           +E   +T++MA +SVSPAI+INLCFR+++FYSATRIIPA+Q++   + RK R IMK LYW
Sbjct: 361 NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYW 420

Query: 420 YSPCILIAMYTHLILQYSGELKKDLCLWGCDSTWFGEDQERINVDAWSFWNWCNIFWTII 479
           YSPCILIAMYTHLILQYSGELKKDLC+WGC   WFG DQ  I VD+W FWNWCNIF TI+
Sbjct: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGPDQPEIIVDSWGFWNWCNIFCTIL 480

Query: 480 IYGSELIGG 488
           +Y +EL+G 
Sbjct: 481 VYATELVGS 489

>YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integral
           ER membrane protein with type-III transmembrane domains;
           required for ER zinc homeostasis; mutations cause
           defects in cortical ER morphology in both the mother and
           daughter cells
          Length = 491

 Score =  473 bits (1217), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 242/489 (49%), Positives = 310/489 (63%), Gaps = 1/489 (0%)

Query: 1   MRRVLKNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGXXXXXXXXXXXXXXXXXNII 60
           M  + K+ ++S ++   CFYLL  + +IPISFK+GGL CG                 N++
Sbjct: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVL 60

Query: 61  ARRWGSKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPKETFLDLLRG 120
           ARR G +  I  T+  +Y Q+FII SLL+LFL+GF+N++L   +++     E+FL+ L+ 
Sbjct: 61  ARRHGGRLYIFFTNCLYYSQHFIIASLLYLFLSGFSNDELGNVLKNKYNESESFLEALKN 120

Query: 121 DIPVSVKNWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHER 180
            +  +  N++L+YYYY + V+PWQ +L+ STP FTL EGFFTIL IQ +GE N WL ++ 
Sbjct: 121 SLNSNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180

Query: 181 NSNIWXXXXXXXXXXXXXXXXYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIVS 240
           NSN W                YYLYRIY TPIW LS+  A+LLG  LS+V  LG+YGIVS
Sbjct: 181 NSNTWIISSLLTSGGVITASLYYLYRIYVTPIWPLSIQTASLLGLVLSMVCGLGLYGIVS 240

Query: 241 HNGSVIESSLFFAYIVRCIYXXXXXXXXXXXXXXXXGIKEVWQSHHANLNVADGFISYFY 300
             GSVIESSLFFAYIVRCIY                  K+VWQ H  NL  AD  + YF+
Sbjct: 241 QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILNLFKDVWQKHQRNLPTADNLLCYFH 300

Query: 301 DSFHMQAHKFWTLFTSR-TPYYGYLHNYCMDYPSLVMIRSNFYPIWETLKTLTFSVPTSI 359
           +     A   W  F  R     G  H+  +   S   +     P W+  K  TFSVP SI
Sbjct: 301 NVILKNAEVLWGSFIPRGRKKTGDFHDKLISILSFEKVSLISKPFWKFFKNFTFSVPLSI 360

Query: 360 SELFHLTVRMAIDSVSPAIIINLCFRLMIFYSATRIIPAIQKRTRSETRKIRGIMKALYW 419
           +E   +T++MA +SVSPAI+INLCFR+++FYSATRIIPA+Q++   + RK R IMK LYW
Sbjct: 361 NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYW 420

Query: 420 YSPCILIAMYTHLILQYSGELKKDLCLWGCDSTWFGEDQERINVDAWSFWNWCNIFWTII 479
           YSPCILIAMYTHLILQYSGELKKDLC+WGC   WFG DQ  I VD+W FWNWCNIF TI+
Sbjct: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGVDQPEIIVDSWGFWNWCNIFCTIL 480

Query: 480 IYGSELIGG 488
           +Y +ELIG 
Sbjct: 481 VYATELIGS 489

>NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {ON}
           Anc_2.293 YIL090W
          Length = 501

 Score =  469 bits (1207), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 243/490 (49%), Positives = 308/490 (62%), Gaps = 8/490 (1%)

Query: 6   KNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGXXXXXXXXXXXXXXXXXNIIARRWG 65
            + +R V+     FYLL  + +IPISFKIGGL CG                 +++AR++G
Sbjct: 4   SSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLARKYG 63

Query: 66  SKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPKETFLDLLRGDIPVS 125
           S  +I +T   +Y Q+ II SLL+LFL+GF++EDL   +    Q  +   D++R ++  +
Sbjct: 64  SNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNLSST 123

Query: 126 VKNWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHERNSNIW 185
             NW L++ YY++ V+PW+ +LSYSTP FTL EGFFTIL IQ +GE N WL +E NSN W
Sbjct: 124 NSNWNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLVNEINSNTW 183

Query: 186 XXXXXXXXXXXXXXXXYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIVSHNGSV 245
                           YYLYRIY TPIW LS+  A+LLGFTLSLVG LG+YGIV+  GSV
Sbjct: 184 IISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYGIVTEKGSV 243

Query: 246 IESSLFFAYIVRCIYXXXXXXXXXXXXXXXXGIKEVWQSHHANLNVADGFISYFYDSFHM 305
           IESSLFFAYIVRCIY                  KEVWQ H  NL   D  + Y+ +    
Sbjct: 244 IESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLFYYNNFVLR 303

Query: 306 QAHKFWTLFTSR--------TPYYGYLHNYCMDYPSLVMIRSNFYPIWETLKTLTFSVPT 357
                W L  S+        T    +  N+   + S  ++     PIW+  K  T SVP+
Sbjct: 304 HIDMLWELLVSKINQNDPNNTLPSSFNINFLTTFLSKDLLLRICKPIWKLFKNFTVSVPS 363

Query: 358 SISELFHLTVRMAIDSVSPAIIINLCFRLMIFYSATRIIPAIQKRTRSETRKIRGIMKAL 417
           SISEL  +T +MA +SVSPA++INLCFR++IFYSATRIIPA+Q+R  SE +K R IMK L
Sbjct: 364 SISELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRRNDSELKKSRRIMKIL 423

Query: 418 YWYSPCILIAMYTHLILQYSGELKKDLCLWGCDSTWFGEDQERINVDAWSFWNWCNIFWT 477
           YWYSPC+LIAMYTHLILQYSGELKKDLCLWGC+  W   +Q  + VD+W FWNWCNIF+T
Sbjct: 424 YWYSPCVLIAMYTHLILQYSGELKKDLCLWGCNLKWLIPNQPELIVDSWGFWNWCNIFFT 483

Query: 478 IIIYGSELIG 487
           IIIY SEL G
Sbjct: 484 IIIYASELFG 493

>CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090w
          Length = 499

 Score =  460 bits (1183), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 236/500 (47%), Positives = 316/500 (63%), Gaps = 18/500 (3%)

Query: 1   MRRVLKNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGXXXXXXXXXXXXXXXXXNII 60
           M  + + + RS+++     YL+  + +IPISFKIGGL CG                 +++
Sbjct: 1   MGLITEGVQRSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFTVTLFNLYLISTTLSVL 60

Query: 61  ARRWGSKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIR-----SGIQPKETFL 115
           ARR  ++  +  TS  +Y Q+ +I  LL LFL+GF+NE+  + +        + P  +FL
Sbjct: 61  ARRSCNRGYVFATSILYYSQHLVIAPLLFLFLSGFSNEEFNRFLSPVGSYQELDPDGSFL 120

Query: 116 DLLRGDIPVSV-----KNWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIG 170
           DLL+  I ++      KNW L+YYY+ + V+PWQ +LSYSTP FTLLEGFFTIL IQ IG
Sbjct: 121 DLLKHRILMATTAENSKNWTLYYYYFKFIVQPWQWLLSYSTPFFTLLEGFFTILAIQAIG 180

Query: 171 EMNTWLKHERNSNIWXXXXXXXXXXXXXXXXYYLYRIYATPIWNLSVGAATLLGFTLSLV 230
           E N WL +E NSN W                YYLYRIY TPIW L++ +A+LLGF LS+V
Sbjct: 181 ETNKWLSYEMNSNTWIITSLLVSGGVITGSLYYLYRIYVTPIWKLTIQSASLLGFVLSIV 240

Query: 231 GSLGIYGIVSHNGSVIESSLFFAYIVRCIYXXXXXXXXXXXXXXXXGIKEVWQSHHANLN 290
             LG+YGI+S  GSVIESSLFFAYIVRCIY                 +K+VWQ+H  NL 
Sbjct: 241 FCLGLYGIISRKGSVIESSLFFAYIVRCIYEISPKLATRATEEILDLVKDVWQTHQRNLL 300

Query: 291 VADGFISYFYDSFHMQAHKFWTLFTSRTPYYGYLHNYCMDYPSLVMIRSNFYPIWETLKT 350
             D  ++Y+++     A   W  F    P      +  ++    +    +  P+W+  K 
Sbjct: 301 NRDNLLAYYHNVVLKNAEMVWESFI--LP-----RSRSLNAMEKIRFWLDVTPVWKFFKN 353

Query: 351 LTFSVPTSISELFHLTVRMAIDSVSPAIIINLCFRLMIFYSATRIIPAIQKRTRSETRKI 410
            T SVP+SI EL  +T +MA +S+SPA+I+NLCFR++IFYSATRIIPA+Q+ +  E R+ 
Sbjct: 354 FTVSVPSSIVELVSVTYKMASESLSPAVIVNLCFRILIFYSATRIIPALQRSSYKEQRQS 413

Query: 411 RGIMKALYWYSPCILIAMYTHLILQYSGELKKDLCLWGCDSTWFG-EDQERINVDAWSFW 469
           R I+K LYWYSPC+LIAMYTHLILQYSGELK++LCLWGC S WFG +DQ RI  D+WSFW
Sbjct: 414 RRILKLLYWYSPCVLIAMYTHLILQYSGELKRELCLWGCTSNWFGSKDQPRIVTDSWSFW 473

Query: 470 NWCNIFWTIIIYGSELIGGK 489
           NWCNIFWT+++Y +ELIG +
Sbjct: 474 NWCNIFWTVLVYANELIGTQ 493

>KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {ON}
           Anc_2.293 YIL090W
          Length = 491

 Score =  456 bits (1174), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 240/491 (48%), Positives = 312/491 (63%), Gaps = 9/491 (1%)

Query: 1   MRRVLKNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGXXXXXXXXXXXXXXXXXNII 60
           M  + K++IR +++    FYLL  + +IP+SFKIGG++CG                 +I+
Sbjct: 1   MTLLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSIL 60

Query: 61  ARRWGSKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPKETFLDLLRG 120
           AR+ GS+  I++TS  +Y Q+ II SLL+ FL+GF+N++L + ++ G +  E  +     
Sbjct: 61  ARQSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDGTEKIEVLVA--NQ 118

Query: 121 DIPVSVKNWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHER 180
           D+ VS  NWLL+ YYYSY VKPW+ +LSYSTP F L EGFFTIL IQ IGE N WL  E+
Sbjct: 119 DLMVSESNWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEK 178

Query: 181 NSNIWXXXXXXXXXXXXXXXXYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIVS 240
           NSN W                YYLYRIY TPIW LS   ATLLG  LSL   LGI+GI+S
Sbjct: 179 NSNSWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIIS 238

Query: 241 HNGSVIESSLFFAYIVRCIYXXXXXXXXXXXXXXXXGIKEVWQSHHANLNVADGFISYFY 300
             GSV+ESSLFFAYIVRCIY                  KEVWQ H   L + D  ++Y+ 
Sbjct: 239 ERGSVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYR 298

Query: 301 DSFHMQAHKFWTLFTSRTPYYGYLHNYCMD-YPSLVMIRSNFYPIWETLKTLTFSVPTSI 359
                     W  F S+T  +    N+ ++ + +      +F P+W+  K  T SVP SI
Sbjct: 299 SVILKNTEMIWEAFLSKTKQHS---NHTLNSFFTAENFWIHFNPLWKFFKNFTISVPFSI 355

Query: 360 SELFHLTVRMAIDSVSPAIIINLCFRLMIFYSATRIIPAIQKRTRSETRKIRGIMKALYW 419
           SEL  + ++MA +S+SPA+++NLCFR++IFYSATRIIP++Q++   ++RK R IMK LYW
Sbjct: 356 SELSGMMLQMASESISPAVVVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRRIMKVLYW 415

Query: 420 YSPCILIAMYTHLILQYSGELKKDLCLWGCDSTW-FGEDQERIN--VDAWSFWNWCNIFW 476
           YSPCILIAMYTHLILQYSGELK++L LWG DS   F  D+E  N  VD+WSFWNWCNIFW
Sbjct: 416 YSPCILIAMYTHLILQYSGELKRELYLWGPDSKLSFLVDKEENNIVVDSWSFWNWCNIFW 475

Query: 477 TIIIYGSELIG 487
           TI+IYG EL G
Sbjct: 476 TILIYGGELFG 486

>SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 479

 Score =  442 bits (1136), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 229/487 (47%), Positives = 305/487 (62%), Gaps = 16/487 (3%)

Query: 6   KNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGXXXXXXXXXXXXXXXXXNIIARRWG 65
           ++LI+S++  L  FYLL ++ TIPISF++GGLYCG                  I+++++ 
Sbjct: 4   RSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSFTVTLFNLYFLTTTLKIVSKKY- 62

Query: 66  SKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQ-PKETFLDLLRGDIPV 124
           ++    ITS  +Y Q+FIIPSLL LFL+GF N++L + I   +  P+E+ ++ LR     
Sbjct: 63  NRLYYSITSFVYYLQHFIIPSLLFLFLSGFNNDELKRQIDGDVNLPRESLVNFLRNK--S 120

Query: 125 SVKNWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHERNSNI 184
              +W+ +YYYY +TVKPWQ +L +STP FTLLEGFFT+LGIQ IGE N WL++ +NSN 
Sbjct: 121 GKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNSNT 180

Query: 185 WXXXXXXXXXXXXXXXXYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIVSHNGS 244
           W                YYLYRIY TP+W LS+  A+LLGFTLS+V  LG+YGIVS  GS
Sbjct: 181 WIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGKGS 240

Query: 245 VIESSLFFAYIVRCIYXXXXXXXXXXXXXXXXGIKEVWQSHHANLNVADGFISYFYDSFH 304
           VIESSLFFAYIVRCIY                 +K+ WQ H  NL   D  +SY+ +   
Sbjct: 241 VIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLP-TDNLLSYYRNVVL 299

Query: 305 MQAHKFWTLFTSRTPYYGYLHNYCMDYPSLV-MIRSNFYPIWETLKTLTFSVPTSISELF 363
                 W     +T             PS   M+     P+W+  K  T SVP+SI E+F
Sbjct: 300 KNGEMIWDAIVQKTG---------TTSPSTTQMVWLRLQPLWKFTKNFTISVPSSIREIF 350

Query: 364 HLTVRMAIDSVSPAIIINLCFRLMIFYSATRIIPAIQKRTRSETRKIRGIMKALYWYSPC 423
            +T++MA +SV+P ++INL FR+++FYSATRIIPA+QK   +  +  R +M+ +YWYSPC
Sbjct: 351 RVTLKMATESVTPTVVINLVFRILVFYSATRIIPALQKDDSNGRKSSRRLMRLIYWYSPC 410

Query: 424 ILIAMYTHLILQYSGELKKDLCLWGCDS-TWFGEDQERINVDAWSFWNWCNIFWTIIIYG 482
           I+IAMYTHLILQYSGEL  DLCLWGC   +   +   ++ VDAW FWNWCN+F T+ IYG
Sbjct: 411 IVIAMYTHLILQYSGELNNDLCLWGCFPWSHTNDPSSKVVVDAWGFWNWCNVFCTLAIYG 470

Query: 483 SELIGGK 489
            ELIGGK
Sbjct: 471 LELIGGK 477

>KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {ON}
           Anc_2.293 YIL090W
          Length = 497

 Score =  439 bits (1130), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 236/484 (48%), Positives = 305/484 (63%), Gaps = 9/484 (1%)

Query: 9   IRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGXXXXXXXXXXXXXXXXXNIIARRWGSKP 68
           IR  ++     YLL  + +IPISFK+GGLYCG                 +IIAR+ G++ 
Sbjct: 10  IRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIARKNGNRI 69

Query: 69  AIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPKETFLDLLRGDIPVSVKN 128
            I+++S  +Y Q+FII SLLHLFL+GF+N +L K I +   P E+   +L   +  S  N
Sbjct: 70  YIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDAIPIESLTSILNVSMSSSEAN 129

Query: 129 WLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHERNSNIWXXX 188
           W+ +YYYY Y V PW+ +LS+STP FTL EGFFTIL IQ IGE N WL +E+NSN W   
Sbjct: 130 WIFYYYYYKYVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYEKNSNAWIIS 189

Query: 189 XXXXXXXXXXXXXYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIVSHNGSVIES 248
                        YYLYRIY TPIW L+V  A+LLGF LSLV  LGIYGIVS +GSVIES
Sbjct: 190 SLLTSSAVISAALYYLYRIYVTPIWELTVQTASLLGFVLSLVSGLGIYGIVSDSGSVIES 249

Query: 249 SLFFAYIVRCIYXXXXXXXXXXXXXXXXGIKEVWQSHHANLNVADGFISYFYDSFHMQAH 308
           SLFFAYIVRCIY                  K+VWQ    NL + +  I Y+ +       
Sbjct: 250 SLFFAYIVRCIYEISPKLATTATDELLELFKDVWQKRQGNLPIRNNLIFYYNNVILKNIE 309

Query: 309 KFWTLFTSRTPYYGYLHNYCMDYPSLVMIRSNFY--PIWETLKTLTFSVPTSISELFHLT 366
             W  F  RT   G   NY    PSL++  +  +  PIW+  K  T SVP SI E+  +T
Sbjct: 310 MAWDNFILRTGTSGTF-NY---NPSLLLNNTWKFCKPIWKFFKNFTLSVPFSIREILLMT 365

Query: 367 VRMAIDSVSPAIIINLCFRLMIFYSATRIIPAIQKRTRSETRKIRGIMKALYWYSPCILI 426
            +M+++SVSPA++INLCFR++IFYSATRI+P++Q++   E R+ R +M+ +YWYSPCILI
Sbjct: 366 WKMSLESVSPAVVINLCFRILIFYSATRIVPSLQRKDAREQRRSRKVMELVYWYSPCILI 425

Query: 427 AMYTHLILQYSGELKKDLCLWGCDSTWFG---EDQERINVDAWSFWNWCNIFWTIIIYGS 483
           AMY HLILQYS ELK +LCLWGC++   G   +  E + VDAW FWNWCN+F TI++Y +
Sbjct: 426 AMYAHLILQYSSELKNELCLWGCNNILLGYNTDQNETVVVDAWRFWNWCNVFCTILVYAN 485

Query: 484 ELIG 487
           ELIG
Sbjct: 486 ELIG 489

>TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.293
           YIL090W
          Length = 579

 Score =  439 bits (1128), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 250/544 (45%), Positives = 316/544 (58%), Gaps = 78/544 (14%)

Query: 6   KNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGXXXXXXXXXXXXXXXXXNIIARRWG 65
           + +I S   VLV FYLLNIV TIPISFKIGG+YCG                  II +R  
Sbjct: 53  RGVINSGHAVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITKRLT 112

Query: 66  SKPAI-IITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSI----------RSGIQPK--- 111
               + ++ SS FY QNFII SLL ++L GF N+DLI ++          ++G   K   
Sbjct: 113 HNTTLRLLASSLFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTKYQI 172

Query: 112 -----ETFLD-----LLRGD-------------------IPVSVKNWLLFYYYYSYTVKP 142
                + F++     L R D                    P  + +W+LF+YYY   +KP
Sbjct: 173 LFIIKDYFVNIMNLILFREDNGLNKMLQLALKSEGNSVPDPQKLNSWILFFYYYYIFIKP 232

Query: 143 WQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHERNSNIWXXXXXXXXXXXXXXXXY 202
           W+ +L  STP FTLLEGFFTILGIQTIGE N WLK +++S+ W                Y
Sbjct: 233 WKFLLINSTPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITATLY 292

Query: 203 YLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIVSHNGSVIESSLFFAYIVRCIYXX 262
           YL RIY TP W+L+V  A++LGFTLS+VG LG++GIVS NGS IESSLFFAYIVRCIY  
Sbjct: 293 YLNRIYVTPFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCIYEM 352

Query: 263 XXXXXXXXXXXXXXGIKEVWQSHHANLNVADGFISY-------FYDSFHMQAHKFWTLFT 315
                         G  EVWQ +   + VAD  ++Y        + SF    H  +    
Sbjct: 353 SPELAISATDEFLEGFNEVWQMNQNRITVADNVLTYCKKYIMDAFSSFSSIEHHLF---- 408

Query: 316 SRTPYYGYLHNYCMDYPSLVMIRSNFYPIWETLKTLTFSVPTSISELFHLTVRMAIDSVS 375
            +T   G   N         +I   F   W  LK  T +VP+SI++L  +T +MA+DS+S
Sbjct: 409 PKTIELGISKN---------LIVKQF---WVFLKNFTINVPSSINDLIQITAQMAVDSIS 456

Query: 376 PAIIINLCFRLMIFYSATRIIPAIQKRTRSETRKIRGIMKALYWYSPCILIAMYTHLILQ 435
           PAIIINL FRLMIFYSATRIIPAIQ+RT+ +   + G M A+YW+SPC+LIAMYTHLILQ
Sbjct: 457 PAIIINLSFRLMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLIAMYTHLILQ 516

Query: 436 YSGELKKDLCLWGCD----------STWFGEDQERINVDAWSFWNWCNIFWTIIIYGSEL 485
           +SGELKK++CLW C+          ST  G++   I VD+WSFWNWCNIFWTIIIY SEL
Sbjct: 517 FSGELKKNICLWNCENWLSSSSDVKSTNLGDNS--IIVDSWSFWNWCNIFWTIIIYASEL 574

Query: 486 IGGK 489
           IGG+
Sbjct: 575 IGGR 578

>KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 474

 Score =  415 bits (1067), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 229/485 (47%), Positives = 299/485 (61%), Gaps = 14/485 (2%)

Query: 6   KNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGXXXXXXXXXXXXXXXXXNIIARRWG 65
           +++I+S +V L  FYLL I+ TIPISF++GGLYCG                  I AR  G
Sbjct: 4   RSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAARARG 63

Query: 66  SKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPKETFLDLLRGDIPVS 125
                 + S+ +Y Q+F IPSLL LFL+GF+N++L + I +  +P E+ +DLLR      
Sbjct: 64  LAK---LASAAYYAQHFFIPSLLFLFLSGFSNDELKRQIDTNTRPDESLIDLLRST--TQ 118

Query: 126 VKNWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHERNSNIW 185
            + W+ +YYYY Y V+PWQ +L  STP FTLLEGFFT+LGIQ +GE N WL     SN+W
Sbjct: 119 SQTWVFYYYYYQYVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNGSNMW 178

Query: 186 XXXXXXXXXXXXXXXXYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIVSHNGSV 245
                           YYLYRIY TPIW LSV  A+LLGFT S+V  LGIYGIVS  GS 
Sbjct: 179 VISGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSGRGST 238

Query: 246 IESSLFFAYIVRCIYXXXXXXXXXXXXXXXXGIKEVWQSHHANLNVADGFISYFYDSFHM 305
           IESSLFFAYIVRC+Y                 +KE W + H +L  +D  ++Y+ D    
Sbjct: 239 IESSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRDIILK 298

Query: 306 QAHKFWTLFTSRTPYYGYLHNYCMDYPSLVMIRSNFYPIWETLKTLTFSVPTSISELFHL 365
                W    +RT       N       +    +   P+W+ +K  T SVP+SI E+F+L
Sbjct: 299 NGEMVWDAILARTNV-----NVGASGTPVWASWNRVQPLWKFVKHFTSSVPSSIQEIFYL 353

Query: 366 TVRMAIDSVSPAIIINLCFRLMIFYSATRIIPAIQKRTRSETRKIRGIMKALYWYSPCIL 425
           T+ MA ++++PA++INLCFR++IFYSATRIIPA+QK+ +   R+ R  M+ LYWYSPCI+
Sbjct: 354 TLEMAREAIAPAVVINLCFRILIFYSATRIIPALQKKHK---RRSRRFMRMLYWYSPCIV 410

Query: 426 IAMYTHLILQYSGELKKDLCLWGCDSTWFGEDQERINVDAWSFWNWCNIFWTIIIYGSEL 485
           IAMYTHLILQYSG++  DLCLWGC   W   D  ++ VD+W FWNWCNIF T+ IY SEL
Sbjct: 411 IAMYTHLILQYSGQISNDLCLWGCFP-WSVPDTPKVVVDSWGFWNWCNIFCTMAIYASEL 469

Query: 486 IGGKK 490
           +G K 
Sbjct: 470 LGSKS 474

>Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {ON}
           YIL090W - Hypothetical ORF [contig 27] FULL
          Length = 475

 Score =  407 bits (1047), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 224/485 (46%), Positives = 298/485 (61%), Gaps = 14/485 (2%)

Query: 6   KNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGXXXXXXXXXXXXXXXXXNIIARRWG 65
           +++++S++V L  FYLL I+ TIPI+F++GGLYCG                  I AR  G
Sbjct: 4   RSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAARARG 63

Query: 66  SKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPKETFLDLLRGDIPVS 125
                 + S+ +Y Q+F IPSLL LFL+GF+N++L   I +  +P E+ +DLLR      
Sbjct: 64  FAK---LASAAYYAQHFFIPSLLFLFLSGFSNDELKHQIDTNTRPDESLIDLLRSS--TH 118

Query: 126 VKNWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHERNSNIW 185
            + W+ +YYYY Y V+PWQ +L  STP FTLLEGFFT+LGIQ +GE N WL     SN+W
Sbjct: 119 SQPWIFYYYYYHYVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHGSNVW 178

Query: 186 XXXXXXXXXXXXXXXXYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIVSHNGSV 245
                           YYLYRIY TPIW LSV  A+LLGFT S+V  LGI+GIVS  GS 
Sbjct: 179 VISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSGRGST 238

Query: 246 IESSLFFAYIVRCIYXXXXXXXXXXXXXXXXGIKEVWQSHHANLNVADGFISYFYDSFHM 305
           IESSLFFAYIVRC+Y                 +K+ W + H +L  +D F++Y+ D    
Sbjct: 239 IESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRDIILK 298

Query: 306 QAHKFWTLFTSRTPYYGYLHNYCMDYPSLVMIRSNFYPIWETLKTLTFSVPTSISELFHL 365
                W    +RT       N     P   +      P+W+ +K  T SVP+SI E+F L
Sbjct: 299 NGEMIWDAVLARTNV-----NVSGAGPVAWISWHRVQPLWKFVKHFTSSVPSSIQEIFLL 353

Query: 366 TVRMAIDSVSPAIIINLCFRLMIFYSATRIIPAIQKRTRSETRKIRGIMKALYWYSPCIL 425
           T+ MA ++++PA++INLCFR++IFYSATRIIPA+Q++ +   R+ R  M+ LYWYSPCI+
Sbjct: 354 TLSMAREAIAPAVVINLCFRILIFYSATRIIPALQRKHK---RRSRRFMRMLYWYSPCIV 410

Query: 426 IAMYTHLILQYSGELKKDLCLWGCDSTWFGEDQERINVDAWSFWNWCNIFWTIIIYGSEL 485
           IAMYTHLI+QYSG++  DLCLWGC   W   +  ++ VD+W FWNWCNIF T+ IY SEL
Sbjct: 411 IAMYTHLIMQYSGQISNDLCLWGC-FPWSPPEGSKVVVDSWGFWNWCNIFCTMAIYASEL 469

Query: 486 IGGKK 490
            G K 
Sbjct: 470 FGSKS 474

>TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON}
           Anc_2.293 YIL090W
          Length = 493

 Score =  382 bits (981), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 212/501 (42%), Positives = 293/501 (58%), Gaps = 19/501 (3%)

Query: 1   MRRVLKNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGXXXXXXXXXXXXXXXXXNII 60
           M +VLKNL  S +      YLL+++ T+PI+F++GGL CG                 N I
Sbjct: 1   MSQVLKNLGESTRFFFAGIYLLSVLMTVPIAFQLGGLQCGLAFTLTLFSSYFITTTLNAI 60

Query: 61  ARRWGSKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPKETFLDLLRG 120
           AR+   +  I  T+  +YFQNF I  +LH+FL+ F++ +L  S+       ET   +L+ 
Sbjct: 61  ARKLRWQRFIAWTNFLYYFQNFNIIGILHIFLSLFSHTELSISMSDENPSMETITSILKN 120

Query: 121 DIPVSVKNWLLFYYYYSYTVKP-WQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHE 179
           +     K     Y Y+ Y   P W+  LSYSTP+F L+EGFFTIL IQ IGE N WL   
Sbjct: 121 NDTYPSKTISFIYKYFFYYAMPRWKFCLSYSTPLFALVEGFFTILAIQVIGETNIWLTTV 180

Query: 180 RNSNIWXXXXXXXXXXXXXXXXYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIV 239
           +NS+IW                YY+Y+IY TP+W+LS   A+LL FT SLVG + IYGIV
Sbjct: 181 KNSSIWIILSLIMSSSMVTTSIYYIYKIYVTPLWHLSNQVASLLSFTFSLVGGVAIYGIV 240

Query: 240 SHNGSVIESSLFFAYIVRCIYXXXXXXXXXXXXXXXXGIKEVWQSHHANLNVADGFISYF 299
           SH GSV+ESSLFFAYIV CIY                 +KE WQ H  N  ++D  + Y+
Sbjct: 241 SHRGSVVESSLFFAYIVCCIYEISPIMATTAMDDIFDTLKESWQIHQRNFFISDNLLIYY 300

Query: 300 YDSFHMQAHKFWTL----FTSRTPYYGYLHNYCMDYPSLVMIRSNFYPIWETLKTLTFSV 355
           Y+S      +F  L     T++  +    ++  + +  + + + +F  I +  K  T  +
Sbjct: 301 YNSLIKNVDEFIKLKIIKLTTKDNFSNKFNS--LLFQCVKISKKSFKFILKLSKRFTLGI 358

Query: 356 PTSISELFHLTVRMAIDSVSPAIIINLCFRLMIFYSATRIIPAIQKRTRS------ETRK 409
           P+SI EL+ +T++MA +S+SP I++NLC+R++IFY+ATRIIPA++ R+        +T+ 
Sbjct: 359 PSSIYELYSITLKMASESISPVILVNLCYRVLIFYAATRIIPALESRSNGFSNNNIKTKS 418

Query: 410 IRGIMKALYWYSPCILIAMYTHLILQYSGELKKDLCLWGCDSTWFGEDQERINVDAWSFW 469
               MK LYWYSPCILIAMYT+LILQYSGELK +  LW   +         + VD+W FW
Sbjct: 419 NSKFMKVLYWYSPCILIAMYTNLILQYSGELKSEFKLWNNSNN------NEVVVDSWRFW 472

Query: 470 NWCNIFWTIIIYGSELIGGKK 490
           NWCNIFWTI +YGSELIGG+K
Sbjct: 473 NWCNIFWTITLYGSELIGGRK 493

>ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL090W
          Length = 502

 Score =  370 bits (949), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 213/515 (41%), Positives = 293/515 (56%), Gaps = 43/515 (8%)

Query: 4   VLKNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGXXXXXXXXXXXXXXXXXNIIARR 63
           V K L+RS++  L  FYL  ++ T+PISF+IGGLYCG                  I A  
Sbjct: 2   VPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAAT 61

Query: 64  WGSKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPK------------ 111
            G +   I  S+ +Y Q+F++PS+L LFL+GF N+ L K +  G  PK            
Sbjct: 62  RGDEWKHI-ASTLYYLQHFLMPSILFLFLSGFNNDQLQKKL-VGSDPKGARGGFIFDGNM 119

Query: 112 -ETFLDLL---RGDIPVSVKNWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQ 167
            E+ L LL   R D     +  + + +YY Y V+PWQ +L ++TP FTL EGFFT+L IQ
Sbjct: 120 NESLLQLLGRSRDD-----RATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQ 174

Query: 168 TIGEMNTWLKHERNSNIWXXXXXXXXXXXXXXXXYYLYRIYATPIWNLSVGAATLLGFTL 227
            IGE   WL+++RNS  W                YYLYRIY TPIW LSV  ATLLGFTL
Sbjct: 175 VIGETGRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTL 234

Query: 228 SLVGSLGIYGIVSHNGSVIESSLFFAYIVRCIYXXXXXXXXXXXXXXXXGIKEVWQSHHA 287
           SLV  LG+YGI+S  GS IESSLFFAY+V CIY                 +   WQ    
Sbjct: 235 SLVFGLGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQG 294

Query: 288 NLNVADGFISYFYDSFHMQAHKFWTLFTSRTPYYGYLHNYCMDY-PSLVMIRSNF----- 341
            L   +  ++Y Y +F + A   W +   +      LH+  +D  PS V+++        
Sbjct: 295 TLP-KNSLLAY-YKNFILNAENLWDVLLKKA---FLLHSVELDQAPSSVVVKDALVLVQQ 349

Query: 342 ------YPIWETLKTLTFSVPTSISELFHLTVRMAIDSVSPAIIINLCFRLMIFYSATRI 395
                   +W   K  +  +P SI E+F +T+ +A +S++ A++ NL FR+++FYSATRI
Sbjct: 350 QWWNKSQQLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRI 409

Query: 396 IPAIQKRTRSETRKIRGIMKALYWYSPCILIAMYTHLILQYSGELKKDLCLWGCDSTWFG 455
           IPA+Q+ T     + R +M+ +YWYSPCI+IAMYTH+IL+YSGEL  +LC+WGC      
Sbjct: 410 IPALQRATGGT--QSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFPWLQS 467

Query: 456 E-DQERINVDAWSFWNWCNIFWTIIIYGSELIGGK 489
           E +++R  VDAW FWNWCN+F+T++IY  ELIG +
Sbjct: 468 EANRDRWVVDAWGFWNWCNLFFTLLIYAVELIGSR 502

>Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar to
           Ashbya gossypii ADL208W
          Length = 513

 Score =  357 bits (917), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 210/518 (40%), Positives = 298/518 (57%), Gaps = 42/518 (8%)

Query: 6   KNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGXXXXXXXXXXXXXXXXXNIIARRWG 65
           + L+RS++  L  FYL  ++ TIPISF++GGLYCG                  I     G
Sbjct: 4   RGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSFTVTLFILYFTTTTLKITTTN-G 62

Query: 66  SKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPKETFLDLLRGDI--- 122
           S    ++ S  +Y Q+F+IPS+L LFL+ F ++ L + + S      +   +  G++   
Sbjct: 63  SGKFKLLASLIYYLQHFLIPSILFLFLSAFNSDQLQRLVDSDAVGASSKGFIFEGNVNES 122

Query: 123 -----------PVSVKNWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGE 171
                        SV +   +YYYY Y VKPWQ +L ++TP FTL EGFFT+L IQ IGE
Sbjct: 123 LLQLLSLPPGNEGSVAS---YYYYYKYIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGE 179

Query: 172 MNTWLKHERNSNIWXXXXXXXXXXXXXXXXYYLYRIYATPIWNLSVGAATLLGFTLSLVG 231
              WL++++NSN W                +YLYRIY TPIW LSV  ATLLGFTLSLV 
Sbjct: 180 TGRWLRYKKNSNTWVILSLLVSGVVITTSMFYLYRIYVTPIWPLSVQTATLLGFTLSLVF 239

Query: 232 SLGIYGIVSHNGSVIESSLFFAYIVRCIYXXXXXXXXXXXXXXXXGIKEVWQSHHANLNV 291
            LG+YGI+S  GS IESSLFFAY+VRCIY                 + + WQ     L+ 
Sbjct: 240 GLGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTLS- 298

Query: 292 ADGFISYFYDSFHMQAHKFWTLFTSRTP------------YYGYLHNY--CMDYPSLVMI 337
            +  ++Y Y++F   A  FW     +T              +GY   +   +   +L+++
Sbjct: 299 KNNLLTY-YNTFVSNAESFWDSLLKKTAIGTAAAAEETYTIFGYSMPFTSTIAKDTLIIL 357

Query: 338 RSNFY----PIWETLKTLTFSVPTSISELFHLTVRMAIDSVSPAIIINLCFRLMIFYSAT 393
           ++ ++     IW   K  +  +P SI E+  +T++MA +S++PA+I NL FR+++FYSAT
Sbjct: 358 QTQWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSAT 417

Query: 394 RIIPAIQKRTRSETRKIRGIMKALYWYSPCILIAMYTHLILQYSGELKKDLCLWGCDS-- 451
           RIIPA+QK T +   + R +M+ +YWYSPCI+IAMYTHLIL+YSGEL  DLC+WGC    
Sbjct: 418 RIIPALQKATGAT--QSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGCFPWL 475

Query: 452 TWFGEDQERINVDAWSFWNWCNIFWTIIIYGSELIGGK 489
            +  + + +  VDAWSFWNWCN+F+T++IY  ELIG +
Sbjct: 476 NFSAKTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGSR 513

>KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 486

 Score =  353 bits (906), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 202/492 (41%), Positives = 279/492 (56%), Gaps = 47/492 (9%)

Query: 1   MRRVLKNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGXXXXXXXXXXXXXXXXXNII 60
           M  + K++++++++ L   YL  ++ TIPISF++GGL CG                  ++
Sbjct: 40  MPLIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLV 99

Query: 61  ARRWGSKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPKETFLDLLRG 120
               GS  + +I    +Y Q+ +IPS+L +FL+ F N D                D +  
Sbjct: 100 LLDRGSALSTLI----YYLQHLLIPSILFMFLSYFENID---------------SDTVDS 140

Query: 121 DIPVSVKNWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHER 180
           +          F  +++  VKPWQ+ L +STPVFTLLEG FTIL IQ IGE   WLK  R
Sbjct: 141 E---------YFKVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSR 191

Query: 181 NSNIWXXXXXXXXXXXXXXXXYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIVS 240
            SN W                +Y YRIY TP+W LS  +A+LLGFT S+V  +G+YGI +
Sbjct: 192 RSNQWVILSLLISGGIITLSLFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-N 250

Query: 241 HNGSVIESSLFFAYIVRCIYXXXXXXXXXXXXXXXXGIKEVWQSHHANLNVADGFISYFY 300
            +GSV+ESSLFFAY+VR +Y                 +KE W+ H ANL   D  +    
Sbjct: 251 GSGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLLELMT 310

Query: 301 DSFHMQAHKFWTLFTSRTPYYGYLHNY--CMDYPSLVMIRSNFYPIWETLKTLTFSVPTS 358
            ++       W+     TP     H Y   MD    ++      P+W ++K  T SVP S
Sbjct: 311 KNY----RAIWSQIVEHTPRN---HKYIKMMDQCKWIL-----NPLWNSVKNFTKSVPIS 358

Query: 359 ISELFHLTVRMAIDSVSPAIIINLCFRLMIFYSATRIIPAIQKRTRSETRKIRGIMKALY 418
           I E+F +T +MA +S+ PA++INL FRL+IFYSATRIIP +Q+ T+ E R  R IM  +Y
Sbjct: 359 IQEIFVVTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQRNTK-ERRSFRRIMNFVY 417

Query: 419 WYSPCILIAMYTHLILQYSGELKKDLCLWGCDSTWFGEDQERINVDAWSFWNWCNIFWTI 478
           WYSPCI+IAMYTHLIL+YSG+LK DLC+WGC   +  E + +I VD+WSFWNWCNI+ T+
Sbjct: 418 WYSPCIIIAMYTHLILRYSGQLKNDLCIWGC---FPYETEPKIVVDSWSFWNWCNIYSTM 474

Query: 479 IIYGSELIGGKK 490
           +IY  EL+G  K
Sbjct: 475 LIYALELMGSNK 486

>TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON} 
          Length = 536

 Score =  352 bits (902), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 209/532 (39%), Positives = 308/532 (57%), Gaps = 48/532 (9%)

Query: 4   VLKNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGXXXXXXXXXXXXXXXXXNIIARR 63
           V+K++ +S++++  CFYL++++ TIP +FKIGGLYCG                 ++IA+R
Sbjct: 4   VVKSVKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLIAKR 63

Query: 64  WGSKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPK-ETFLDLLRGDI 122
             +   I++++  +Y Q+ +I SLL++F+  F++ +L + + +    +  + L  ++ D 
Sbjct: 64  TLNNFYILLSTLVYYLQHIVIASLLYIFITIFSDGNLNEILSNNKTDQLPSLLYYIKNDT 123

Query: 123 PVSVK---NWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHE 179
             SV    ++LLFYYYY Y V+PW  +LS+STP FTLLEGFFTILGIQ IGE   WL  +
Sbjct: 124 SKSVSQNFHYLLFYYYYYYAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYCWLLLK 183

Query: 180 RNSNIWXXXXXXXXXXXXXXXXYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIV 239
           +   I+                ++LY+IY   +W LS+  A+LLG T+SLV ++GI+GI 
Sbjct: 184 KQKKIFKLLTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVGIFGIF 243

Query: 240 SHNGSVIESSLFFAYIVRCIYXXXXXXXXXXXXXXXXGIKEVWQSHHANLNVADGFI--- 296
           S NGS+IESSLF  YI+RC Y                 IKE WQ+H  ++ V +  +   
Sbjct: 244 STNGSLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEHILFYY 303

Query: 297 ----------SYFYDSFHMQAHKFWTLFTSRTPYYGYLHNYCM-------DYPSLVMIRS 339
                     SY ++S   +++       +        +NY +       D   L+  +S
Sbjct: 304 NNVLLKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKPSDLIHLIGFKS 363

Query: 340 NFY-------PIWETLKTLTFSVPTSISELFHLTVRMAIDSVSPAIIINLCFRLMIFYSA 392
            +        PI+E LK    ++PTS++ L  +T ++A DSVSP+I+INLCFR++IFYSA
Sbjct: 364 IYQNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRVLIFYSA 423

Query: 393 TRIIPAIQKRTRSETRKIRGIMKALYWYSPCILIAMYTHLILQYSGELKKDLCLWGCD-- 450
           TRIIPA+Q++   ET++ R  +KA Y +SPCI+IAMYT+LILQYSGELK DLC+WGCD  
Sbjct: 424 TRIIPAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCIWGCDII 483

Query: 451 STWFGEDQERINVD---------------AWSFWNWCNIFWTIIIYGSELIG 487
           S    +    IN+D               +W FWNWCNIF TI IYG EL+G
Sbjct: 484 SKSISQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCELMG 535

>TDEL0E01740 Chr5 complement(335052..336323) [1272 bp, 423 aa] {ON}
           Anc_4.199 YLR360W
          Length = 423

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 27/43 (62%)

Query: 139 TVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHERN 181
           +V P  +I SY+ P+F + +GF+T+ G+     ++ +  H+RN
Sbjct: 117 SVNPNDLIDSYNAPLFEMTDGFYTLPGLPAARIVSDFSSHKRN 159

>Kwal_33.13758 s33 (380210..381925) [1716 bp, 571 aa] {ON} YJL172W
           (CPS1) - 1:1 [contig 112] FULL
          Length = 571

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 38/107 (35%), Gaps = 8/107 (7%)

Query: 218 GAATLLGFTLSLVGSLGIYGIVSHNGSVIESSLFFAYIVRCIYXXXXXXXXXXXXXXXXG 277
           GA T+  F     G  GIY IV   G+V++      Y    I                 G
Sbjct: 239 GAQTMGAFLHDRYGDDGIYSIVDEGGAVLQLDKNI-YAAAAITGEKGYVDVEVTVHGHGG 297

Query: 278 IKEVWQSHHANLNVADGFISYFYDSFHMQAHKFWTLFTSRTPYYGYL 324
              V    H  + +A   I        ++AH F   FT + P+YG L
Sbjct: 298 HSSV-PPDHTTIGIAAQLIK------ELEAHPFEPAFTPQNPFYGLL 337

>NCAS0B06140 Chr2 complement(1162144..1163475) [1332 bp, 443 aa]
           {ON} Anc_2.306
          Length = 443

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query: 288 NLNVADGFISYFYDSF--HMQAHKFWTLFTSRTPYYGYL 324
           N++V D  +S+ +D F  ++QAH  W + T R+  YG++
Sbjct: 179 NVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFV 217

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.329    0.142    0.467 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,257,989
Number of extensions: 1823758
Number of successful extensions: 5627
Number of sequences better than 10.0: 28
Number of HSP's gapped: 5611
Number of HSP's successfully gapped: 30
Length of query: 490
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 376
Effective length of database: 40,409,475
Effective search space: 15193962600
Effective search space used: 15193962600
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 68 (30.8 bits)