Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1003.402.290ON26126113940.0
SAKL0E07590g2.290ON2602628881e-121
KLTH0G10450g2.290ON2612628601e-116
TDEL0G022002.290ON2612618401e-113
TPHA0C034202.290ON2682668351e-112
YIL093C (RSM25)2.290ON2642458301e-112
ZYRO0A01958g2.290ON2632638251e-111
Smik_9.862.290ON2642458131e-109
Suva_9.1062.290ON2642458091e-109
Skud_9.802.290ON2642458081e-108
Ecym_33292.290ON2582628061e-108
KLLA0E08273g2.290ON2612638021e-107
KAFR0J013502.290ON2642487971e-107
Kwal_27.115092.290ON2612627921e-106
TBLA0B059602.290ON2662517861e-105
NDAI0B035402.290ON2612587851e-105
KNAG0A054102.290ON2662407611e-101
CAGL0D04158g2.290ON2722577273e-96
NCAS0B062402.290ON2602437101e-93
ADL211C2.290ON2251905966e-77
Kpol_1004.475.560ON675124780.26
NDAI0C056508.566ON42953701.9
NDAI0K013802.447ON53499675.5
NCAS0D039006.258ON31048657.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1003.40
         (261 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON...   541   0.0  
SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar...   346   e-121
KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {O...   335   e-116
TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON...   328   e-113
TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON...   326   e-112
YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}  R...   324   e-112
ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {O...   322   e-111
Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON} ...   317   e-109
Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}...   316   e-109
Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON} ...   315   e-108
Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON} ...   315   e-108
KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar...   313   e-107
KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.2...   311   e-107
Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C...   309   e-106
TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {...   307   e-105
NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.29...   306   e-105
KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.29...   297   e-101
CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {O...   284   3e-96
NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2....   278   1e-93
ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON} Sy...   234   6e-77
Kpol_1004.47 s1004 (100685..102712) [2028 bp, 675 aa] {ON} (1006...    35   0.26 
NDAI0C05650 Chr3 (1305925..1307214) [1290 bp, 429 aa] {ON} Anc_8...    32   1.9  
NDAI0K01380 Chr11 (316616..318220) [1605 bp, 534 aa] {ON} Anc_2....    30   5.5  
NCAS0D03900 Chr4 (726411..727343) [933 bp, 310 aa] {ON} Anc_6.25...    30   7.5  

>Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON}
           complement(97903..98688) [786 nt, 262 aa]
          Length = 261

 Score =  541 bits (1394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/261 (100%), Positives = 261/261 (100%)

Query: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60
           MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL
Sbjct: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60

Query: 61  HSLDSSAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPKIL 120
           HSLDSSAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPKIL
Sbjct: 61  HSLDSSAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPKIL 120

Query: 121 IENNGDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLRMQQ 180
           IENNGDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLRMQQ
Sbjct: 121 IENNGDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLRMQQ 180

Query: 181 HIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPSESWA 240
           HIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPSESWA
Sbjct: 181 HIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPSESWA 240

Query: 241 TDEKDPKKNDDIEEDVEEIKL 261
           TDEKDPKKNDDIEEDVEEIKL
Sbjct: 241 TDEKDPKKNDDIEEDVEEIKL 261

>SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 260

 Score =  346 bits (888), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 170/262 (64%), Positives = 205/262 (78%), Gaps = 3/262 (1%)

Query: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60
           MK+Q NAVN+LERTSAYLRAGLLTK PAWYNVVASVPP K F R PK+TNPSN++    L
Sbjct: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60

Query: 61  HSLDSSAG-NNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPKI 119
                + G  NG +KTR +  DR  +  +LY A KL Y ED+LRE+FY+QHPWELSRPK+
Sbjct: 61  SEYSETVGIKNGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPKV 120

Query: 120 LIENNGDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLRMQ 179
           LIEN G+E YDWS +QQ+GKPLDGESVVQRTLYL+K K+  +LV AYD AR+EFYR+R+Q
Sbjct: 121 LIENTGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVRVQ 180

Query: 180 QHIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPSESW 239
           Q I EQVAQEEAEMFGSVFG S+IEYG++KEQKVI+TWK+KAI QTE+MAAR   PS   
Sbjct: 181 QEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSSGPSA-- 238

Query: 240 ATDEKDPKKNDDIEEDVEEIKL 261
           A +       + +E+DVEE++L
Sbjct: 239 AWENAAEANEESVEQDVEELQL 260

>KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 261

 Score =  335 bits (860), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 157/262 (59%), Positives = 206/262 (78%), Gaps = 2/262 (0%)

Query: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60
           MK+Q+NAVNVLERTS+YL+AGLL K PAWY+VVA VPP K+F R P+L NPS ++   +L
Sbjct: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60

Query: 61  HSL-DSSAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPKI 119
               +  +  N  +KTR +  +R  +  +L++A KL Y ED+LRE+FY+QHPWELSRPK+
Sbjct: 61  SEFAEQYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPKM 120

Query: 120 LIENNGDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLRMQ 179
           L+EN+G   YDWS +QQ+GKPLDGESVVQRTLYL++ K    L+ AYD AR+EFYRLR+Q
Sbjct: 121 LVENSGTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLRIQ 180

Query: 180 QHIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPSESW 239
           + ++ QVAQEEAEMFGSVFGPSAI++G++KEQK+ID WK+KAI QTE+M+AR INPSESW
Sbjct: 181 EEVQNQVAQEEAEMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSESW 240

Query: 240 ATDEKDPKKNDDIEEDVEEIKL 261
           +  E  P ++D   ED +E++L
Sbjct: 241 SAQESQP-QSDAKAEDTKELQL 261

>TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON}
           Anc_2.290 YIL093C
          Length = 261

 Score =  328 bits (840), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 162/261 (62%), Positives = 205/261 (78%)

Query: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60
           MKIQ NAVNVLERTSAYLR+GLL   PAWY+VVAS+PP  KF R P+L NPSN +    L
Sbjct: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60

Query: 61  HSLDSSAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPKIL 120
                     G FKTR +  D+   + +LY A KL ++EDQLRE+FYKQHPWELSRPK+L
Sbjct: 61  KDHADEPNAKGFFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPKVL 120

Query: 121 IENNGDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLRMQQ 180
           +EN+ +E++DWSH+QQ+ KPLDGESV+QRTL+L+KN E  SL  AYD AR+EFYRLRMQQ
Sbjct: 121 VENDAEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLRMQQ 180

Query: 181 HIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPSESWA 240
            +E+QVAQEE+EMFGS++GPSAI++G+Q+EQK ID WK+KAI +T+++AARR NPSE+WA
Sbjct: 181 EVEQQVAQEESEMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPSEAWA 240

Query: 241 TDEKDPKKNDDIEEDVEEIKL 261
             E+ P K D  ++D+EEI L
Sbjct: 241 AGEEQPDKKDLEDQDIEEIVL 261

>TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON}
           Anc_2.290 YIL093C
          Length = 268

 Score =  326 bits (835), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 168/266 (63%), Positives = 207/266 (77%), Gaps = 12/266 (4%)

Query: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60
           MKIQ+NAVNVLERTS+YLR+GLLTKQPAWYNVVA +PP KKFER PK TNPSN++   +L
Sbjct: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60

Query: 61  HSLD----SSAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSR 116
             +D    S      +FK+RY   D+ ++SK +Y  +KL+YIEDQLRE+FY QHPWELSR
Sbjct: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120

Query: 117 PKILIENNGDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYD----MARYE 172
           PKI++ENNGDE YDWSH+QQ+GK LDGE+VVQR +YLMK K    L++ +      ARYE
Sbjct: 121 PKIVVENNGDETYDWSHIQQLGKALDGENVVQRAMYLMKKK----LIMIFQKHTIKARYE 176

Query: 173 FYRLRMQQHIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARR 232
           FYR+RMQ  IEEQVAQEEAEMFGSVFGPS IE+G+ +EQKVID WKRKAI +TE+M A+R
Sbjct: 177 FYRVRMQSEIEEQVAQEEAEMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKR 236

Query: 233 INPSESWATDEKDPKKNDDIEEDVEE 258
            NPSE+WA ++++     D E+  EE
Sbjct: 237 TNPSETWAQEKEEDVNYPDGEQITEE 262

>YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}
           RSM25Mitochondrial ribosomal protein of the small
           subunit
          Length = 264

 Score =  324 bits (830), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 155/245 (63%), Positives = 190/245 (77%), Gaps = 3/245 (1%)

Query: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60
           MKIQ NAVNVL+RTSAYL++GLL + PAWYNVVAS+PP  KF R P+  NPSN  I G+L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFKNPSNGHIIGKL 60

Query: 61  HSLDSS--AGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPK 118
             +     A N G++KTR  + D+    K+LY   KLTY+ED+LR +FYKQHPWELSRPK
Sbjct: 61  VDVTEQPHANNKGLYKTRPNSSDKRVGVKRLYRPPKLTYVEDRLRSLFYKQHPWELSRPK 120

Query: 119 ILIENN-GDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLR 177
           IL+EN  GDE YDWSHM QIG+PLDGESV+QRT+YL+K K+   +V AYD ARYEFY LR
Sbjct: 121 ILVENEIGDENYDWSHMLQIGRPLDGESVIQRTMYLIKTKQYGDMVEAYDHARYEFYALR 180

Query: 178 MQQHIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPSE 237
           MQ+  E+QVA EEAEMFGS+FG SAIE+GIQKEQ+V+D W++K + +TE+MAAR  NP+ 
Sbjct: 181 MQEETEQQVALEEAEMFGSLFGVSAIEHGIQKEQEVLDVWEKKVVEETELMAARTSNPAG 240

Query: 238 SWATD 242
           SW  D
Sbjct: 241 SWKDD 245

>ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 263

 Score =  322 bits (825), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 151/263 (57%), Positives = 196/263 (74%), Gaps = 2/263 (0%)

Query: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60
           MK+Q NAVNVLERTSAYLR+GLL + PAWY VVASVPP  KF R  +  NPS  +   Q 
Sbjct: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60

Query: 61  HSLDSSAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPKIL 120
              D      G +KTR ++ DR     +LY A KL ++EDQLRE+FY+QHPWE SRPK+L
Sbjct: 61  KEFDEGINRKGFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPKML 120

Query: 121 IENNGDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLRMQQ 180
           +EN  +E +DWS+M Q+GKPLDGESVVQRT+YL++      ++ AYD  R+EFYRLRMQ+
Sbjct: 121 VENEINENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLRMQE 180

Query: 181 HIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPSESWA 240
            IE+QVAQEEAEMFGSVF  SAI+YG+++EQ+VID WK+KAI +TE++AARR +P+ESW 
Sbjct: 181 EIEQQVAQEEAEMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPAESWG 240

Query: 241 TD--EKDPKKNDDIEEDVEEIKL 261
            +  E +P K+D+  ++ EE+ L
Sbjct: 241 QEKQEGEPNKSDEDGQETEELHL 263

>Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  317 bits (813), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 152/245 (62%), Positives = 187/245 (76%), Gaps = 3/245 (1%)

Query: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60
           MKIQ NAVNVL+RTSAYL++GLL   PAWYNVVAS+PP  KF R P   NPSN    G+L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPHFENPSNGHTIGRL 60

Query: 61  HSL--DSSAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPK 118
             +  +    +NG++KTR    D+    K+LY   KLTY+ED+LR +FYKQHPWELSRPK
Sbjct: 61  VDVIENQHTNSNGLYKTRPNTNDKRIGVKKLYKPPKLTYVEDRLRTLFYKQHPWELSRPK 120

Query: 119 ILIENN-GDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLR 177
           IL+EN  GDE YDWSHM Q+GKPLDGESV+QRT+YL+K K+  + V AYD ARYEFY LR
Sbjct: 121 ILVENEIGDEDYDWSHMLQLGKPLDGESVIQRTMYLLKTKQYENTVEAYDHARYEFYALR 180

Query: 178 MQQHIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPSE 237
           MQ+  ++QVA EEAEMFGS+FG SAIE+GIQKEQ+V++ W++K I +TE+MAAR  NP+ 
Sbjct: 181 MQEETQQQVALEEAEMFGSIFGKSAIEHGIQKEQEVLNIWEKKVIEETELMAARSSNPAG 240

Query: 238 SWATD 242
           SW  D
Sbjct: 241 SWKDD 245

>Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  316 bits (809), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 152/245 (62%), Positives = 188/245 (76%), Gaps = 3/245 (1%)

Query: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60
           MKIQ NAVNVL+RTSAYL++GLL   PAWYNVVAS+PP  KF R P+  NPSN RI G+L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPRFKNPSNGRIIGKL 60

Query: 61  HSLD--SSAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPK 118
             +     A  NG++KTR    DR    K+LY   KLTY+ED+LR +FYKQHPWELSRPK
Sbjct: 61  VDVTERQQANANGLYKTRPNPNDRRVGVKKLYKPPKLTYVEDRLRVLFYKQHPWELSRPK 120

Query: 119 ILIENN-GDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLR 177
           IL+EN  GDE YDWSHM Q+GK LDGESV+QRT++L+K ++   +V AYD ARYEFY LR
Sbjct: 121 ILVENEVGDENYDWSHMLQLGKVLDGESVIQRTMHLLKTQQYKDMVEAYDHARYEFYALR 180

Query: 178 MQQHIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPSE 237
           M++  ++QVA EEAEMFGS+FG S+IE+GIQKEQ+V+D W++K I +TE+MAAR  NP+ 
Sbjct: 181 MEEETQQQVALEEAEMFGSIFGVSSIEHGIQKEQEVLDVWEKKVIEETELMAARSSNPAG 240

Query: 238 SWATD 242
           SW  D
Sbjct: 241 SWKDD 245

>Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  315 bits (808), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 151/245 (61%), Positives = 187/245 (76%), Gaps = 3/245 (1%)

Query: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60
           MKIQ NAVNVL+RTSAYL++GLL + PAWYNVVAS+PP  KF R P+  NPSN    G+L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60

Query: 61  HSLDS--SAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPK 118
             +     A  NG++KTR    D+  + K+LY   KLTY+ED+LR +FYKQHPWELSRPK
Sbjct: 61  DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK 120

Query: 119 ILIENN-GDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLR 177
           IL+EN  GDE YDW  M Q+GKPLDGESVVQRT++L+K K+   +V AYD ARYEFY LR
Sbjct: 121 ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR 180

Query: 178 MQQHIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPSE 237
           MQ+  ++QVA EEAEMFGS+FG SAIE+GIQKEQ+V+D W++K I +TE+MAA+  NP+ 
Sbjct: 181 MQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNPAG 240

Query: 238 SWATD 242
           SW  D
Sbjct: 241 SWKDD 245

>Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON}
           similar to Ashbya gossypii ADL211C
          Length = 258

 Score =  315 bits (806), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 150/262 (57%), Positives = 195/262 (74%), Gaps = 5/262 (1%)

Query: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60
           MKIQ NA N+LERTS++LR GLL + P WY+V+   PP  KF R PKL NPS      +L
Sbjct: 1   MKIQTNATNILERTSSFLRVGLLARTPVWYDVIVKSPPSTKFARQPKLVNPSTGAYTAKL 60

Query: 61  HSL-DSSAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPKI 119
               D+   ++G +KTR    ++  ++  +Y A KL Y ED+LR +FYKQHPWELSRPKI
Sbjct: 61  REFSDNRNSSSGTYKTRANKHEKRVSTSAVYRAPKLYYFEDKLRSLFYKQHPWELSRPKI 120

Query: 120 LIENNGDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLRMQ 179
           L+EN GDEK+DWS +QQ+GKPLDGESVVQRTLYL+ + E  +L+ AYD AR+EFYRLRMQ
Sbjct: 121 LVENQGDEKHDWSRIQQLGKPLDGESVVQRTLYLLGSGEHTNLIDAYDQARFEFYRLRMQ 180

Query: 180 QHIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPSESW 239
           Q +EEQVAQEEA M GSVFGPSA+E+G++KEQ+VID WK+KA+ Q E+M+A+R + S +W
Sbjct: 181 QELEEQVAQEEAGMLGSVFGPSAVEFGLRKEQEVIDDWKKKALKQVELMSAKRSDQSANW 240

Query: 240 ATDEKDPKKNDDIEEDVEEIKL 261
            T E +   ND +E  +EE++L
Sbjct: 241 GTREDNA--NDAVE--IEELEL 258

>KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 261

 Score =  313 bits (802), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 157/263 (59%), Positives = 209/263 (79%), Gaps = 4/263 (1%)

Query: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60
           MK+Q+ AVNVLERTSAYL++G+L K PAWYNV+A VPP KKF R P+LT+P N +    L
Sbjct: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60

Query: 61  HSLDS-SAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPKI 119
               +  A ++G++KTR  + ++ + + +LY + KL YIED+LR++F++QHPWELSRPKI
Sbjct: 61  PDYSNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPKI 120

Query: 120 LIENNGD-EKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLRM 178
           L+EN  + ++YDWSH+QQ+GKPLDGESVVQRTL+L+K+ E   L+ AYD AR+EFYRLR+
Sbjct: 121 LVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLRI 180

Query: 179 QQHIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPSES 238
           QQ I++QVAQEEAEMFGSVF  ++IEYGI KEQKVIDTWKRKA+ Q E+MAAR  +PS S
Sbjct: 181 QQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAARASSPSAS 240

Query: 239 WATDEKDPKKNDDIEEDVEEIKL 261
           W  + ++ +K   I++DVEEI+L
Sbjct: 241 WTNETEEEQK--PIDQDVEEIQL 261

>KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.290
           YIL093C
          Length = 264

 Score =  311 bits (797), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 147/248 (59%), Positives = 187/248 (75%), Gaps = 1/248 (0%)

Query: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60
           MKIQ NA N+LERTSAYL+AGLL   PA+Y+V+A VPP  KF R PKL NPS  +   + 
Sbjct: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60

Query: 61  HSLDSSAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPKIL 120
             L       G++KTRY A DR  +  +LY AS+L Y+ED LR++FY QHPWELSRPKI+
Sbjct: 61  RELTDKVNWRGLYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPKIV 120

Query: 121 IENNGD-EKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLRMQ 179
           IENN D    DWS++QQ+GKP+DGESVVQRTL+LMKNK+  +L   YD AR+EFY++RMQ
Sbjct: 121 IENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVRMQ 180

Query: 180 QHIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPSESW 239
           +  EEQ+A EEA MFGS+FGP+A+EYGIQ+EQ VI  WK++AI +TE++ A+R NPS+SW
Sbjct: 181 RDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANPSDSW 240

Query: 240 ATDEKDPK 247
           A +E   K
Sbjct: 241 AQEESSDK 248

>Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C
           (RSM25) - mitochondrial ribosome small subunit component
           [contig 27] FULL
          Length = 261

 Score =  309 bits (792), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 155/262 (59%), Positives = 201/262 (76%), Gaps = 2/262 (0%)

Query: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPS-NDRINGQ 59
           MK+Q+NAVNVLERTS+YLRAG+L K PAWY VVA +PP K+F R P+L NPS ND I   
Sbjct: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60

Query: 60  LHSLDSSAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPKI 119
               +S    N  +KTR +  D+  +  +LY A KL Y ED+LRE+F++QHPWELSRPK+
Sbjct: 61  SEFRESYNFENRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPKM 120

Query: 120 LIENNGDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLRMQ 179
           L+EN+G + YDWS +QQ+GKPLDGESVVQRTLYL+K+K+   L+ AYD AR+EFYRLR+Q
Sbjct: 121 LVENSGIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLRIQ 180

Query: 180 QHIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPSESW 239
           + ++ QVAQEEAEM GSVFGPSAI++G++KEQK+ID WK+KAI Q+E+++AR  NPSES 
Sbjct: 181 EEVQNQVAQEEAEMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSARNTNPSES- 239

Query: 240 ATDEKDPKKNDDIEEDVEEIKL 261
            +     + ND   ++ EEIKL
Sbjct: 240 WSSSPSSQDNDSKVQETEEIKL 261

>TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {ON}
           Anc_2.290 YIL093C
          Length = 266

 Score =  307 bits (786), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 146/251 (58%), Positives = 192/251 (76%), Gaps = 1/251 (0%)

Query: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60
           MKIQ+NAVNVLERTSAYL+AG++ K P WY+VVA+ PP KKF R PK  NPS ++   + 
Sbjct: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60

Query: 61  HSL-DSSAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPKI 119
             L D      G++KTR  + D+ NA   LY   KLTYIED+LR++FY+QHPWEL+RPKI
Sbjct: 61  KPLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRPKI 120

Query: 120 LIENNGDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLRMQ 179
           ++EN+G+  YDWS + Q+GKPLDGESVVQRTL+L+K KE   L+ AY+ AR+EFYRLRM 
Sbjct: 121 VMENHGEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRLRMA 180

Query: 180 QHIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPSESW 239
           + I+EQVAQEE+EMFG+VFG + IE+GI+KEQ++ID+WK +AI +TEI  A+R   S SW
Sbjct: 181 EEIQEQVAQEESEMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRSKESVSW 240

Query: 240 ATDEKDPKKND 250
            TD  + K+++
Sbjct: 241 KTDSLEGKEDE 251

>NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.290
           YIL093C
          Length = 261

 Score =  306 bits (785), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 148/258 (57%), Positives = 191/258 (74%), Gaps = 5/258 (1%)

Query: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60
           MKIQ NAVN++ERTSAYL +GLL   PAWY+VVAS+PP KKF R PK+TNP+  R     
Sbjct: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRNKTFF 60

Query: 61  HSLDSSAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPKIL 120
                   N G++KTR    DR +++  LY   KL Y+ED+LR +F++QHPWELSRPKIL
Sbjct: 61  KDDRIRVNNKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPKIL 120

Query: 121 IENNGDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLRMQQ 180
           IEN+ +E +DWSH+QQ  K LDGESVVQRTLYL+KN+   +++ AY+ AR+EFYRLR+QQ
Sbjct: 121 IENSLEENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLRIQQ 180

Query: 181 HIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPSESWA 240
            I +QVAQEEAEMFGS+F  ++ E+GI+KEQKVI+ WK+KAI +T++M  R  NPS+SWA
Sbjct: 181 DISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPSDSWA 240

Query: 241 TDEKDPKKNDDIEEDVEE 258
             E+      D+EED  E
Sbjct: 241 APEE-----QDLEEDFTE 253

>KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.290
           YIL093C
          Length = 266

 Score =  297 bits (761), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 143/240 (59%), Positives = 179/240 (74%), Gaps = 1/240 (0%)

Query: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60
           MKIQ NAVN+LERTSA+L +G++ K PAWYNVVA+ PP KKFER P   NPS  +    L
Sbjct: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60

Query: 61  HS-LDSSAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPKI 119
            S LDS    + ++KTRY+  D+  +   LY   KL Y+EDQLR++FY QHPWE SRP I
Sbjct: 61  KSFLDSKRNAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRPMI 120

Query: 120 LIENNGDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLRMQ 179
           LIENN   K+DWS +QQ+GK LDGESVVQR L+L++     SL  AYD AR+EFYR+RMQ
Sbjct: 121 LIENNVTPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIRMQ 180

Query: 180 QHIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPSESW 239
           Q +EEQ++QEEA M+GSV+  SAIE+G++KE KVI+TWKR+ I +TE M ARR +PSESW
Sbjct: 181 QELEEQISQEEAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASPSESW 240

>CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093c RSM25
          Length = 272

 Score =  284 bits (727), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 148/257 (57%), Positives = 191/257 (74%), Gaps = 2/257 (0%)

Query: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60
           MKIQ NAVNVLERTSAYLR G++ + PAWYNVVAS+PP+ KF R P   NPS D+   +L
Sbjct: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60

Query: 61  HSLD-SSAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPKI 119
              D  S   NG++KTR+ A +R  A+KQ+Y   KL Y+ED++R +FYKQHPWEL+RPKI
Sbjct: 61  KDPDLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPKI 120

Query: 120 LIENNGDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLRMQ 179
           + EN  +   DW +M Q+G+PLDGE+VVQRTLYL+K KE  ++  AYD AR EFYRLRMQ
Sbjct: 121 VSENEINTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLRMQ 180

Query: 180 QHIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPSESW 239
           Q +EEQVA EEAEMFGSVFGPS IE+G+ KEQ+VI+ WKR A +Q+E+++A++ N S++ 
Sbjct: 181 QELEEQVAAEEAEMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKENASKA- 239

Query: 240 ATDEKDPKKNDDIEEDV 256
           A D         +E+DV
Sbjct: 240 AGDASAVSSEKQVEDDV 256

>NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2.290
           YIL093C
          Length = 260

 Score =  278 bits (710), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 142/243 (58%), Positives = 183/243 (75%), Gaps = 1/243 (0%)

Query: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60
           M++Q NA+N++ERTSAYL++GLL   PAWY VVA +PP KKF R P+L NPS +     L
Sbjct: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60

Query: 61  HSLDSSAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPKIL 120
                +    G +KTR    DR   S +LY   KL Y+EDQLR +F+ QHPWELSRPKIL
Sbjct: 61  RDNREAVNKKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRPKIL 120

Query: 121 IENNGDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLRMQQ 180
           +EN+ +E++DWSH+QQ+GKPLDGESVVQRT+YL+K  +   ++ AY+ AR+EFYR R+QQ
Sbjct: 121 VENSLEERFDWSHIQQLGKPLDGESVVQRTMYLLKTDKM-DMITAYNQARFEFYRFRIQQ 179

Query: 181 HIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPSESWA 240
            +EEQVAQEEAEMFGSVF  S I++GI+KEQKVI  WK+KA  +TE++AARR NPS+SW 
Sbjct: 180 EVEEQVAQEEAEMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANPSDSWI 239

Query: 241 TDE 243
           + E
Sbjct: 240 SAE 242

>ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL093C
           (RSM25)
          Length = 225

 Score =  234 bits (596), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 144/190 (75%), Gaps = 3/190 (1%)

Query: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60
           MKIQ NAVNVL+RTS YL+AGLL K PAWYNVVA +PP+ KF R PKL +P + +  G+L
Sbjct: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60

Query: 61  HSL-DSSAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPKI 119
             + D    N   +KTR  + DR  A+  ++  SKL +IED+LR +F++QHPWELSRPK+
Sbjct: 61  DIMTDRLNRNTETYKTRAGSSDRQTAA--VHKPSKLRFIEDKLRSLFFQQHPWELSRPKV 118

Query: 120 LIENNGDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLRMQ 179
           L+EN G+E+YDWS M Q+GKPLDGESVVQRTLYL+K+     ++ AYD AR+EFYRLRMQ
Sbjct: 119 LVENMGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLRMQ 178

Query: 180 QHIEEQVAQE 189
           Q +EEQ+A E
Sbjct: 179 QELEEQIAYE 188

>Kpol_1004.47 s1004 (100685..102712) [2028 bp, 675 aa] {ON}
           (100685..102712) [2028 nt, 676 aa]
          Length = 675

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 59/124 (47%), Gaps = 15/124 (12%)

Query: 141 LDGESVVQRTLYL------MKNKEAPSLVLAYDMARYEFYR-LRMQQHIEEQVAQEEAEM 193
           +D + ++++ +++      +KN+E+P L   Y    Y FY  +R   + E +V  E+ ++
Sbjct: 46  IDKDKLIEQGIFIDELFVKIKNRESPLLKPVYLTGPYAFYLDIRPHNYHENEVYDEKEDI 105

Query: 194 -FGSVFGP--SAIEYGI-QKEQKVIDT----WKRKAIIQTEIMAARRINPSESWATDEKD 245
            F S   P  S I Y +  K  KV DT    W    I Q  + A  ++  S S +T  K 
Sbjct: 106 QFCSDLKPDDSFIGYLVMNKNSKVDDTNCYSWTLDIISQVAVTAIPKLEFSMSLSTVRKF 165

Query: 246 PKKN 249
           P ++
Sbjct: 166 PMRD 169

>NDAI0C05650 Chr3 (1305925..1307214) [1290 bp, 429 aa] {ON}
           Anc_8.566
          Length = 429

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 9/53 (16%)

Query: 20  AGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQLHSLDSS-AGNNG 71
           AG  +KQ    +V+A +PP+KK E V   T    D I   +HS +++ AGNNG
Sbjct: 385 AGESSKQ----SVIAQLPPIKKLEIVKHRT----DAILPSIHSFNATIAGNNG 429

>NDAI0K01380 Chr11 (316616..318220) [1605 bp, 534 aa] {ON} Anc_2.447
           YKL125W
          Length = 534

 Score = 30.4 bits (67), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 43/99 (43%), Gaps = 3/99 (3%)

Query: 22  LLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQLHSLDSSAGNNGMFKTRYTAKD 81
           L +  P W+  V S+  +  F    K+T   +D +   L  + SS G    + TR+    
Sbjct: 54  LCSSVPKWWQDV-SMILISNFTLSIKMTQCHHDMLKYFLRMIPSSMGFIDSYLTRFFPNK 112

Query: 82  RSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPKIL 120
              +SK +   + L ++ +  +E+  K   W L   +I+
Sbjct: 113 NDTSSKTVNYIANLLFLTEYCKEL--KFQIWSLLVERII 149

>NCAS0D03900 Chr4 (726411..727343) [933 bp, 310 aa] {ON} Anc_6.258
          YMR183C
          Length = 310

 Score = 29.6 bits (65), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%)

Query: 43 ERVPKLTNPSNDRINGQLHSLDSSAGNNGMFKTRYTAKDRSNASKQLY 90
          E    L+N +ND  N   H++D+SA  +G F    T  +  N + Q+Y
Sbjct: 22 EESNDLSNHNNDDKNATYHNVDTSANTSGDFVEFMTKINNINGNLQVY 69

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.130    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,822,945
Number of extensions: 1231766
Number of successful extensions: 3873
Number of sequences better than 10.0: 48
Number of HSP's gapped: 3914
Number of HSP's successfully gapped: 48
Length of query: 261
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 154
Effective length of database: 41,212,137
Effective search space: 6346669098
Effective search space used: 6346669098
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 64 (29.3 bits)