Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1003.392.287ON37037019450.0
NCAS0B062502.287ON37337315880.0
CAGL0G02585g2.287ON37237215640.0
TDEL0G021802.287ON36937015600.0
KNAG0A054202.287ON37237115590.0
SAKL0E07656g2.287ON36837015530.0
NDAI0B035502.287ON37237215530.0
Suva_9.1052.287ON37137115510.0
YIL094C (LYS12)2.287ON37137115380.0
Smik_9.852.287ON37137115340.0
TPHA0C034102.287ON37137115310.0
Skud_9.792.287ON37137115250.0
KLLA0E08339g2.287ON36936015220.0
ZYRO0A01914g2.287ON36837015180.0
Kwal_27.115282.287ON36737014940.0
KLTH0G10384g2.287ON36737014840.0
KAFR0J013602.287ON37337214840.0
Ecym_33262.287ON36637014760.0
TBLA0B059402.287ON36937214530.0
ADL214C2.287ON36734813770.0
Smik_14.2902.278ON3603765091e-60
YNL037C (IDH1)2.278ON3603765055e-60
TPHA0D015602.278ON3603505049e-60
ADL223W2.278ON3623505012e-59
Skud_14.2932.278ON3613764987e-59
Smik_15.3165.473ON3693904934e-58
Kwal_23.50122.278ON3613824846e-57
Suva_8.1885.473ON3693904813e-56
KLLA0E03125g5.473ON3683534813e-56
YOR136W (IDH2)5.473ON3693904813e-56
KAFR0B063705.473ON3783654813e-56
KLLA0F04103g2.278ON3613824803e-56
Ecym_33162.278ON3623804803e-56
Kpol_440.125.473ON3683894795e-56
NCAS0H022505.473ON4223904835e-56
Kpol_1039.352.278ON3593504769e-56
Skud_15.3005.473ON3693904771e-55
NDAI0C014105.473ON3693904762e-55
CAGL0I07227g5.473ON3683664743e-55
KLTH0G10186g2.278ON3603814715e-55
Ecym_23135.473ON3703534717e-55
TDEL0C038402.278ON3613794709e-55
TBLA0B069102.278ON3653504691e-54
NCAS0B062902.278ON3593514663e-54
NDAI0B035902.278ON3593514663e-54
Kpol_543.85.473ON3683584655e-54
KNAG0B040705.473ON3733944665e-54
TBLA0B022405.473ON3733604657e-54
SAKL0E07876g2.278ON3613824602e-53
AFR137C5.473ON3673584603e-53
SAKL0G03520g5.473ON3693964603e-53
KAFR0J014102.278ON3503764541e-52
TPHA0J027705.473ON3763594552e-52
KLTH0F15048g5.473ON3683584517e-52
Kwal_55.212735.473ON3683584482e-51
KNAG0A052802.278ON3613504472e-51
CAGL0G02673g2.278ON3583794438e-51
TPHA0E014805.473ON3773604403e-50
ZYRO0D02838g2.278ON3613504393e-50
TDEL0A033705.473ON3713604342e-49
ZYRO0D11220g5.473ON3683554282e-48
Ecym_12961.402ON3633664211e-47
TBLA0C015001.402ON3653694045e-45
AAL012C1.402ON3723644021e-44
KLLA0D04906g1.402ON3623643941e-43
Skud_3.431.402ON3643643871e-42
CAGL0H03795g1.402ON3653663853e-42
YCL018W (LEU2)1.402ON3643643853e-42
NDAI0G042301.402ON3633643819e-42
KLTH0H12188g1.402ON3643643819e-42
Smik_3.661.402ON3643643811e-41
TDEL0B060001.402ON3623653792e-41
KAFR0I022001.402ON3653603783e-41
Suva_14.3022.278ON3003183691e-40
Kwal_0.2251.402ON3643683731e-40
KNAG0I012801.402ON4473703762e-40
Kpol_1048.631.402ON3643693643e-39
ZYRO0E04796g1.402ON3623643592e-38
Suva_3.31.402ON3643643547e-38
SAKL0D08690g1.402ON3643653494e-37
NCAS0C048701.402ON3653683424e-36
TPHA0B037301.402ON3653672918e-29
CAGL0D00770g4.254ON4231281391e-08
KAFR0H031601.396ON4211331382e-08
TBLA0C012901.396ON4181261382e-08
CAGL0H03663g1.396ON4181281372e-08
Ecym_13061.396ON4151261372e-08
AAL022W1.396ON4151261363e-08
Suva_14.303singletonON53501213e-08
NCAS0A087201.396ON4131321363e-08
Kwal_23.42104.254ON4221951353e-08
KLTH0H12012g1.396ON4131281354e-08
TDEL0E011604.254ON4231441345e-08
Kpol_1055.784.254ON4271281337e-08
KNAG0H016701.396ON4241291311e-07
NCAS0A025104.254ON4261441301e-07
NDAI0D043604.254ON4241091302e-07
KNAG0I013201.396ON4121261292e-07
ZYRO0E05016g1.396ON4111261292e-07
SAKL0H02860g4.254ON4211331283e-07
YNL009W (IDP3)1.396ON4201261274e-07
TDEL0B061001.396ON4141291264e-07
KAFR0I021301.396ON4081261265e-07
NDAI0G008501.396ON4191261265e-07
YDL066W (IDP1)4.254ON4281091265e-07
TPHA0B036601.396ON4221281265e-07
Skud_4.1894.254ON4291091256e-07
KLTH0D14476g4.254ON4201501257e-07
Skud_12.2391.396ON4121261257e-07
SAKL0D08426g1.396ON4111261231e-06
Smik_4.1694.254ON4281091231e-06
Skud_14.3181.396ON4201261231e-06
Suva_10.2711.396ON4121271231e-06
Smik_12.2351.396ON4121261231e-06
TPHA0B022104.254ON4331091221e-06
KLLA0B03355g4.254ON4292041221e-06
Kwal_0.1911.396ON4111281221e-06
Kpol_1048.701.396ON4191061222e-06
AER061C4.254ON4252101222e-06
CAGL0B04917g1.396ON4111301222e-06
Smik_14.3191.396ON4181261212e-06
YLR174W (IDP2)1.396ON4121281212e-06
KNAG0D044104.254ON4281501203e-06
NCAS0G036201.396ON4181261203e-06
Suva_4.1844.254ON4291091203e-06
KAFR0G032604.254ON4212031193e-06
Suva_14.3391.396ON4171261194e-06
TBLA0A080104.254ON4281301185e-06
Ecym_32654.254ON4241281151e-05
ZYRO0B12496g4.254ON4222061142e-05
KLLA0F12342g1.396ON4151491132e-05
NDAI0G051601.396ON4201221052e-04
KAFR0A053703.455ON120168712.9
ZYRO0F17402g1.52ON118984703.6
Suva_16.4833.502ON61377679.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1003.39
         (370 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {O...   753   0.0  
NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON} Anc_2...   616   0.0  
CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly...   607   0.0  
TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {O...   605   0.0  
KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON}              605   0.0  
SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly...   602   0.0  
NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.2...   602   0.0  
Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON...   602   0.0  
YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}  ...   597   0.0  
Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}...   595   0.0  
TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {O...   594   0.0  
Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}...   592   0.0  
KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly...   590   0.0  
ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {...   589   0.0  
Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094...   580   0.0  
KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {...   576   0.0  
KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2....   576   0.0  
Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}...   573   0.0  
TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa] ...   564   0.0  
ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON} S...   535   0.0  
Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037...   200   1e-60
YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON} ...   199   5e-60
TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {O...   198   9e-60
ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic ho...   197   2e-59
Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037...   196   7e-59
Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136...   194   4e-58
Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C...   191   6e-57
Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W ...   189   3e-56
KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly...   189   3e-56
YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subun...   189   3e-56
KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa] ...   189   3e-56
KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON} unipro...   189   3e-56
Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar t...   189   3e-56
Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON} (32084..3...   189   5e-56
NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473    190   5e-56
Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa] ...   187   9e-56
Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136...   188   1e-55
NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {O...   187   2e-55
CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {...   187   3e-55
KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly...   186   5e-55
Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}...   186   7e-55
TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {O...   185   9e-55
TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON}            185   1e-54
NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa] ...   184   3e-54
NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {O...   184   3e-54
Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON} (21411..22...   183   5e-54
KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {O...   184   5e-54
TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {O...   183   7e-54
SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {...   181   2e-53
AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON} S...   181   3e-53
SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly...   181   3e-53
KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {...   179   1e-52
TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2....   179   2e-52
KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]...   178   7e-52
Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {...   177   2e-51
KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON}              176   2e-51
CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {...   175   8e-51
TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {O...   174   3e-50
ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} simila...   173   3e-50
TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.4...   171   2e-49
ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly...   169   2e-48
Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar t...   166   1e-47
TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {O...   160   5e-45
AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON} S...   159   1e-44
KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly...   156   1e-43
Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)   153   1e-42
CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}             152   3e-42
YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}  LEU2Beta-iso...   152   3e-42
NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa] ...   151   9e-42
KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} high...   151   9e-42
Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)   151   1e-41
TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON} Anc_1...   150   2e-41
KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.4...   150   3e-41
Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C...   146   1e-40
Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W (L...   148   1e-40
KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {O...   149   2e-40
Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON} (1820...   144   3e-39
ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON} unipro...   142   2e-38
Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)      140   7e-38
SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {...   139   4e-37
NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {O...   136   4e-36
TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {O...   116   8e-29
CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly s...    58   1e-08
KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {O...    58   2e-08
TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {O...    58   2e-08
CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly...    57   2e-08
Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}...    57   2e-08
AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic ho...    57   3e-08
Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C ...    51   3e-08
NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa] ...    57   3e-08
Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W...    57   3e-08
KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} high...    57   4e-08
TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.2...    56   5e-08
Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON} (2078...    56   7e-08
KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.3...    55   1e-07
NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {O...    55   1e-07
NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON} Anc_4...    55   2e-07
KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {O...    54   2e-07
ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {...    54   2e-07
SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly...    54   3e-07
YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}  IDP3Perox...    54   4e-07
TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa] ...    53   4e-07
KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.3...    53   5e-07
NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396     53   5e-07
YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}  IDP1Mitoch...    53   5e-07
TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.3...    53   5e-07
Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W ...    53   6e-07
KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]...    53   7e-07
Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174...    53   7e-07
SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly...    52   1e-06
Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W ...    52   1e-06
Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009...    52   1e-06
Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174...    52   1e-06
Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174...    52   1e-06
TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.2...    52   1e-06
KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly...    52   1e-06
Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP...    52   1e-06
Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa] ...    52   2e-06
AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON} S...    52   2e-06
CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {...    52   2e-06
Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174...    51   2e-06
YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}  IDP2Cytos...    51   2e-06
KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {O...    51   3e-06
NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {O...    51   3e-06
Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W ...    51   3e-06
KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {O...    50   3e-06
Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009...    50   4e-06
TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON} Anc_4...    50   5e-06
Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar t...    49   1e-05
ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]...    49   2e-05
KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} high...    48   2e-05
NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa] ...    45   2e-04
KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON} Anc_...    32   2.9  
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    32   3.6  
Suva_16.483 Chr16 complement(831888..833729) [1842 bp, 613 aa] {...    30   9.8  

>Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {ON}
           complement(96083..97195) [1113 nt, 371 aa]
          Length = 370

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/370 (100%), Positives = 370/370 (100%)

Query: 1   MLRNGVYRACARRTVVNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFID 60
           MLRNGVYRACARRTVVNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFID
Sbjct: 1   MLRNGVYRACARRTVVNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFID 60

Query: 61  LHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYA 120
           LHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYA
Sbjct: 61  LHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYA 120

Query: 121 NIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKI 180
           NIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKI
Sbjct: 121 NIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKI 180

Query: 181 AKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQI 240
           AKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQI
Sbjct: 181 AKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQI 240

Query: 241 VDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCHGS 300
           VDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCHGS
Sbjct: 241 VDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCHGS 300

Query: 301 APDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTT 360
           APDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTT
Sbjct: 301 APDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTT 360

Query: 361 EVTDDILSKL 370
           EVTDDILSKL
Sbjct: 361 EVTDDILSKL 370

>NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON}
           Anc_2.287
          Length = 373

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/373 (78%), Positives = 334/373 (89%), Gaps = 3/373 (0%)

Query: 1   MLRNGVYR---ACARRTVVNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFK 57
           MLR    R   +  R    N  R NLTIGLIPGDGIGKEVIPAGK+VLE +  K+ + F 
Sbjct: 1   MLRTAASRFATSTCRTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFD 60

Query: 58  FIDLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLG 117
           FIDL AG+QTFLDTGKALPDETV +LK QCQGALFGAVQSPTTKVEGYSSPIVALRK++G
Sbjct: 61  FIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 120

Query: 118 LYANIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVAT 177
           L+AN+RPVKSVSGT DRPVDMVIVRENTEDLYIK E+TYID+ATGT+VAEATKRISE+AT
Sbjct: 121 LFANVRPVKSVSGTKDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIAT 180

Query: 178 RKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYN 237
           R+IA IALDIALQRLK  GKATLTVTHKSNVLSQSDGLFRE+C+DVYE NKD YG+++YN
Sbjct: 181 RRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYN 240

Query: 238 EQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPC 297
           EQIVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP+I+IGEPC
Sbjct: 241 EQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 300

Query: 298 HGSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDS 357
           HGSAPDI+G+GI+NP+ATIRS ALML+FLG+N+AA+DI  AV+ N+R  KIKTPDLGG+S
Sbjct: 301 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNS 360

Query: 358 STTEVTDDILSKL 370
           +T +VT+D+L++L
Sbjct: 361 TTQQVTEDVLARL 373

>CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094c LYS12 homo-isocitrate dehydrogenase
          Length = 372

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/372 (78%), Positives = 328/372 (88%), Gaps = 2/372 (0%)

Query: 1   MLRNGVYRACARR--TVVNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKF 58
           MLR    R  A R  +    A+  LTIGLIPGDGIGKEVIPAGK++LE +G K+ +DFKF
Sbjct: 1   MLRGSATRLTAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKF 60

Query: 59  IDLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGL 118
           IDLHAGW+TF +TGKALPDETV +L++ CQGALFGAVQSPTTKVEGYSSPIVALRK +GL
Sbjct: 61  IDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGL 120

Query: 119 YANIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATR 178
           +AN+RPVK+V GTNDRPVDMVIVRENTEDLYIK E+TY D ATGT+VAEATKRISEVATR
Sbjct: 121 FANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATR 180

Query: 179 KIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNE 238
           +IA IALDIALQRL++ G ATLTVTHKSNVLSQSDGLFRE+C+DVYE NKD YG + YNE
Sbjct: 181 RIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNE 240

Query: 239 QIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCH 298
           QIVDSMVYR+FREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP+I+IGEPCH
Sbjct: 241 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300

Query: 299 GSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSS 358
           GSAPDI+G+GI+NP+ATIRS ALML+FLGY EAA+ I  AVD NIR  +IKTPDLGG S+
Sbjct: 301 GSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKST 360

Query: 359 TTEVTDDILSKL 370
           T +V DDILSK+
Sbjct: 361 TQQVVDDILSKI 372

>TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {ON}
           Anc_2.287 YIL094C
          Length = 369

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/370 (77%), Positives = 328/370 (88%), Gaps = 1/370 (0%)

Query: 1   MLRNGVYRACARRTVVNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFID 60
           MLR+ + R   RR   +  +S + IGLIPGDGIGKEVIPAGK+VLE +  K+ ++F FID
Sbjct: 1   MLRSAIGRLATRRAYASAPKS-MVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFID 59

Query: 61  LHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYA 120
           L AGW TF +TGKALP++TV +LK QCQGALFGAVQSPTTKVEGYSSPIVALRK+LGLYA
Sbjct: 60  LQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYA 119

Query: 121 NIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKI 180
           N+RPVKSV GT DRPVDMVIVRENTEDLYIK E+TY+D+ATGT+VAEATKRISEVATR+I
Sbjct: 120 NVRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRI 179

Query: 181 AKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQI 240
           A IALDIALQRLK  G ATLTVTHKSNVLSQSDGLFRE+C+DVYE NKD YG V+YNEQI
Sbjct: 180 ATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQI 239

Query: 241 VDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCHGS 300
           VDSMVYR+FREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP+I+IGEPCHGS
Sbjct: 240 VDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGS 299

Query: 301 APDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTT 360
           APDI+G+GISNP+ATIRS  LML+FLG+N+ A+DI  AVD N+R  K+KTPDLGG+S+T 
Sbjct: 300 APDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQ 359

Query: 361 EVTDDILSKL 370
           +V +DILSKL
Sbjct: 360 QVVEDILSKL 369

>KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/371 (77%), Positives = 333/371 (89%), Gaps = 1/371 (0%)

Query: 1   MLRNGVYR-ACARRTVVNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFI 59
           MLR+   + A  R    N AR +LTIGLIPGDGIGKEVIPAGK+VL+++  K+ ++F FI
Sbjct: 2   MLRSAANKLAGCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLQSLNPKHGLNFDFI 61

Query: 60  DLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLY 119
           DL AG+QTF DTGKALPDETV ILK++CQGALFGAVQSPTTKVEGYSSPIVALRK +GLY
Sbjct: 62  DLQAGFQTFQDTGKALPDETVQILKEKCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLY 121

Query: 120 ANIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRK 179
           ANIRPVKSV G+N+RPVDM+IVRENTEDLYIK E+TYID+ATGT+VAEATKRISE+AT++
Sbjct: 122 ANIRPVKSVEGSNERPVDMIIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATQR 181

Query: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQ 239
           IA IALDIALQRL+N GKATLTVTHKSNVLSQSDGLFREVCR++YE NKD Y  ++YNEQ
Sbjct: 182 IATIALDIALQRLQNNGKATLTVTHKSNVLSQSDGLFREVCREMYEANKDKYAGITYNEQ 241

Query: 240 IVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCHG 299
           IVDSMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP+I+IGEPCHG
Sbjct: 242 IVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 301

Query: 300 SAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSST 359
           SAPDI+G+GI+NP+ATIRS ALML+FLG+NEAA+DI  AVD N+R G +KT DLGG+++T
Sbjct: 302 SAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIHKAVDANLRDGLVKTADLGGNATT 361

Query: 360 TEVTDDILSKL 370
             V DDIL++L
Sbjct: 362 QNVVDDILARL 372

>SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/370 (78%), Positives = 325/370 (87%), Gaps = 2/370 (0%)

Query: 1   MLRNGVYRACARRTVVNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFID 60
           MLR+ V +  ARR+  + A+  LTIGLIPGDGIGKEVIPAGK VLE +  K+++ F FID
Sbjct: 1   MLRSTVSQ-FARRSYASAAKP-LTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFID 58

Query: 61  LHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYA 120
           L AGWQTFLDTGKALPDET+ ILK  CQGALFGAVQSPT KVEGYSSPIVALRK+LGLYA
Sbjct: 59  LQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYA 118

Query: 121 NIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKI 180
           N+RPVKSV GTNDRPVDM+IVRENTEDLYIK E+TYIDE TGT+VAEA KRISE AT  I
Sbjct: 119 NVRPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDI 178

Query: 181 AKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQI 240
           AKIAL+I+LQRLK  GKATLTVTHKSNVLSQSDGLFREVC++VYE NK+ YG + YNEQI
Sbjct: 179 AKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQI 238

Query: 241 VDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCHGS 300
           VDSMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG D I+GEPCHGS
Sbjct: 239 VDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCHGS 298

Query: 301 APDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTT 360
           APDI+G+GISNP+ATIRS ALML+F+GY EAA+DI  AVD NIR  +IKTPDLGG S+T 
Sbjct: 299 APDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQ 358

Query: 361 EVTDDILSKL 370
           +V DDILSK+
Sbjct: 359 QVVDDILSKM 368

>NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.287
           YIL094C
          Length = 372

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/372 (77%), Positives = 327/372 (87%), Gaps = 2/372 (0%)

Query: 1   MLRNGVYR-ACARRTVVNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFI 59
           MLR    R A  R    N  R NLTIGLIPGDGIGKEVIPAGK+VL+ +  K+ ++F FI
Sbjct: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60

Query: 60  DLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLY 119
           DL AG+QTFLDTGKALPDET+ +LK QCQGALFGAVQSPTTKVEGYSSPIVALRK++GLY
Sbjct: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120

Query: 120 ANIRPVKSVSGTNDRPVDMVIVRENTEDLY-IKEERTYIDEATGTKVAEATKRISEVATR 178
           AN+RPVKSV GT D+PVDMVIVRENT     IK ERTYID ATGT+VAEATKRISE+ATR
Sbjct: 121 ANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATR 180

Query: 179 KIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNE 238
           +IA IALDIALQRLK  GKATLTVTHKSNVLSQSDGLFRE+C+DVYE NKD YG ++YNE
Sbjct: 181 RIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNE 240

Query: 239 QIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCH 298
           QIVDSMVYR+FREP+CFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP+I+IGEPCH
Sbjct: 241 QIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300

Query: 299 GSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSS 358
           GSAPDI+G+GISNP+ATIRS ALML+FLG+NEAA+DI  AV+ N++  K+KTPDLGG S+
Sbjct: 301 GSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKST 360

Query: 359 TTEVTDDILSKL 370
           T EVT+D+L++L
Sbjct: 361 TQEVTEDVLARL 372

>Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/371 (76%), Positives = 330/371 (88%), Gaps = 1/371 (0%)

Query: 1   MLRNGVYRACARRTVV-NGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFI 59
           M R+   R  A R +  N AR +LTIGLIPGDGIGKEVIPAGK++LE +  K+ + F FI
Sbjct: 1   MFRSVATRISACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFI 60

Query: 60  DLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLY 119
           DL+AG+QTF +TGKALPDET+ +LK QCQGALFGAVQSPTTKVEGYSSPIVALR+++GLY
Sbjct: 61  DLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLY 120

Query: 120 ANIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRK 179
           AN+RPVKSV GT D+P+DMVIVRENTEDLYIK E+TYID+ATGT+VA+A KRISEVATR+
Sbjct: 121 ANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRR 180

Query: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQ 239
           IAKIALDIALQRL+  G+ATLTVTHKSNVLSQSDGLFRE+C+DVYE NKD YG + YNEQ
Sbjct: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQ 240

Query: 240 IVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCHG 299
           IVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGPDI+IGEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCHG 300

Query: 300 SAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSST 359
           SAPDI+G+GI+NP+ATIRS ALML+FLG+N+AA+DI  AVD N+R G I TPDLGG +ST
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAST 360

Query: 360 TEVTDDILSKL 370
            +V DD+LS+L
Sbjct: 361 QQVVDDVLSRL 371

>YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}
           LYS12Homo-isocitrate dehydrogenase, an NAD-linked
           mitochondrial enzyme required for the fourth step in the
           biosynthesis of lysine, in which homo-isocitrate is
           oxidatively decarboxylated to alpha-ketoadipate
          Length = 371

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/371 (75%), Positives = 330/371 (88%), Gaps = 1/371 (0%)

Query: 1   MLRNGVYRACARRTVV-NGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFI 59
           M R+   R  A R +  N AR +LTIGLIPGDGIGKEVIPAGK+VLE +  K+ + F FI
Sbjct: 1   MFRSVATRLSACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 60  DLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLY 119
           DL+AG+QTF +TGKALPDETV +LK+QCQGALFGAVQSPTTKVEGYSSPIVALR+++GL+
Sbjct: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 120 ANIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRK 179
           AN+RPVKSV G   +P+DMVIVRENTEDLYIK E+TYID+ATGT+VA+ATKRISE+ATR+
Sbjct: 121 ANVRPVKSVEGEKGKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180

Query: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQ 239
           IA IALDIAL+RL+  G+ATLTVTHKSNVLSQSDGLFRE+C++VYE NKD YG + YNEQ
Sbjct: 181 IATIALDIALKRLQTRGQATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240

Query: 240 IVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCHG 299
           IVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP+I+IGEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300

Query: 300 SAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSST 359
           SAPDI+G+GI+NP+ATIRS ALML+FLG+NEAA+DI  AVD N+R G IKTPDLGG +ST
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIYKAVDANLREGSIKTPDLGGKAST 360

Query: 360 TEVTDDILSKL 370
            +V DD+LS+L
Sbjct: 361 QQVVDDVLSRL 371

>Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/371 (75%), Positives = 330/371 (88%), Gaps = 1/371 (0%)

Query: 1   MLRNGVYR-ACARRTVVNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFI 59
           MLR+   R +  R    N AR +LTIGLIPGDGIGKEVIPAGK+VLE +  K+ + F FI
Sbjct: 1   MLRSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 60  DLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLY 119
           DL+AG+QTF +TGKALPDETV +LK+QCQGALFGAVQSPTTKVEGYSSPIVALR+++GL+
Sbjct: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 120 ANIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRK 179
           AN+RPVKSV G  D+P+DMVIVRENTEDLYIK E+TYID+ATGT+VA+ATKRISE+ATR+
Sbjct: 121 ANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180

Query: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQ 239
           IA IA+DIAL+RL+  G+ATLTVTHKSNVLSQSDGLFRE+C++VYE NKD YG + YNEQ
Sbjct: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240

Query: 240 IVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCHG 299
           IVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP+I+IGEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300

Query: 300 SAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSST 359
           SAPDI+G+GI+NP+ATIRS ALML+FLG+N AA+DI  AVD N+R G IKTPDLGG +ST
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAST 360

Query: 360 TEVTDDILSKL 370
            +V +D+LS+L
Sbjct: 361 QQVVEDVLSRL 371

>TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {ON}
           Anc_2.287 YIL094C
          Length = 371

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/371 (76%), Positives = 327/371 (88%), Gaps = 1/371 (0%)

Query: 1   MLRNGVYRACARRTVVN-GARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFI 59
           MLR  VY    +RT+ N   +SNLTIGLIPGDGIGKEVIP+G++VLETIG K+ + F FI
Sbjct: 1   MLRRSVYNRQFQRTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFI 60

Query: 60  DLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLY 119
           DL AGWQTFLDTGKALP ETV  L++ C GALFGAVQSPTTKVEGYSSPIVALRK+LGLY
Sbjct: 61  DLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120

Query: 120 ANIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRK 179
           ANIRPVKSV    ++ VDMVIVRENTEDLYIK E+TYIDE TGT+VA+ATKRISEVATR+
Sbjct: 121 ANIRPVKSVDTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRR 180

Query: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQ 239
           IAKIALDIALQRLKN G   LTVTHKSNVLSQSDGLFREVC++V+E NK LY ++ YNEQ
Sbjct: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQ 240

Query: 240 IVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCHG 299
           I+DSMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP I+IGEPCHG
Sbjct: 241 IIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHG 300

Query: 300 SAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSST 359
           SAPDI+G+GISNP+ATIRS ALML+FLG+++AA+DIQ AVD N+R  KIKTPDLGG +ST
Sbjct: 301 SAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNST 360

Query: 360 TEVTDDILSKL 370
           ++V +D++ +L
Sbjct: 361 SDVVNDVIRRL 371

>Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/371 (74%), Positives = 331/371 (89%), Gaps = 1/371 (0%)

Query: 1   MLRNGVYRACARRTV-VNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFI 59
           M R+   R  A R +  N AR +LTIGLIPGDGIGKEVIPAGK+VLE +  K+ + F FI
Sbjct: 1   MFRSVATRVSACRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 60  DLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLY 119
           DL+AG+QTF +TGKALPDETV++LK+QCQGALFGAVQSPTTKVEGYSSPIVALR+++GL+
Sbjct: 61  DLYAGFQTFQETGKALPDETVNVLKKQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 120 ANIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRK 179
           AN+RPVKSV G+ ++P+DMVIVRENTEDLYIK E+TYID+ATGT+VA+ATKRISE+ATR+
Sbjct: 121 ANVRPVKSVEGSRNKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180

Query: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQ 239
           IA IALDIAL+RL+  G+ATLTVTHKSNVLSQ+DGLFRE+C++VYE NKD YG + YNEQ
Sbjct: 181 IATIALDIALKRLQTRGEATLTVTHKSNVLSQTDGLFREICKEVYESNKDKYGQIKYNEQ 240

Query: 240 IVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCHG 299
           IVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP+I+IGEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300

Query: 300 SAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSST 359
           SAPDI+G+GI+NP+ATIRS ALML+FLG+N AA+DI  AVD N+R G I TPDLGG +ST
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNGAAQDIYKAVDANLREGAITTPDLGGKAST 360

Query: 360 TEVTDDILSKL 370
            +V DD+LS+L
Sbjct: 361 QQVVDDVLSRL 371

>KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 369

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/360 (78%), Positives = 319/360 (88%), Gaps = 1/360 (0%)

Query: 11  ARRTVVNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQTFLD 70
           +RR   + A+ NLTIGLIPGDGIGKEVIPAGKK+LE++  KY + FKFIDL AGW+TF +
Sbjct: 10  SRRAYASNAK-NLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWETFQN 68

Query: 71  TGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSG 130
           TGKALPDET+ ILK QC+GALFGAVQSPTTKVEGYSSPIVALRK LGL+AN+RPVKSV G
Sbjct: 69  TGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDG 128

Query: 131 TNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQ 190
           T DR VD+VIVRENTEDLYIK E++YIDEATGT+VA+ATKRI+E+AT+ IA IAL IA Q
Sbjct: 129 TKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQ 188

Query: 191 RLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFR 250
           RL+  G ATLTVTHKSNVLSQSDGLFREVCR+ YE NKD YG V YNEQIVDSMVYR+FR
Sbjct: 189 RLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFR 248

Query: 251 EPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCHGSAPDISGQGIS 310
           EPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP+I+IGEPCHGSAPDI+G+GIS
Sbjct: 249 EPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHGSAPDIAGKGIS 308

Query: 311 NPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTTEVTDDILSKL 370
           NP+ATIRS ALML+FLGY E AKDI  AVD NIR GK  TPDLGG+S+T +V +D+LSKL
Sbjct: 309 NPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQVLEDVLSKL 368

>ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/370 (76%), Positives = 320/370 (86%), Gaps = 2/370 (0%)

Query: 1   MLRNGVYRACARRTVVNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFID 60
           M R+ V +  ARR     A  ++ IGLIPGDGIGKEVIPAGK+VLE +G K+ + F FID
Sbjct: 1   MFRSSVAKVAARRAY--SAPKSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFID 58

Query: 61  LHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYA 120
           L AGW+ F   GKALPD+TV +LK+QCQGALFGAVQSPTTKV GYSSPIVALRK+LGLYA
Sbjct: 59  LKAGWEAFQQQGKALPDDTVKVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYA 118

Query: 121 NIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKI 180
           N+RPVKSV   NDR VDM+IVRENTEDLYIK E+TY+DEATGT+VAEA KRISEVATRKI
Sbjct: 119 NVRPVKSVEKGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKI 178

Query: 181 AKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQI 240
           A IALDI+LQRLK+ G ATLTVTHKSNVLSQSDGLFRE+C+DVYEKNKD YG V YNEQI
Sbjct: 179 ATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQI 238

Query: 241 VDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCHGS 300
           VDSMVYR+FREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP+I+IGEPCHGS
Sbjct: 239 VDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGS 298

Query: 301 APDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTT 360
           APDI+G+GISNP+ATIRS ALML+FLG+ E A+DI  AVD N+  G + TPDLGG ++T 
Sbjct: 299 APDIAGKGISNPIATIRSTALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQ 358

Query: 361 EVTDDILSKL 370
           +V DDILSK+
Sbjct: 359 QVVDDILSKI 368

>Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094C
           (LYS12) - Homo-isocitrate dehydrogenase [contig 27] FULL
          Length = 367

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/370 (75%), Positives = 320/370 (86%), Gaps = 3/370 (0%)

Query: 1   MLRNGVYRACARRTVVNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFID 60
           MLR   +   ARR+  +  +S LTIGLIPGDGIG+EVIPAGK VLE +  K+ + F FID
Sbjct: 1   MLRTS-FNQLARRSYTSATKS-LTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFID 58

Query: 61  LHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYA 120
           L AGWQTFLDTGKALPDET+ ILK +CQGALFGAVQSPT KVEGYSSPIVALRK+LGLYA
Sbjct: 59  LEAGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYA 118

Query: 121 NIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKI 180
           N+RPVKSV  + ++P+DMVIVRENTEDLYIK E+TYIDE TGT+VAEA KRISEVATR I
Sbjct: 119 NVRPVKSVL-SQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNI 177

Query: 181 AKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQI 240
           A IAL+IALQR K  G ATLTVTHKSNVLSQSDGLFRE+CR VYE N+D +G+++YNEQI
Sbjct: 178 ANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQI 237

Query: 241 VDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCHGS 300
           VDSMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG D ++GEPCHGS
Sbjct: 238 VDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGS 297

Query: 301 APDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTT 360
           APDI+G+GISNPVATIRS ALML+F+G+ EAA+DI  AVD N+R   +KTPDLGG S+T 
Sbjct: 298 APDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQ 357

Query: 361 EVTDDILSKL 370
           +V DD+LS++
Sbjct: 358 QVVDDVLSRM 367

>KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 367

 Score =  576 bits (1484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/370 (74%), Positives = 319/370 (86%), Gaps = 3/370 (0%)

Query: 1   MLRNGVYRACARRTVVNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFID 60
           MLR   +   ARR+  + ++S LTIGLIPGDGIGKEVIPAG++VLE +  K+ + F FID
Sbjct: 1   MLR-ASFTQLARRSYASASKS-LTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFID 58

Query: 61  LHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYA 120
           L AGWQTF +TGKALPDET+ IL+ QCQGALFGAVQSPT KVEGYSSPIVALRK+LGLYA
Sbjct: 59  LQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYA 118

Query: 121 NIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKI 180
           N+RPVKSV    +RPVDM+IVRENTEDLYIK E+TYIDE TGT+VAEA KRISE AT+ I
Sbjct: 119 NVRPVKSVL-PQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNI 177

Query: 181 AKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQI 240
           A IAL+IALQR K  G+ATLTVTHKSNVLSQSDGLFREVCR VYE NKD +G++ YNEQI
Sbjct: 178 ANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQI 237

Query: 241 VDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCHGS 300
           VDSMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG D ++GEPCHGS
Sbjct: 238 VDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGS 297

Query: 301 APDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTT 360
           APDI+G+GISNPVATIRS ALML+F+G+ EAA+DI  AVD N+R   IKTPDLGG S+T 
Sbjct: 298 APDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQ 357

Query: 361 EVTDDILSKL 370
           +V +D+LS++
Sbjct: 358 QVVEDVLSRM 367

>KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2.287
           YIL094C
          Length = 373

 Score =  576 bits (1484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/372 (74%), Positives = 323/372 (86%), Gaps = 3/372 (0%)

Query: 1   MLRNGVYR-ACARRTVVNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFI 59
           MLR+ V + A  R     G   +LTIGLIPGDGIGKEVIPAGK+VL+ +  ++ ++F FI
Sbjct: 1   MLRSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFI 60

Query: 60  DLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLY 119
           DL AG+QTFLDTGKALPDETV +LK+QCQG LFGAVQSPTT+V+ YSSPIVALRK+L LY
Sbjct: 61  DLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLY 120

Query: 120 ANIRPVKSVSGTND-RPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATR 178
           ANIRPVKSV+G +  +PVDMVIVRENTEDLYIK E++Y D+  G +VAEATKRI+EVATR
Sbjct: 121 ANIRPVKSVAGAHSGKPVDMVIVRENTEDLYIKIEKSYKDQ-NGMRVAEATKRITEVATR 179

Query: 179 KIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNE 238
           KIAKIALD+ALQRLK  GKATLTVTHKSNVLSQSDGLFRE+C+DVY+ NKD Y  ++YNE
Sbjct: 180 KIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNE 239

Query: 239 QIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCH 298
           QI+DSMVYR+FREPE FDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGPDI++GEPCH
Sbjct: 240 QIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPCH 299

Query: 299 GSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSS 358
           GSAPDI+G+GI+NP+ATIRS ALML+FLG+ EAA+DI  AV+ N+R  KIKTPDLGG+SS
Sbjct: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSS 359

Query: 359 TTEVTDDILSKL 370
           T  V DD+L KL
Sbjct: 360 TQNVVDDVLEKL 371

>Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii ADL214C
          Length = 366

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/370 (75%), Positives = 315/370 (85%), Gaps = 4/370 (1%)

Query: 1   MLRNGVYRACARRTVVNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFID 60
           MLR G  +   R  V +    + TIGLIPGDGIGKEVIP G+KVLE IG KY +DFK+ID
Sbjct: 1   MLRVGRGQLSTRTYVTS---KSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYID 57

Query: 61  LHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYA 120
           L AGWQTFLDTGKALPD+TV  L+  CQGALFGAVQSPTTKV+GYSSPIVALRK LGLYA
Sbjct: 58  LQAGWQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYA 117

Query: 121 NIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKI 180
           NIRPVKSV GT DRPVD+VI RENTEDLYIK ERTYID+ TG +VAEA KRISE ATR I
Sbjct: 118 NIRPVKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNI 177

Query: 181 AKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQI 240
           A IAL+IALQRLK  G ATLTVTHKSNVLSQSDGLFRE+C+ VY+ NK  + NV YNEQI
Sbjct: 178 ANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKK-FANVQYNEQI 236

Query: 241 VDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCHGS 300
           VDSMVYR+F+EP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPS NVGP+I+IGEPCHGS
Sbjct: 237 VDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHGS 296

Query: 301 APDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTT 360
           APDI GQGI+NP+ATIRSAAL+L+FLG  EAA+ I+  VDENIR  KIKTPDLGG+S+  
Sbjct: 297 APDIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGE 356

Query: 361 EVTDDILSKL 370
           +V +DILS++
Sbjct: 357 QVANDILSRI 366

>TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa]
           {ON} Anc_2.287 YIL094C
          Length = 369

 Score =  564 bits (1453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/372 (73%), Positives = 316/372 (84%), Gaps = 5/372 (1%)

Query: 1   MLRNGV--YRACARRTVVNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKF 58
           MLR  V  +   AR      +   LTIGLIPGDGIGKEVIPAGK+VL+ +  K+ + F+F
Sbjct: 1   MLRTSVRQFSVSARNA---SSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEF 57

Query: 59  IDLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGL 118
           IDL AG+QTFLDTG ALP +TV ILK +CQGALFGAVQSPTTKVEGYSSPIV LRK+LGL
Sbjct: 58  IDLQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGL 117

Query: 119 YANIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATR 178
           +AN+RPVK+V GT+ +P+D+VIVRENTEDLYIK E+TY D   G+++AEATKRI+E AT+
Sbjct: 118 FANVRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATK 177

Query: 179 KIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNE 238
           +IAK ALDIALQRLK  G ATLTVTHKSNVLSQSDGLFREVC++VYE NK LY  V+YNE
Sbjct: 178 RIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNE 237

Query: 239 QIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCH 298
           QIVDSMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLG+VPSANVGP+I+IGEPCH
Sbjct: 238 QIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCH 297

Query: 299 GSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSS 358
           GSAPDI+G+GI+NP+ATIRS A ML++LGY+  A+DI  AVD NIR  KIKT DLGGDS+
Sbjct: 298 GSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDST 357

Query: 359 TTEVTDDILSKL 370
           T +V DDIL KL
Sbjct: 358 TQQVIDDILGKL 369

>ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL094C
           (LYS12)
          Length = 367

 Score =  535 bits (1377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/348 (72%), Positives = 301/348 (86%), Gaps = 1/348 (0%)

Query: 23  LTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQTFLDTGKALPDETVSI 82
           LTIGLIPGDGIGKEVIPAG++VLE IG K+ I F +  L AGWQTFL+TG ALP  TV  
Sbjct: 21  LTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEA 80

Query: 83  LKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSGTNDRPVDMVIVR 142
           L+++CQGALFGAVQSPTTKVEGYSSPIVALR+QLGLYANIRPVKSVSGT  +PVD+VIVR
Sbjct: 81  LRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSGTG-QPVDLVIVR 139

Query: 143 ENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKNTGKATLTV 202
           ENTEDLY+++ERTY+D ATG +VAEA KRISE AT +IA+I+L +ALQR +  G+  LTV
Sbjct: 140 ENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGALTV 199

Query: 203 THKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPECFDVVVAPN 262
           THKSNVLSQ+DGLF+EVCR+VYE NK  YG++ YNEQIVDSMVYR+F+EP CFDVVVAPN
Sbjct: 200 THKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFDVVVAPN 259

Query: 263 LYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCHGSAPDISGQGISNPVATIRSAALM 322
           LYGD+LSDGAAALVGSLG+VPS NVG +IIIGEPCHGSAPDI+G+GI+NP+ATIRS +LM
Sbjct: 260 LYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHGSAPDIAGRGIANPIATIRSVSLM 319

Query: 323 LQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTTEVTDDILSKL 370
           LQFLG  EAA DI  AV  N++  ++ +PDLGG ++T EV DDIL+++
Sbjct: 320 LQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVLDDILARI 367

>Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037C
           (REAL)
          Length = 360

 Score =  200 bits (509), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 135/376 (35%), Positives = 203/376 (53%), Gaps = 35/376 (9%)

Query: 8   RACARRTVVNGARSN----------LTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFK 57
           R  A+RT+   A++            T+ LIPGDG+GKE+  + K + E   +K  +D++
Sbjct: 4   RTIAKRTLATAAQAERALPKKYGGRFTVTLIPGDGVGKEITDSVKTIFE--AEKIPVDWE 61

Query: 58  FIDLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLG 117
            +++    QT    G     E V  LK+   G L G   +P  +  G+ S  VALRKQL 
Sbjct: 62  TVNIK---QTDHKEGVY---EAVESLKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLD 113

Query: 118 LYANIRPVKSVSGTNDR--PVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEV 175
           +YAN+   KS+ G   R   +D++++RENTE      E + ++  +   V E+ K ++  
Sbjct: 114 IYANVALFKSLKGVKTRIPDIDLIVIRENTEG-----EFSGLEHESVPGVVESLKIMTRP 168

Query: 176 ATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVS 235
            T +IA+ A D A    K   +  +T  HK+N++   DGLFR +  ++ +K    Y ++ 
Sbjct: 169 KTERIARFAFDFA----KKYNRKAVTAVHKANIMKLGDGLFRNIITEIGQKE---YPDID 221

Query: 236 YNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGE 295
            +  IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G D  + E
Sbjct: 222 VSSIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFE 281

Query: 296 P-CHGSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLG 354
           P       DI GQ ++NP A I S+ LML  LG NE A  I  AV E I  GK  T D+G
Sbjct: 282 PGSRHVGLDIKGQNVANPTAMILSSVLMLNHLGLNEYATRISKAVHETIAEGKHTTKDIG 341

Query: 355 GDSSTTEVTDDILSKL 370
           G SSTT+ T++I++KL
Sbjct: 342 GSSSTTDFTNEIINKL 357

>YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON}
           IDH1Subunit of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  199 bits (505), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 135/376 (35%), Positives = 203/376 (53%), Gaps = 35/376 (9%)

Query: 8   RACARRTVVNGARSN----------LTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFK 57
           R  A+RT+   A++            T+ LIPGDG+GKE+  + + + E   +   ID++
Sbjct: 4   RTIAKRTLATAAQAERTLPKKYGGRFTVTLIPGDGVGKEITDSVRTIFE--AENIPIDWE 61

Query: 58  FIDLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLG 117
            I++    QT    G     E V  LK+   G L G   +P  +  G+ S  VALRKQL 
Sbjct: 62  TINIK---QTDHKEGVY---EAVESLKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLD 113

Query: 118 LYANIRPVKSVSGTNDR--PVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEV 175
           +YAN+   KS+ G   R   +D++++RENTE      E + ++  +   V E+ K ++  
Sbjct: 114 IYANVALFKSLKGVKTRIPDIDLIVIRENTEG-----EFSGLEHESVPGVVESLKVMTRP 168

Query: 176 ATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVS 235
            T +IA+ A D A    K   + ++T  HK+N++   DGLFR +  ++ +K    Y ++ 
Sbjct: 169 KTERIARFAFDFA----KKYNRKSVTAVHKANIMKLGDGLFRNIITEIGQKE---YPDID 221

Query: 236 YNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGE 295
            +  IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G D  + E
Sbjct: 222 VSSIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFE 281

Query: 296 P-CHGSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLG 354
           P       DI GQ ++NP A I S+ LML  LG NE A  I  AV E I  GK  T D+G
Sbjct: 282 PGSRHVGLDIKGQNVANPTAMILSSTLMLNHLGLNEYATRISKAVHETIAEGKHTTRDIG 341

Query: 355 GDSSTTEVTDDILSKL 370
           G SSTT+ T++I++KL
Sbjct: 342 GSSSTTDFTNEIINKL 357

>TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {ON}
           Anc_2.278 YNL037C
          Length = 360

 Score =  198 bits (504), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 135/350 (38%), Positives = 193/350 (55%), Gaps = 25/350 (7%)

Query: 24  TIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQTFLDTGKALPDETVSIL 83
           T+ LIPGDGIGKEV  +  K+  + G    ID++ ID+  G     +  KA     V  L
Sbjct: 30  TVTLIPGDGIGKEVTDSVVKIFASQG--LPIDWERIDV-PGMSNENEVKKA-----VESL 81

Query: 84  KQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSGTNDR--PVDMVIV 141
           K+   G     +   +    GY S  VALRKQL ++AN+   KS+ G   +   VD+V++
Sbjct: 82  KRNKIG--LKGIWHTSADQTGYGSLNVALRKQLDIFANVAIFKSLKGVKTKIPDVDLVVI 139

Query: 142 RENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKNTGKATLT 201
           RENTE  Y     + ++  +   V E+ K I++  T +IA+ A D AL+      ++T+T
Sbjct: 140 RENTEGEY-----SGLEHESVPGVVESLKIITKPKTERIARFAFDFALE----NNRSTVT 190

Query: 202 VTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPECFDVVVAP 261
             HK+N++  SDGLF+    +V EK    Y ++  N  IVD+   +   +P  FDV+V P
Sbjct: 191 AVHKANIMKLSDGLFKNTVAEVGEKE---YPDIKVNTIIVDNASMQAVAKPHQFDVMVTP 247

Query: 262 NLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEP-CHGSAPDISGQGISNPVATIRSAA 320
           ++YG IL +  AAL+G  G++P AN G +  + EP       DI  Q I+NP A I SA 
Sbjct: 248 SMYGTILGNIGAALIGGPGLIPGANYGREHAVFEPGSRHVGLDIENQNIANPTAMILSAT 307

Query: 321 LMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTTEVTDDILSKL 370
           LML  LG  E +K I NAV   I  GK  T D+GG++STTE TD ++ KL
Sbjct: 308 LMLNQLGLREESKRISNAVYAVIEEGKTTTKDIGGNASTTEFTDAVIDKL 357

>ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL037C (IDH1)
          Length = 362

 Score =  197 bits (501), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 134/350 (38%), Positives = 193/350 (55%), Gaps = 24/350 (6%)

Query: 24  TIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQTFLDTGKALPDETVSIL 83
           T+ LIPGDGIGKEV  +  ++ E   +   +D++ ++L A     L+       + V  L
Sbjct: 31  TVTLIPGDGIGKEVTDSVVQIFE--AENVPVDWESVELSA-----LEENHEGVQKAVESL 83

Query: 84  KQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSG--TNDRPVDMVIV 141
           K+   G L G   +P  +  G+ S  VA RKQL ++AN+   KS  G  T  + VD+VI+
Sbjct: 84  KRNKVG-LKGIWHTPADQT-GHGSLNVAFRKQLDIFANVALFKSFPGVKTKLQDVDLVII 141

Query: 142 RENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKNTGKATLT 201
           RENTE  Y     + ++  +   V E+ K +++  + +IA+ A D AL   KN  KA   
Sbjct: 142 RENTEGEY-----SGLEHESVPGVVESLKIMTKAKSERIARFAFDFAL---KNNRKAVCA 193

Query: 202 VTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPECFDVVVAP 261
           V HK+N++   DGLFR    ++  K    Y  V+ +  IVD+   +   +P  FDV+V P
Sbjct: 194 V-HKANIMKLGDGLFRNTVSEIGAKE---YPEVNVSSIIVDNASMQAVAKPHQFDVLVTP 249

Query: 262 NLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEP-CHGSAPDISGQGISNPVATIRSAA 320
           NLYG IL +  AAL+G  G+VP AN G +  + EP C     DI GQ ++NP A I S+ 
Sbjct: 250 NLYGSILGNIGAALIGGPGLVPGANFGREYAVFEPGCRHVGLDIKGQDVANPTAMILSST 309

Query: 321 LMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTTEVTDDILSKL 370
           LML+ LG NE A  I  A  E I  GK  T D+GG ++TTE T+ ++ KL
Sbjct: 310 LMLRHLGLNEYADRISRATYETIAEGKRTTKDIGGTATTTEFTNAVIDKL 359

>Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037C
           (REAL)
          Length = 361

 Score =  196 bits (498), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 132/376 (35%), Positives = 203/376 (53%), Gaps = 35/376 (9%)

Query: 8   RACARRTVVNGARSN----------LTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFK 57
           R  A+RT+   A++            T+ LIPGDG+GKE+  + + + E   ++  +D++
Sbjct: 4   RTIAKRTLATAAQAERTLPKKYGGRFTVTLIPGDGVGKEITDSVRTIFE--AERIPVDWE 61

Query: 58  FIDLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLG 117
            I++    QT    G     E V  LK+   G L G   +P  +  G+ S  VALRKQL 
Sbjct: 62  TINIK---QTDHKEGVY---EAVESLKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLD 113

Query: 118 LYANIRPVKSVSGTNDR--PVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEV 175
           +YAN+   KS+ G   R   +D++++RENTE      E + ++  +   V E+ K +++ 
Sbjct: 114 IYANVALFKSLKGVKTRIPDIDLIVIRENTEG-----EFSGLEHESVPGVVESLKVMTKP 168

Query: 176 ATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVS 235
            T +IA+ A D A    K   +  +T  HK+N++   DGLFR +  ++ +     Y ++ 
Sbjct: 169 KTERIARFAFDFA----KKYNRKAVTAVHKANIMKLGDGLFRNIITEIGQTE---YPDID 221

Query: 236 YNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGE 295
            +  IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G D  + E
Sbjct: 222 VSSIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFE 281

Query: 296 P-CHGSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLG 354
           P       DI GQ ++NP A I S+ LML  LG NE A  I  AV E I  GK  T D+G
Sbjct: 282 PGSRHVGLDIKGQNVANPTAMILSSVLMLNHLGLNENATRISKAVHETIAEGKHTTRDIG 341

Query: 355 GDSSTTEVTDDILSKL 370
           G SSTT+ T+++++KL
Sbjct: 342 GSSSTTDFTNEVINKL 357

>Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  194 bits (493), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 133/390 (34%), Positives = 208/390 (53%), Gaps = 41/390 (10%)

Query: 1   MLRNGVYRACARRTVV--------------NGARSNLTIGLIPGDGIGKEVIPAGKKVLE 46
           MLRN  +R  +RR +               N +    T+  I GDGIG E+  + KK+  
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 47  TIGDKYSIDFKFIDLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYS 106
                  I+++F D++     F++    +PD  V  + +    AL G + +P  K  G+ 
Sbjct: 61  --AANVPIEWEFCDVNP---IFVNGLTTIPDPAVQSITKNLV-ALKGPLATPIGK--GHR 112

Query: 107 SPIVALRKQLGLYANIRPVKSVSG--TNDRPVDMVIVRENTEDLYIKEERTYIDEATGTK 164
           S  + LRK  GL+AN+RP KSV G  T    VD+V++RENTE  Y     + I+      
Sbjct: 113 SLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEY-----SGIEHIVCPG 167

Query: 165 VAEATKRISEVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVY 224
           V ++ K I+  A+ ++ + A + A    +  G+  + V HKS +   +DGLF  V +++ 
Sbjct: 168 VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKELS 223

Query: 225 EKNKDLYGNVSYNEQIVDSMVYRIFREPECFD--VVVAPNLYGDILSDGAAAL-VGSLGV 281
           ++    Y +++   +++D+ V ++   P  +   V V PNLYGDILSD  + L  GSLG+
Sbjct: 224 KE----YPDITLETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGL 279

Query: 282 VPSANVGPDIIIGEPCHGSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDE 341
            PSAN+G  I I E  HGSAPDI+GQ  +NP A + S+ +ML  +G    A  IQNAV  
Sbjct: 280 TPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNYADQIQNAVLS 339

Query: 342 NIRSG-KIKTPDLGGDSSTTEVTDDILSKL 370
            I SG + +T DL G ++T+  T+ ++ +L
Sbjct: 340 TIASGPENRTGDLAGAATTSSFTEAVIKRL 369

>Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C
           (IDH1) - alpha-4-beta-4 subunit of mitochondrial
           isocitrate dehydrogenase 1 [contig 7] FULL
          Length = 361

 Score =  191 bits (484), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 138/382 (36%), Positives = 205/382 (53%), Gaps = 36/382 (9%)

Query: 1   MLRNGVYRACARRTVVNGARSNL---------TIGLIPGDGIGKEVIPAGKKVLETIGDK 51
           MLR+G+    ++R++   A   L         T+ LIPGDG+GKEV  +   + E+  + 
Sbjct: 1   MLRSGL--GVSKRSLATMAAEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFES--EN 56

Query: 52  YSIDFKFIDLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVA 111
             ID++ +++       LD  + +  + V  LK+   G L G   +P+ +  G+ S  VA
Sbjct: 57  IPIDWETVEISG-----LDNQEGV-QKAVESLKRNKVG-LKGIWHTPSDQT-GHGSLNVA 108

Query: 112 LRKQLGLYANIRPVKSVSGTNDRP--VDMVIVRENTEDLYIKEERTYIDEATGTKVAEAT 169
           LRKQL ++AN+   KSV G   R   VDMV++RENTE  Y     + ++  +   V E+ 
Sbjct: 109 LRKQLDIFANVALFKSVPGVPSRHSNVDMVVIRENTEGEY-----SGLEHESVPGVVESL 163

Query: 170 KRISEVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKD 229
           K +++  + +I + A D A+   KN  K+   V HK+N++   DGLFR    +V  K   
Sbjct: 164 KIMTKAKSERIGRFAFDFAV---KNNRKSVCAV-HKANIMKLGDGLFRNCINEVGAKE-- 217

Query: 230 LYGNVSYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP 289
            Y  +     IVD+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP AN G 
Sbjct: 218 -YPEIDVKNIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANFGR 276

Query: 290 DIIIGEP-CHGSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKI 348
           +  + EP       DI GQ ++NP A I S++LML+ LG N  A  I  A  + I   K 
Sbjct: 277 EYAVFEPGSRHVGLDIKGQNVANPTAMILSSSLMLRHLGLNAYADRISKATYDVIAEAKT 336

Query: 349 KTPDLGGDSSTTEVTDDILSKL 370
            T D+GG +STTE T+ I+SKL
Sbjct: 337 TTQDIGGSASTTEFTEAIISKL 358

>Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  189 bits (481), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 129/390 (33%), Positives = 208/390 (53%), Gaps = 41/390 (10%)

Query: 1   MLRNGVYRACARRTVVNGARSNL--------------TIGLIPGDGIGKEVIPAGKKVLE 46
           MLRN   R  +RR +    + ++              T+  I GDGIG E+  + KK+  
Sbjct: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 47  TIGDKYSIDFKFIDLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYS 106
                  I+++F D++     F++    +PD  V  + +    AL G + +P  K  G+ 
Sbjct: 61  --AADVPINWEFCDVNP---IFVNGLTTIPDPAVQSITKNLV-ALKGPLATPIGK--GHR 112

Query: 107 SPIVALRKQLGLYANIRPVKSVSG--TNDRPVDMVIVRENTEDLYIKEERTYIDEATGTK 164
           S  + LRK  GL+AN+RP KS+ G  T    VD+V++RENTE  Y     + I+      
Sbjct: 113 SLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEY-----SGIEHIVCPG 167

Query: 165 VAEATKRISEVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVY 224
           V ++ K I+  A+ ++ + A + A    +  G+  + V HKS +   +DGLF  V +++ 
Sbjct: 168 VVQSIKLITREASERVIRYAFEYA----RAIGRPRIIVVHKSTIQRLADGLFVNVAKELS 223

Query: 225 EKNKDLYGNVSYNEQIVDSMVYRIFREPECFD--VVVAPNLYGDILSDGAAAL-VGSLGV 281
           ++    Y ++++  +++D+ V  +   P  +   V V PNLYGDILSD  + L  GSLG+
Sbjct: 224 KE----YPDITFETELIDNKVLNVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGL 279

Query: 282 VPSANVGPDIIIGEPCHGSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDE 341
            PSAN+G  + I E  HGSAPDI+G+  +NP A + S+ +ML  +G    A  IQNAV  
Sbjct: 280 TPSANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLS 339

Query: 342 NIRSG-KIKTPDLGGDSSTTEVTDDILSKL 370
            I SG + +T DL G ++T+  T+ ++ +L
Sbjct: 340 TIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  189 bits (481), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 124/353 (35%), Positives = 197/353 (55%), Gaps = 27/353 (7%)

Query: 24  TIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQTFLDTGKALPDETVSIL 83
           T+  I GDG+G E+  + K +      K  I+++  D+      F++    +PD  V+ +
Sbjct: 37  TVSFIEGDGVGPEISKSVKAIFS--AAKVPIEWESCDVSP---IFVNGLTTIPDPAVASI 91

Query: 84  KQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSG--TNDRPVDMVIV 141
            +    AL G + +P  K  G+ S  + LRK  GL+AN+RP KS+ G  T    V++V++
Sbjct: 92  NKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLI 148

Query: 142 RENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKNTGKATLT 201
           RENTE  Y     + I+      V ++ K I++ A+ ++ + A + A    +   ++ + 
Sbjct: 149 RENTEGEY-----SGIEHVVAPGVVQSIKLITQDASERVIRYAFEYA----RAVDRSKVL 199

Query: 202 VTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPECFD--VVV 259
           V HKS +   +DGLF +V + +  +    Y ++    +++D+ V +  + PE +D  VVV
Sbjct: 200 VVHKSTIQRLADGLFVDVAKKLSSE----YPDIELQTELLDNTVLKTVQHPEAYDDVVVV 255

Query: 260 APNLYGDILSDGAAAL-VGSLGVVPSANVGPDIIIGEPCHGSAPDISGQGISNPVATIRS 318
            PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDI+GQ  +NP A + S
Sbjct: 256 CPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLS 315

Query: 319 AALMLQFLGYNEAAKDIQNAVDENIRS-GKIKTPDLGGDSSTTEVTDDILSKL 370
           + +ML  +G  E A  I+ AV   I S  K +T DLGG +ST+  TD ++ +L
Sbjct: 316 SVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368

>YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subunit
           of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle;
           phosphorylated
          Length = 369

 Score =  189 bits (481), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 132/390 (33%), Positives = 205/390 (52%), Gaps = 41/390 (10%)

Query: 1   MLRNGVYRACARRTVV--------------NGARSNLTIGLIPGDGIGKEVIPAGKKVLE 46
           MLRN  +R  +RR +               N +    T+  I GDGIG E+  + KK+  
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 47  TIGDKYSIDFKFIDLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYS 106
                  I+++  D+      F++    +PD  V  + +    AL G + +P  K  G+ 
Sbjct: 61  --AANVPIEWESCDVSP---IFVNGLTTIPDPAVQSITKNLV-ALKGPLATPIGK--GHR 112

Query: 107 SPIVALRKQLGLYANIRPVKSVSG--TNDRPVDMVIVRENTEDLYIKEERTYIDEATGTK 164
           S  + LRK  GL+AN+RP KS+ G  T    VD+V++RENTE  Y     + I+      
Sbjct: 113 SLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEY-----SGIEHIVCPG 167

Query: 165 VAEATKRISEVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVY 224
           V ++ K I+  A+ ++ + A + A    +  G+  + V HKS +   +DGLF  V +++ 
Sbjct: 168 VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKELS 223

Query: 225 EKNKDLYGNVSYNEQIVDSMVYRIFREPECFD--VVVAPNLYGDILSDGAAAL-VGSLGV 281
           ++  DL    +   +++D+ V ++   P  +   V V PNLYGDILSD  + L  GSLG+
Sbjct: 224 KEYPDL----TLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDILSDLNSGLSAGSLGL 279

Query: 282 VPSANVGPDIIIGEPCHGSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDE 341
            PSAN+G  I I E  HGSAPDI+GQ  +NP A + S+ +ML  +G    A  IQNAV  
Sbjct: 280 TPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLS 339

Query: 342 NIRSG-KIKTPDLGGDSSTTEVTDDILSKL 370
            I SG + +T DL G ++T+  T+ ++ +L
Sbjct: 340 TIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa]
           {ON} Anc_5.473 YOR136W
          Length = 378

 Score =  189 bits (481), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 132/365 (36%), Positives = 194/365 (53%), Gaps = 39/365 (10%)

Query: 19  ARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQT------FLDTG 72
           A    T+  I GDGIG E+  + K +           F+   +   W+T       +D  
Sbjct: 40  ATGKYTVSFIEGDGIGPEISRSVKDI-----------FQAASVPITWETCDVSPILVDGL 88

Query: 73  KALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSG-- 130
             +PDE V  + +   G L G + +P  K  G+ S  + LRK   L+AN+RP KSV G  
Sbjct: 89  TTIPDEAVKSINKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFK 145

Query: 131 TNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQ 190
           T    VD+V++RENTE  Y     + I+      V ++ K I+  A+ ++ + A + A  
Sbjct: 146 TTYDNVDLVLIRENTEGEY-----SGIEHVVTPGVVQSIKLITRDASERVIRYAFEYA-- 198

Query: 191 RLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVY-EKNKDLYGNVSYNEQIVDSMVYRIF 249
             K  G+  + V HKS +   SDGLF  V +++  EKN   + N+  + +++D+ V  + 
Sbjct: 199 --KAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKN---FQNIELDTELIDNTVLNVV 253

Query: 250 REPECFD--VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPDIIIGEPCHGSAPDISG 306
             P  +   V V PNLYGDILSD  + L  GSLG+ PSAN+G  I I E  HGSAPDI+G
Sbjct: 254 MNPSKYSDAVFVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKISIFEAVHGSAPDIAG 313

Query: 307 QGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENI-RSGKIKTPDLGGDSSTTEVTDD 365
           Q  +NP A + S+ +ML  +G NE    I+NAV + I  S K +T DLGG ++TT  T+ 
Sbjct: 314 QNKANPTALLLSSVMMLHHMGLNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEA 373

Query: 366 ILSKL 370
           ++  L
Sbjct: 374 VIDNL 378

>KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON}
           uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1
           Isocitrate dehydrogenase subunit 1
          Length = 361

 Score =  189 bits (480), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 137/382 (35%), Positives = 202/382 (52%), Gaps = 36/382 (9%)

Query: 1   MLRNGVYRACARRTVVNGARSNL---------TIGLIPGDGIGKEVIPAGKKVLETIGDK 51
           MLR G+  A  +++    A   L         T+ LIPGDG+GKEV  +  K+ E   + 
Sbjct: 1   MLRQGI--AAQKKSFATLAAEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVKIFEN--EN 56

Query: 52  YSIDFKFIDLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVA 111
             ID++ ID+ +G +   +  +A     V  LK+   G L G   +P  +  G+ S  VA
Sbjct: 57  IPIDWETIDI-SGLENTENVQRA-----VESLKRNKVG-LKGIWHTPADQT-GHGSLNVA 108

Query: 112 LRKQLGLYANIRPVKSVSGTNDR--PVDMVIVRENTEDLYIKEERTYIDEATGTKVAEAT 169
           LRKQL ++AN+   KS+ G   R   +DMVI+RENTE  Y     + ++  +   V E+ 
Sbjct: 109 LRKQLDIFANVALFKSIPGVKTRLNNIDMVIIRENTEGEY-----SGLEHESVPGVVESL 163

Query: 170 KRISEVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKD 229
           K ++   + +IA+ A D AL   KN  K+   V HK+N++   DGLFR    ++     +
Sbjct: 164 KIMTRAKSERIARFAFDFAL---KNNRKSVCAV-HKANIMKLGDGLFRNTVNEI---GAN 216

Query: 230 LYGNVSYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP 289
            Y  +     IVD+   +   +P  FDV+V PNLYG IL +  +AL+G  G+VP AN G 
Sbjct: 217 EYPELDVKNIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGSALIGGPGLVPGANFGR 276

Query: 290 DIIIGEP-CHGSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKI 348
           +  + EP       DI GQ ++NP A I S+ LML+ LG N  A  I  A  + I  GK 
Sbjct: 277 EYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLMLRHLGLNAYADRISKATYDVISEGKS 336

Query: 349 KTPDLGGDSSTTEVTDDILSKL 370
            T D+GG +ST+E T+ ++ KL
Sbjct: 337 TTRDIGGSASTSEFTNAVIEKL 358

>Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar to
           Ashbya gossypii ADL223W
          Length = 362

 Score =  189 bits (480), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 137/380 (36%), Positives = 197/380 (51%), Gaps = 31/380 (8%)

Query: 1   MLRNGVYRACARRTVVNGAR-------SNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYS 53
           MLRN   +   RR  +   +          T+ LIPGDG+GKEV  +   + E   +   
Sbjct: 1   MLRNTFVQISKRRFALASGQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVNIFEA--ENVP 58

Query: 54  IDFKFIDLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALR 113
           ID++ ++L    +      KA     V  LK+   G L G   +P  +  G+ S  VA R
Sbjct: 59  IDWESVELSGLEENMEGVQKA-----VESLKRNKVG-LKGIWSTPADQT-GHGSLNVAFR 111

Query: 114 KQLGLYANIRPVKSVSG--TNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKR 171
           KQL ++AN+   KS  G  T  + VD+VI+RENTE  Y     + ++  +   V E+ K 
Sbjct: 112 KQLDIFANVALFKSFPGVKTKLKDVDLVIIRENTEGEY-----SGLEHESVPGVVESLKI 166

Query: 172 ISEVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLY 231
           +++  + +IA+ A D AL   KN  ++   V HK+N++   DGLFR    ++  K    Y
Sbjct: 167 MTKAKSERIARFAFDFAL---KNNRRSVCAV-HKANIMKLGDGLFRNTVNEIGAKE---Y 219

Query: 232 GNVSYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDI 291
             +     IVD+   +   +P  FDV+V PNLYG IL +  AAL+GS G+VP AN G + 
Sbjct: 220 PELEVKSIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNVGAALIGSPGLVPGANFGREY 279

Query: 292 IIGEP-CHGSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKT 350
            + EP       DI GQ ++NP A I S+ LML+ LG N+ A  I  A  E I  GK  T
Sbjct: 280 AVFEPGSRHVGLDIKGQDVANPTAMILSSTLMLRHLGLNDYADRISKATYEVIAEGKHTT 339

Query: 351 PDLGGDSSTTEVTDDILSKL 370
            D+GG +STT+ T  I+ KL
Sbjct: 340 KDIGGHASTTQFTKAIVDKL 359

>Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON}
           (32084..33190) [1107 nt, 369 aa]
          Length = 368

 Score =  189 bits (479), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 128/389 (32%), Positives = 204/389 (52%), Gaps = 40/389 (10%)

Query: 1   MLRNGVYRACARRTVVNG-------------ARSNLTIGLIPGDGIGKEVIPAGKKVLET 47
           MLRN +YR    R +  G                  T+  I GDG+G E+  + K +   
Sbjct: 1   MLRNTIYRGSFARMMTTGQPNIGRFTGKPNPVTGKYTVPFIEGDGVGPEISKSVKDIFA- 59

Query: 48  IGDKYSIDFKFIDLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSS 107
              K  I+++  D+      F++    +PD  V  + +    AL G + +P  K  G+ S
Sbjct: 60  -AAKVPIEWEPCDV---GPIFVNGLTTIPDAAVQSINKHLV-ALKGPLATPIGK--GHRS 112

Query: 108 PIVALRKQLGLYANIRPVKSVSG--TNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKV 165
             + LRK   L+AN+RP +SV    T  + VD+V++RENTE  Y     + I+      V
Sbjct: 113 LNLTLRKTFNLFANVRPARSVPNYKTTYQNVDLVLIRENTEGEY-----SGIEHVISPGV 167

Query: 166 AEATKRISEVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYE 225
            ++ K I++ A+ ++ + A +      +  G+  L V HKS +   +DGLF  V +++  
Sbjct: 168 IQSIKLITKDASERVIRYAFEYT----RAIGRPRLVVVHKSTIQRMADGLFVNVAKELAS 223

Query: 226 KNKDLYGNVSYNEQIVDSMVYRIFREPECFD--VVVAPNLYGDILSDGAAAL-VGSLGVV 282
           +    Y ++    +++D+ +  +   PE +   V V PNLYGDILSD  + L  GSLG+ 
Sbjct: 224 E----YPDIELQTELIDNTILNVVTHPESYTDAVSVCPNLYGDILSDLNSGLSAGSLGLT 279

Query: 283 PSANVGPDIIIGEPCHGSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDEN 342
           PSAN+G  + I E  HGSAPDI+GQ  +NP A + S+ +ML  +G NE A  I+NA+   
Sbjct: 280 PSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNEHATKIENAILST 339

Query: 343 IRSG-KIKTPDLGGDSSTTEVTDDILSKL 370
           I SG + +T DL G ++T+  T+ +++KL
Sbjct: 340 IASGSENRTGDLAGTATTSSFTEAVINKL 368

>NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473
          Length = 422

 Score =  190 bits (483), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 129/390 (33%), Positives = 207/390 (53%), Gaps = 41/390 (10%)

Query: 1   MLRNGVYRACARRTVV--------------NGARSNLTIGLIPGDGIGKEVIPAGKKVLE 46
           M R+ + R   RR +               N +    T+  I GDGIG E+  + K++  
Sbjct: 54  MFRSSILRTTTRRLLSVKHQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFS 113

Query: 47  TIGDKYSIDFKFIDLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYS 106
               K  I+++  D+      F+D    +P+  V  + +    AL G + +P  K  G+ 
Sbjct: 114 --AAKVPIEWETCDV---TPLFIDGLTTIPEPAVQSINKNLV-ALKGPLATPIGK--GHR 165

Query: 107 SPIVALRKQLGLYANIRPVKSVSG--TNDRPVDMVIVRENTEDLYIKEERTYIDEATGTK 164
           S  + LRK  GL+AN+RP +SV G  T    VD+V++RENTE  Y     + I+      
Sbjct: 166 SLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLVLIRENTEGEY-----SGIEHVVTPG 220

Query: 165 VAEATKRISEVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVY 224
           V ++ K I+  A+ ++ + A +      +  G+  L V HKS +   SDGLF  V +++ 
Sbjct: 221 VVQSIKLITREASERVIRYAFEYC----RAIGRPRLVVVHKSTIQRLSDGLFVNVAKELS 276

Query: 225 EKNKDLYGNVSYNEQIVDSMVYRIFREPECFD--VVVAPNLYGDILSDGAAAL-VGSLGV 281
           ++    Y ++ +  +++D+ V ++   P  +   V V PNLYGDILSD  + L  GSLG+
Sbjct: 277 KE----YPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGL 332

Query: 282 VPSANVGPDIIIGEPCHGSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDE 341
            PS N+G +I I E  HGSAPDI+G+ ++NP A + S+ +ML  +G ++ A  I+NAV  
Sbjct: 333 TPSGNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSSVMMLNHMGLSKHADQIENAVLS 392

Query: 342 NIRSG-KIKTPDLGGDSSTTEVTDDILSKL 370
            I SG + +T DL G ++T+  TD ++ KL
Sbjct: 393 TIASGPESRTGDLAGTATTSTFTDAVIKKL 422

>Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa]
           {ON} complement(108102..109181) [1080 nt, 360 aa]
          Length = 359

 Score =  187 bits (476), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 124/350 (35%), Positives = 189/350 (54%), Gaps = 26/350 (7%)

Query: 24  TIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQTFLDTGKALPDETVSIL 83
           T+ L+PGDG+G+E+  +   + E   +   ID++ ++L    Q  + T        V  L
Sbjct: 30  TVTLLPGDGVGREITDSVVSIFE--AENLPIDWERVELSGLEQEDVHTA-------VESL 80

Query: 84  KQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSGTNDR--PVDMVIV 141
           K+   G     +   +   +G++S  VALRK+L +YAN+   KS  G + R   VD+VI+
Sbjct: 81  KRNKIG--LKGIWHTSADHDGHTSWNVALRKELDIYANVAIFKSFKGVDTRIPDVDLVII 138

Query: 142 RENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKNTGKATLT 201
           RENTE  Y     + ++  +   V E+ K ++   T +IA+ A D A++      + ++T
Sbjct: 139 RENTEGEY-----SGLEHESVPGVVESLKIMTAQKTERIARFAFDYAMKY----NRKSVT 189

Query: 202 VTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPECFDVVVAP 261
             HK+N++   DGLFR +  ++  K    Y  V  +  IVD+   +   +P  FDV+VAP
Sbjct: 190 AVHKANIMKLGDGLFRNLVTEIGAKE---YPEVGVSSIIVDNASMQAVAKPHQFDVMVAP 246

Query: 262 NLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEP-CHGSAPDISGQGISNPVATIRSAA 320
           ++YG IL +  AAL+G  G+VP AN G D  + EP       DI  Q I+NP A I SA 
Sbjct: 247 SMYGTILGNIGAALIGGPGLVPGANYGRDYAVFEPGSRHVGLDIENQNIANPTAMILSAT 306

Query: 321 LMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTTEVTDDILSKL 370
           LML  LG+   A  I  AV E I  GK  T D+GG ++TTE T+ +++KL
Sbjct: 307 LMLNHLGFRNDAARISKAVHEVIAEGKTTTRDIGGSATTTEFTNAVIAKL 356

>Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  188 bits (477), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 131/390 (33%), Positives = 206/390 (52%), Gaps = 41/390 (10%)

Query: 1   MLRNGVYRACARRTVV--------------NGARSNLTIGLIPGDGIGKEVIPAGKKVLE 46
           MLR+ ++R  +RR +               N +    T+  I GDGIG E+  + KK+  
Sbjct: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60

Query: 47  TIGDKYSIDFKFIDLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYS 106
                  I+++  D++     F++    +PD  V  +      AL G + +P  K  G+ 
Sbjct: 61  --AANVPIEWESCDVNP---IFVNGLTTIPDAAVQSITNNLI-ALKGPLATPIGK--GHR 112

Query: 107 SPIVALRKQLGLYANIRPVKSVSG--TNDRPVDMVIVRENTEDLYIKEERTYIDEATGTK 164
           S  + LRK  GL+AN+RP KSV G  T    VD+V++RENTE  Y     + I+      
Sbjct: 113 SLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEY-----SGIEHIVCPG 167

Query: 165 VAEATKRISEVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVY 224
           V ++ K I+  A+ ++ + A + A    +  G+  + V HKS +   +DGLF  V +++ 
Sbjct: 168 VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKELS 223

Query: 225 EKNKDLYGNVSYNEQIVDSMVYRIFREPECFD--VVVAPNLYGDILSDGAAAL-VGSLGV 281
           ++    Y ++    +++D+ V ++   P  +   V V PNLYGDILSD  + L  GSLG+
Sbjct: 224 KE----YPDIILETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGL 279

Query: 282 VPSANVGPDIIIGEPCHGSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDE 341
            PSAN+G  I I E  HGSAPDI+GQ  +NP A + S+ +ML  +G    A  IQNAV  
Sbjct: 280 TPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLS 339

Query: 342 NIRSG-KIKTPDLGGDSSTTEVTDDILSKL 370
            I SG + +T DL G ++T+  T+ ++ +L
Sbjct: 340 TIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {ON}
           Anc_5.473
          Length = 369

 Score =  187 bits (476), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 130/390 (33%), Positives = 206/390 (52%), Gaps = 41/390 (10%)

Query: 1   MLRNGVYRACARRTVV--------------NGARSNLTIGLIPGDGIGKEVIPAGKKVLE 46
           M RN + R   RR +               N +    T+  I GDGIG E+  + K++ +
Sbjct: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60

Query: 47  TIGDKYSIDFKFIDLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYS 106
               K  ID++  D+      F++    +P+  V  + +    AL G + +P  K  G+ 
Sbjct: 61  --AAKVPIDWEPCDVSP---LFINGLTTIPEPAVQSINKNLV-ALKGPLATPIGK--GHR 112

Query: 107 SPIVALRKQLGLYANIRPVKSVSG--TNDRPVDMVIVRENTEDLYIKEERTYIDEATGTK 164
           S  + LRK  GL+AN+RP KS+ G  T    VD+VI+RENTE  Y     + I+      
Sbjct: 113 SLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEY-----SGIEHVVTPG 167

Query: 165 VAEATKRISEVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVY 224
           V ++ K I+  A+ ++ + A + A    +  G+  + V HKS +   +DGLF +V +++ 
Sbjct: 168 VVQSIKLITRDASERVIRYAYEYA----RAIGRPRVIVVHKSTIQRLADGLFVDVAKELS 223

Query: 225 EKNKDLYGNVSYNEQIVDSMVYRIFREPECFD--VVVAPNLYGDILSDGAAAL-VGSLGV 281
           ++    Y ++    +++D+ V  +   P  +   V V PNLYGDILSD  + L  GSLG+
Sbjct: 224 QE----YPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDILSDLNSGLSAGSLGL 279

Query: 282 VPSANVGPDIIIGEPCHGSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDE 341
            PSAN+G ++ I E  HGSAPDI+GQ  +NP A + S+ +ML  +G N  A  I+ AV  
Sbjct: 280 TPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLS 339

Query: 342 NIRSG-KIKTPDLGGDSSTTEVTDDILSKL 370
            I SG + +T DL G ++T+  TD ++ +L
Sbjct: 340 TIASGPEGRTGDLAGKATTSSFTDAVIGRL 369

>CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2 isocitrate dehydrogenase
          Length = 368

 Score =  187 bits (474), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 127/366 (34%), Positives = 192/366 (52%), Gaps = 39/366 (10%)

Query: 17  NGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQT------FLD 70
           N +    T+  I GDGIG E+  + K++           F+  D+   W+T      F++
Sbjct: 30  NPSTGKFTVSFIEGDGIGPEISSSVKRI-----------FQAADVPVEWETCDVTPIFVN 78

Query: 71  TGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSG 130
               +PD  V  + +    AL G + +P  K  G+ S  + LRK   L+AN+RP KS+ G
Sbjct: 79  GLTTIPDPAVQSINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEG 135

Query: 131 --TNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIA 188
             T    VD+V++RENTE  Y     + I+      V ++ K I+  A+ ++ + A + A
Sbjct: 136 FKTTYENVDLVLIRENTEGEY-----SGIEHLVSPGVVQSIKLITRDASERVIRYAYEYA 190

Query: 189 LQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRI 248
               +  G+  L V HKS +   +DGLF  V +++  +    Y ++    +++D+    +
Sbjct: 191 ----RAIGRPRLIVVHKSTIQRLADGLFVNVAKELAAE----YPDIQLETELIDNTCLNV 242

Query: 249 FREPECFD--VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPDIIIGEPCHGSAPDIS 305
              P  +   V V PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDI+
Sbjct: 243 VSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIA 302

Query: 306 GQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSG-KIKTPDLGGDSSTTEVTD 364
           GQ  +NP A + S+ +ML  +G  E A  I+ AV   I  G + +T DLGG +STT  TD
Sbjct: 303 GQNKANPTALLLSSVMMLNHMGMTEHADRIEKAVLGTIAGGSEYRTGDLGGSASTTSFTD 362

Query: 365 DILSKL 370
            I+ KL
Sbjct: 363 AIIKKL 368

>KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|P28834 Saccharomyces cerevisiae
           YNL037C IDH1 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  186 bits (471), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 136/381 (35%), Positives = 202/381 (53%), Gaps = 35/381 (9%)

Query: 1   MLRNGVYRACARRTVVNGARSNL--------TIGLIPGDGIGKEVIPAGKKVLETIGDKY 52
           MLRNG     ++R++   A   L        T+ LIPGDG+GKEV  +   + E+  +  
Sbjct: 1   MLRNGF--GISKRSLATVAEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFES--ENV 56

Query: 53  SIDFKFIDLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVAL 112
            ID++ +++       LD  + +  + V  LK+   G L G   +P+ +  G+ S  VAL
Sbjct: 57  PIDWETVEISG-----LDNEEGV-QKAVDSLKRNKVG-LKGIWHTPSDQT-GHGSLNVAL 108

Query: 113 RKQLGLYANIRPVKSVSGTNDRP--VDMVIVRENTEDLYIKEERTYIDEATGTKVAEATK 170
           RKQL ++AN+   K+V G   R   VD+V++RENTE  Y     + ++  +   V E+ K
Sbjct: 109 RKQLDIFANVALFKTVPGVPSRHSNVDLVVIRENTEGEY-----SGLEHESVPGVVESLK 163

Query: 171 RISEVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDL 230
            +++  + +I + A D AL   KN  K+   V HK+N++   DGLFR    ++  K    
Sbjct: 164 IMTKAKSDRIGRFAFDFAL---KNNRKSVCAV-HKANIMKLGDGLFRNCINEIGAKE--- 216

Query: 231 YGNVSYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD 290
           Y  +     IVD+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP AN G +
Sbjct: 217 YPEIEVKNIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANFGRE 276

Query: 291 IIIGEP-CHGSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIK 349
             + EP       DI GQ ++NP A I S+ALML+ LG N  A  I  A  + I   K  
Sbjct: 277 FAVFEPGSRHVGLDIKGQNVANPTAMILSSALMLRHLGLNSYADRISKATYDVIAEAKNT 336

Query: 350 TPDLGGDSSTTEVTDDILSKL 370
           T D+GG +STT+ T  I+ KL
Sbjct: 337 TKDIGGSASTTDFTQAIIEKL 357

>Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}
           similar to Ashbya gossypii AFR137C
          Length = 370

 Score =  186 bits (471), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 121/353 (34%), Positives = 195/353 (55%), Gaps = 27/353 (7%)

Query: 24  TIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQTFLDTGKALPDETVSIL 83
           T+  I GDGIG E+  + K +      K  +++++ D+      F++    +PD  V  +
Sbjct: 39  TVSFIEGDGIGPEISQSVKDIFS--AAKVPVEWEYCDV---TPIFINGLTTIPDPAVQSI 93

Query: 84  KQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSG--TNDRPVDMVIV 141
            +    AL G + +P  K  G+ S  + LRK  GL+AN+RP KS+ G  T    VD+V++
Sbjct: 94  NKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLI 150

Query: 142 RENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKNTGKATLT 201
           RENTE  Y     + I+      V ++ K I+  A+ ++ + A + A    +  G+  + 
Sbjct: 151 RENTEGEY-----SGIEHVVSPGVVQSIKLITRDASERVIRYAFEYA----RAVGRPKVV 201

Query: 202 VTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPECFD--VVV 259
           V HKS +   +DGLF  V ++V ++    Y ++    +++D+ V  +  +PE +   V V
Sbjct: 202 VVHKSTIQRLADGLFVNVAQEVGKE----YPDIELQPELIDNTVLNVVSKPEKYSDSVAV 257

Query: 260 APNLYGDILSDGAAAL-VGSLGVVPSANVGPDIIIGEPCHGSAPDISGQGISNPVATIRS 318
            PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDI+GQ  +NP A + S
Sbjct: 258 CPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNCANPTALLLS 317

Query: 319 AALMLQFLGYNEAAKDIQNAVDENIRSGKI-KTPDLGGDSSTTEVTDDILSKL 370
           + +ML  +G +E A  I++AV   + S K  +T DL G ++T+  T  ++ +L
Sbjct: 318 SVMMLNHMGLHEHADQIESAVLATVASDKKNRTADLAGTATTSSFTKAVIERL 370

>TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {ON}
           Anc_2.278 YNL037C
          Length = 361

 Score =  185 bits (470), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 135/379 (35%), Positives = 195/379 (51%), Gaps = 30/379 (7%)

Query: 1   MLRNGVYR------ACARRTVVNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSI 54
           MLR+ V +      A A + +         + LIPGDG+GKEV  +   + E   +   I
Sbjct: 1   MLRSAVGKRMFASVAAAEKVLPKKYGGRFVVTLIPGDGVGKEVTDSVVSIFEA--ENLPI 58

Query: 55  DFKFIDLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRK 114
           D+  +D+       LD  + +    V  LK+   G L G   +      G  S  VALRK
Sbjct: 59  DWDRVDISG-----LDHEEGV-QAAVDSLKRNKIG-LKGIWHTSAADQAGKGSLNVALRK 111

Query: 115 QLGLYANIRPVKSVSGTNDR--PVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRI 172
           +L +YAN+   KSV G   +   VD+V++RENTE  Y     + ++  +   V E+ K +
Sbjct: 112 ELDIYANVALFKSVPGVKTKIPNVDLVVIRENTEGEY-----SGLEHESVPGVVESLKIM 166

Query: 173 SEVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYG 232
           +E  T +IA+ A D A    K   +  +T  HK+N++   DGLFR V   V E+    Y 
Sbjct: 167 TEDKTERIARFAFDFA----KKYNRHAVTAVHKANIMKLGDGLFRNVVTRVGEQE---YP 219

Query: 233 NVSYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDII 292
           +V     IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G +  
Sbjct: 220 DVKVGSIIVDNASMQTVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANYGREYA 279

Query: 293 IGEP-CHGSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTP 351
           + EP       DI  + I+NP A I SA+LML  LG + +A  I NAV + I  GK  TP
Sbjct: 280 VFEPGSRHVGLDIKDKNIANPTAMILSASLMLDHLGLSTSATKISNAVHQVIAEGKSTTP 339

Query: 352 DLGGDSSTTEVTDDILSKL 370
           D+GG +STTE T  ++ KL
Sbjct: 340 DIGGSASTTEFTQAVIEKL 358

>TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score =  185 bits (469), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 124/350 (35%), Positives = 191/350 (54%), Gaps = 25/350 (7%)

Query: 24  TIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQTFLDTGKALPDETVSIL 83
           T+ LIPGDG+GKEV  +   +     +   ID++ +D+       LD  + + +  V+ L
Sbjct: 35  TVTLIPGDGVGKEVTDSVVSIFNA--ENLPIDWERVDISG-----LDHEEGV-EAAVNSL 86

Query: 84  KQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSGTNDR--PVDMVIV 141
           K+   G     +   +     + S  VALRKQL +YAN+   K++ G   R   VD+VI+
Sbjct: 87  KRNKIG--LKGIWHTSAGQSDHGSLNVALRKQLDIYANVAHFKTLPGVKTRIPDVDLVII 144

Query: 142 RENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKNTGKATLT 201
           RENTE  Y     + ++  +   V E+ K I++  + +IA+ A D A    K   +  +T
Sbjct: 145 RENTEGEY-----SGLEHESVPGVVESLKIITKEKSERIARFAFDFA----KRFDRKLVT 195

Query: 202 VTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPECFDVVVAP 261
             HK+N++   DGLFR     + E     Y ++  +  IVD+   +   +P  FDV+V P
Sbjct: 196 AVHKANIMKLGDGLFRNSVTSIGETE---YPDIKVSSIIVDNASMQSVAKPHQFDVLVTP 252

Query: 262 NLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEP-CHGSAPDISGQGISNPVATIRSAA 320
           ++YG IL +  AAL+G  G+VP AN G +  + EP       DI GQ ++NP A I S+ 
Sbjct: 253 SMYGTILGNIGAALIGGPGLVPGANYGTECAVFEPGSRHVGLDIKGQNVANPTAMILSST 312

Query: 321 LMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTTEVTDDILSKL 370
           L+L+ LG N  AK I++AV + I  GK+ T D+GG +STTE T++I+ KL
Sbjct: 313 LLLKHLGLNNEAKKIEDAVYKTIAEGKVTTRDIGGSASTTEFTNEIIKKL 362

>NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa]
           {ON} Anc_2.278
          Length = 359

 Score =  184 bits (466), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 124/351 (35%), Positives = 192/351 (54%), Gaps = 26/351 (7%)

Query: 23  LTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQTFLDTGKALPDETVSI 82
           +T+ L+PGDG+GKE+  +   + +   +   ID++ +D+     + LD    + +  V  
Sbjct: 29  MTVTLLPGDGVGKEITDSVVSIFQ--AENVPIDWETVDI-----SQLDHEDGV-NAAVES 80

Query: 83  LKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSGTNDR--PVDMVI 140
           LK+   G L G   +   +V G+ S  VA RKQL +YAN+   KS+ G   +   VD+VI
Sbjct: 81  LKRNKIG-LKGIWHTSADQV-GHGSLNVAFRKQLDIYANVAFCKSIPGVKTKIPNVDLVI 138

Query: 141 VRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKNTGKATL 200
           +RENTE  Y     + ++  +   V E+ K +++V + +IAK A D A++      +  +
Sbjct: 139 IRENTEGEY-----SGLEHESVPGVVESLKIVTKVNSERIAKFAFDFAMRH----DRKMV 189

Query: 201 TVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPECFDVVVA 260
           T  HK+N++  SDGLFR     V E     Y  +  +  IVD+   +   +P  FDV+V 
Sbjct: 190 TAVHKANIMKLSDGLFRNTVARVGEA----YPQIKNDSIIVDNASMQAVAKPHQFDVMVT 245

Query: 261 PNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEP-CHGSAPDISGQGISNPVATIRSA 319
           P++YG IL +  AAL+G  G+VP  N G +  + EP       DI GQ ++NP A I S+
Sbjct: 246 PSMYGTILGNIGAALIGGPGLVPGVNYGREYAVFEPGSRHVGLDIKGQNVANPTAMILSS 305

Query: 320 ALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTTEVTDDILSKL 370
            L+LQ LG N+ A  I  AV + I+ G   T D+GG++STTE T  ++ KL
Sbjct: 306 TLLLQHLGLNDTASRISKAVYDVIKEGNATTKDIGGNASTTEFTKAVIDKL 356

>NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {ON}
           Anc_2.278
          Length = 359

 Score =  184 bits (466), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 122/351 (34%), Positives = 193/351 (54%), Gaps = 25/351 (7%)

Query: 23  LTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQTFLDTGKALPDETVSI 82
            T+ L+PGDG+GKE+  +   + ++  +   ID++ +D+       LD  + +    V  
Sbjct: 28  FTVTLLPGDGVGKEITDSVVSIFKS--ENVPIDWETVDISG-----LDHTEGV-KAAVDS 79

Query: 83  LKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSGTNDR--PVDMVI 140
           LK+   G L G   +P  +V G+ S  VA RKQL +YAN+   KS+ G   +   VD+V+
Sbjct: 80  LKRNKIG-LKGIWHTPADQV-GHGSLNVAFRKQLDIYANVAIFKSIEGVKTKIPNVDLVV 137

Query: 141 VRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKNTGKATL 200
           +RENTE  Y     + ++  +   V E+ K I++  + +IA+ A D A    K   + ++
Sbjct: 138 IRENTEGEY-----SGLEHESVPGVVESLKIITKSKSERIARFAFDFA----KRNNRKSV 188

Query: 201 TVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPECFDVVVA 260
           T  HK+N++  SDGLFR     + E+    Y  +  +  IVD+   +   +P  FDV+V 
Sbjct: 189 TAVHKANIMKLSDGLFRNTVSKIGEEE---YPEIQTSSIIVDNASMQAVAKPHQFDVMVT 245

Query: 261 PNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEP-CHGSAPDISGQGISNPVATIRSA 319
           P++YG I+ +  AAL+G  G+VP  N G D  + EP       DI GQ ++NP A + SA
Sbjct: 246 PSMYGTIVGNIGAALIGGPGLVPGVNYGRDYAVFEPGSRHVGLDIKGQNVANPTAMLLSA 305

Query: 320 ALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTTEVTDDILSKL 370
            L+L  LG  ++A  I++AV + I  GK  T D+GG +STTE T  +++KL
Sbjct: 306 TLLLDHLGLEKSANRIKSAVYDVIAEGKATTQDIGGSASTTEFTQAVINKL 356

>Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON}
           (21411..22517) [1107 nt, 369 aa]
          Length = 368

 Score =  183 bits (465), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 121/358 (33%), Positives = 195/358 (54%), Gaps = 27/358 (7%)

Query: 19  ARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQTFLDTGKALPDE 78
           A    T+  I GDG+G E+  + KK+      K  I++   D+      F++    +P+ 
Sbjct: 32  ATGKFTVPFIEGDGVGPEISESVKKIFS--AAKVPIEWVPCDV---GPIFVNGQTTIPEP 86

Query: 79  TVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSG--TNDRPV 136
            V ++ +    AL G + +P  K  G+ S  + LRK   L+AN+RP +S+    +    V
Sbjct: 87  AVELINKHLI-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPARSIPNYKSTYENV 143

Query: 137 DMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKNTG 196
           D+V++RENTE  Y     + I+      V ++ K I+  AT ++ + A +      +  G
Sbjct: 144 DLVLIRENTEGEY-----SGIEHVITPGVIQSIKLITREATERVVRYAFEYT----QAIG 194

Query: 197 KATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPECFD 256
           +  L V HKS +   +DGLF +V  ++  +    Y ++    +I+D  +  +  +PE + 
Sbjct: 195 RPRLLVIHKSTIQRMADGLFVKVAEELASE----YPDIKLETEIIDKSILNVVSKPELYS 250

Query: 257 --VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPDIIIGEPCHGSAPDISGQGISNPV 313
             V V PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDI+GQ  +NP 
Sbjct: 251 DAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPT 310

Query: 314 ATIRSAALMLQFLGYNEAAKDIQNAVDENIRSG-KIKTPDLGGDSSTTEVTDDILSKL 370
           A + S+ +ML+ +G +E A  I+NAV   I SG + +T DL G +ST+  T++++ +L
Sbjct: 311 ALLLSSVMMLKHMGLDEHANKIENAVLTTIASGSENRTADLSGTASTSSFTEEVIQRL 368

>KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  184 bits (466), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 132/394 (33%), Positives = 206/394 (52%), Gaps = 45/394 (11%)

Query: 1   MLRNGVYRAC--ARRTVVNGARSNLTIG----------------LIPGDGIGKEVIPAGK 42
           MLRN + R    ARR +    ++  +IG                 I GDGIG E+  + K
Sbjct: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60

Query: 43  KVLETIGDKYSIDFKFIDLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKV 102
            + +    +  I+++F D+      F++    +PD  V+ + +    AL G + +P  K 
Sbjct: 61  DIFK--AAEVPINWEFCDV---TPIFVNGLTTIPDPAVASINKNLI-ALKGPLATPIGK- 113

Query: 103 EGYSSPIVALRKQLGLYANIRPVKSVSG--TNDRPVDMVIVRENTEDLYIKEERTYIDEA 160
            G+ S  + LRK   L+AN+RP KS+ G  T    VD+V++RENTE  Y     + I+  
Sbjct: 114 -GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEY-----SGIEHV 167

Query: 161 TGTKVAEATKRISEVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVC 220
               V ++ K I+  A+ ++ + A + A    K  G+  + V HKS +   +DGLF  V 
Sbjct: 168 VAPGVVQSIKLITRDASERVIRYAFEYA----KAIGRPRVVVVHKSTIQRLADGLFVNVA 223

Query: 221 RDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPECFD--VVVAPNLYGDILSDGAAAL-VG 277
           +++ ++    Y  +    +++D+ V  +   P  +   V V PNLYGDILSD  + L  G
Sbjct: 224 KELSKE----YPEIKLETELIDNTVLNVVSNPAGYTDAVSVCPNLYGDILSDLNSGLSAG 279

Query: 278 SLGVVPSANVGPDIIIGEPCHGSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQN 337
           SLG+ PSAN+G +I I E  HGSAPDI+GQ  +NP A + S+ +ML  +G  + A  I+ 
Sbjct: 280 SLGLTPSANIGNEISIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIER 339

Query: 338 AVDENI-RSGKIKTPDLGGDSSTTEVTDDILSKL 370
           AV   I  S K +T DLGG ++T+  TD ++  L
Sbjct: 340 AVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373

>TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  183 bits (465), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 117/360 (32%), Positives = 199/360 (55%), Gaps = 27/360 (7%)

Query: 17  NGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQTFLDTGKALP 76
           N +    T+  I GDG+G E+  + K + +    +  +D+++ D+       L T   +P
Sbjct: 35  NPSTGRFTVPFIEGDGVGPEISKSVKDIFK--AAQVPVDWEYCDVSPLLINGLTT---IP 89

Query: 77  DETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSG--TNDR 134
           +  V  + +  + AL G + +P  K  G+ S  + LRK  GL+AN+RP +S+ G  T  +
Sbjct: 90  EPAVQQINKH-KIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSIRGYETTYK 146

Query: 135 PVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKN 194
            VD+V++RENTE  Y     + I+      V ++ K I+  A+ ++ + A + A    + 
Sbjct: 147 NVDLVLIRENTEGEY-----SGIEHVVAPGVVQSIKLITRDASERVIRYAYEYA----RA 197

Query: 195 TGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPEC 254
            G+  L V HKS +   +DGLF  + +++  +    + ++    +++D+ V  + R+P  
Sbjct: 198 IGRPRLVVVHKSTIQKLADGLFVNIAKELAPE----FPDIKLETELIDNTVLNVVRDPPS 253

Query: 255 FD--VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPDIIIGEPCHGSAPDISGQGISN 311
           +   V V PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDI+GQ  +N
Sbjct: 254 YTDAVTVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEVSIFEAVHGSAPDIAGQNKAN 313

Query: 312 PVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSG-KIKTPDLGGDSSTTEVTDDILSKL 370
           P A + S+ +ML ++G    +  I+NA+   I SG + +T DL G ++T+  T+ ++  L
Sbjct: 314 PTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373

>SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037C IDH1 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 361

 Score =  181 bits (460), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 135/382 (35%), Positives = 200/382 (52%), Gaps = 36/382 (9%)

Query: 1   MLRNGVYRACARRTVVNGARSNL---------TIGLIPGDGIGKEVIPAGKKVLETIGDK 51
           M RN    A ++R++   A   L         T+ LIPGDG+GKEV  +   + E   + 
Sbjct: 1   MFRNTF--AVSKRSLATVATEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFE--AEN 56

Query: 52  YSIDFKFIDLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVA 111
             ID++ I++     T +D+ + +  + V  LK+   G L G   +P  +  G+ S  VA
Sbjct: 57  VPIDWETINI-----TGVDSEEGV-QKAVESLKRNKIG-LKGIWHTPADQT-GHGSLNVA 108

Query: 112 LRKQLGLYANIRPVKSVSGTNDR--PVDMVIVRENTEDLYIKEERTYIDEATGTKVAEAT 169
            RKQL ++AN+   K+V G   +   +D+V++RENTE  Y     + ++  +   V E+ 
Sbjct: 109 FRKQLDIFANVALFKNVPGVKTKLSNIDLVVIRENTEGEY-----SGLEHESVPGVVESL 163

Query: 170 KRISEVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKD 229
           K I++  + +IA+ A D AL   KN  K+   V HK+N++   DGLFR    +V      
Sbjct: 164 KIITKAKSERIARFAFDFAL---KNNRKSVCAV-HKANIMKLGDGLFRNTVNEV---GAS 216

Query: 230 LYGNVSYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP 289
            Y  +     IVD+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP AN G 
Sbjct: 217 EYPEIDVKNIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANFGR 276

Query: 290 DIIIGEP-CHGSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKI 348
           +  + EP       DI G+ ++NP A I S+ LML+ LG N  A  I  A  + I  GK 
Sbjct: 277 EYAVFEPGSRHVGLDIKGKDLANPTAMILSSTLMLRHLGLNGYADRISKATYDVIAEGKH 336

Query: 349 KTPDLGGDSSTTEVTDDILSKL 370
            T D+GG SSTTE T  ++ KL
Sbjct: 337 TTKDIGGSSSTTEFTKSVIDKL 358

>AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR136W
           (IDH2)
          Length = 367

 Score =  181 bits (460), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 121/358 (33%), Positives = 195/358 (54%), Gaps = 27/358 (7%)

Query: 19  ARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQTFLDTGKALPDE 78
           A    T+  I GDG+G E+  + K +         +++++ D+       L T   +P+ 
Sbjct: 31  AAGKYTVSFIEGDGVGPEISQSVKDIFS--AASVPVEWEYCDVTPLLVNGLTT---IPEP 85

Query: 79  TVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSG--TNDRPV 136
            V+ + +    AL G + +P  K  G+ S  + LRK  GL+AN+RP KS+ G  T    V
Sbjct: 86  AVASINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDV 142

Query: 137 DMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKNTG 196
           D+V++RENTE  Y     + I+      V ++ K I+  A+ ++ + A + A    +  G
Sbjct: 143 DLVLIRENTEGEY-----SGIEHVVSPGVVQSIKLITREASERVIRYAFEYA----RTVG 193

Query: 197 KATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPECFD 256
           +  + V HKS +   +DGLF  V +++  +    Y ++    +++D+ V  +  +PE + 
Sbjct: 194 RPKVVVVHKSTIQRLADGLFVNVAQELGRE----YPDIELQTELLDNTVLNVVTKPEAYK 249

Query: 257 VVVA--PNLYGDILSDGAAAL-VGSLGVVPSANVGPDIIIGEPCHGSAPDISGQGISNPV 313
            VVA  PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDI+GQ  +NP 
Sbjct: 250 DVVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHQVSIFEAVHGSAPDIAGQNRANPT 309

Query: 314 ATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKI-KTPDLGGDSSTTEVTDDILSKL 370
           A + S+ +ML  +G +E A  I+ AV   I S +  +T DL G +ST+  T+ ++ +L
Sbjct: 310 ALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAVIERL 367

>SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 369

 Score =  181 bits (460), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 129/396 (32%), Positives = 201/396 (50%), Gaps = 53/396 (13%)

Query: 1   MLRNGVYRACARRTVV--------------NGARSNLTIGLIPGDGIGKEVIPAGKKVLE 46
           MLR+ V R   RR +               N +    T+  I GDG+G E+  + K +  
Sbjct: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDI-- 58

Query: 47  TIGDKYSIDFKFIDLHAGWQT------FLDTGKALPDETVSILKQQCQGALFGAVQSPTT 100
                    F   ++   W++      F++    +P   V  + +    AL G + +P  
Sbjct: 59  ---------FAAAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLI-ALKGPLATPIG 108

Query: 101 KVEGYSSPIVALRKQLGLYANIRPVKSVSG--TNDRPVDMVIVRENTEDLYIKEERTYID 158
           K  G+ S  + LRK  GL+AN+RP KSV G  T    VD+V++RENTE  Y     + I+
Sbjct: 109 K--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEY-----SGIE 161

Query: 159 EATGTKVAEATKRISEVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFRE 218
                 V ++ K I+  A+ ++ + A + A    +  G+  + V HKS +   +DGLF +
Sbjct: 162 HVVSPGVVQSIKLITRDASERVIRYAFEYA----RAVGRPKVMVVHKSTIQRLADGLFVD 217

Query: 219 VCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPECF--DVVVAPNLYGDILSDGAAAL- 275
           V +++  +    Y ++    Q++D+ V  +   P  +   V V PNLYGDILSD  + L 
Sbjct: 218 VAKELSSE----YPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDILSDLNSGLS 273

Query: 276 VGSLGVVPSANVGPDIIIGEPCHGSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDI 335
            GSLG+ PSAN+G  + I E  HGSAPDI+GQ  +NP A + S+ +ML  +G  E A  I
Sbjct: 274 AGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLYEKADSI 333

Query: 336 QNAVDENIRSG-KIKTPDLGGDSSTTEVTDDILSKL 370
           + AV   I SG + +T DL G +ST+  T+ ++ +L
Sbjct: 334 EKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369

>KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {ON}
           Anc_2.278 YNL037C
          Length = 350

 Score =  179 bits (454), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 128/376 (34%), Positives = 195/376 (51%), Gaps = 36/376 (9%)

Query: 1   MLRNGVYRACARRTVVNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFID 60
           MLRN + R                I LIPG+GIGKEV  + + + +   +   ID++ ++
Sbjct: 1   MLRNTLLRRSISTISPKKYGGRFQITLIPGNGIGKEVTDSVRSIFQ--AENLPIDWEIVN 58

Query: 61  LHA---GWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLG 117
           + +   G +T +D+ K            + + AL G   S    ++G  S  VALRKQL 
Sbjct: 59  IESHRDGIKTAVDSIK------------RNKIALKGIWSS--DPIDG--SLNVALRKQLD 102

Query: 118 LYANIRPVKSVSGTNDR--PVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEV 175
           ++AN+   KS    N R   VD+V++RENTE  +   E   +D      V E+ K +++ 
Sbjct: 103 IFANVAIFKSFDNVNTRIPNVDLVVIRENTEGEFSGLEHESVD-----GVVESLKIVTKP 157

Query: 176 ATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVS 235
            T +IA+ A D A +  +N     +T  HK+N++   DGLF+ +   +     + Y  + 
Sbjct: 158 KTERIARFAFDFAKKHNRNH----VTAVHKANIMKLGDGLFKNIVAHI---GNNEYPEIK 210

Query: 236 YNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGE 295
            +  IVD+   +   +P  FDV+V+P++YG IL +  AAL+G  G+VP AN G D  + E
Sbjct: 211 NSSIIVDNASMQAVAKPHQFDVLVSPSMYGTILGNIGAALIGGPGLVPGANFGRDYAVFE 270

Query: 296 P-CHGSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLG 354
           P       DI GQ ++NP A I SA  ML+ LG    A+ I NAV   I  G   T D+G
Sbjct: 271 PGSRHVGLDIKGQNVANPTAMILSATWMLRHLGLTSPAERITNAVKHVIAQGTTVTKDIG 330

Query: 355 GDSSTTEVTDDILSKL 370
           G +STTE TD ++++L
Sbjct: 331 GTASTTEFTDAVINEL 346

>TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2.278
           YNL037C
          Length = 376

 Score =  179 bits (455), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 124/359 (34%), Positives = 189/359 (52%), Gaps = 39/359 (10%)

Query: 24  TIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQ------TFLDTGKALPD 77
           T+  I GDG+G E+  + K +           F   ++   WQ       F++    +P+
Sbjct: 45  TVPFIEGDGVGPEISKSVKDI-----------FSAANVPIQWQPCDVGPIFVNGLTTIPE 93

Query: 78  ETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSG--TNDRP 135
             V  +K+    AL G + +P  K  G+ S  + LRK   L+AN+RP KSV    +    
Sbjct: 94  PAVKAIKESLV-ALKGPLATPVGK--GHRSLNLTLRKTFDLFANVRPAKSVPNYKSTYEN 150

Query: 136 VDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKNT 195
           VD+V++RENTE  Y     + I+      V ++ K I+  A+ K+ + A + A+      
Sbjct: 151 VDLVLIRENTEGEY-----SGIEHIVTPGVVQSIKLITREASEKVIRYAYEYAIA----V 201

Query: 196 GKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPECF 255
           G+  L V HKS +    DGLF ++  ++  +    Y ++    QI+D+ V  +   P  +
Sbjct: 202 GRPRLIVVHKSTIQRLGDGLFVQIANELQSE----YPSIKLETQILDNTVLNVVSNPTLY 257

Query: 256 D--VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPDIIIGEPCHGSAPDISGQGISNP 312
              V V PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDI+GQ  +NP
Sbjct: 258 KDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANP 317

Query: 313 VATIRSAALMLQFLGYNEAAKDIQNAVDENIRSG-KIKTPDLGGDSSTTEVTDDILSKL 370
            A + S+ +ML  +G  E A  I+NAV   I SG + +T DLGG ++T+  T+ ++ KL
Sbjct: 318 TALLLSSVMMLNHMGLEEHASRIENAVLSTIASGPESRTGDLGGSATTSSFTECVIKKL 376

>KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]
           {ON} highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136W IDH2 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 368

 Score =  178 bits (451), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 123/358 (34%), Positives = 191/358 (53%), Gaps = 27/358 (7%)

Query: 19  ARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQTFLDTGKALPDE 78
           A    T+  I GDG+G E+  A K +      K  I ++  D+      F++    +P  
Sbjct: 32  ATGKYTVSFIEGDGVGPEISKAVKDIFA--AAKAPIQWESCDVSP---LFINGLTTIPQP 86

Query: 79  TVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSG--TNDRPV 136
               + +    AL G + +P  K  G+ S  + LRK  GL+AN+RP KSV G  T    V
Sbjct: 87  AQDSINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVQGYKTAYDNV 143

Query: 137 DMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKNTG 196
           D+V++RENTE  Y     + I+      V ++ K I++ A+ ++ + A + A    +   
Sbjct: 144 DLVLIRENTEGEY-----SGIEHVVSPGVVQSIKLITQDASERVIRYAFEYA----RAVE 194

Query: 197 KATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPECFD 256
           +  + V HKS +   +DGLF  V   + ++    Y ++    +++D+ V    R+P  + 
Sbjct: 195 RPKVVVVHKSTIQRLADGLFVSVAEQLSKE----YPDIELQTELIDNTVLHTVRDPTKYS 250

Query: 257 --VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPDIIIGEPCHGSAPDISGQGISNPV 313
             VVV PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDI+GQ  +NP 
Sbjct: 251 DVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKANPT 310

Query: 314 ATIRSAALMLQFLGYNEAAKDIQNAVDENIRSG-KIKTPDLGGDSSTTEVTDDILSKL 370
           A + S+ +ML  +G  E A  I+ AV   I +G + +T DLGG +ST+   + ++S+L
Sbjct: 311 ALLLSSVMMLNHMGLTEHADKIEKAVFTTIAAGPESRTGDLGGSASTSSFAEAVISRL 368

>Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {ON}
           YOR136W (IDH2) - NAD+-dependent isocitrate dehydrogenase
           [contig 130] FULL
          Length = 368

 Score =  177 bits (448), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 124/358 (34%), Positives = 190/358 (53%), Gaps = 27/358 (7%)

Query: 19  ARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQTFLDTGKALPDE 78
           A    T+  I GDG+G E+  A K +      K  I ++  D+      F++    +P  
Sbjct: 32  ATGKYTVSFIEGDGVGPEISKAVKDIFA--AAKAPIQWETCDV---TPLFINGLTTIPQP 86

Query: 79  TVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSG--TNDRPV 136
               + +    AL G + +P  K  G+ S  + LRK  GL+AN+RP KS+ G  T    V
Sbjct: 87  AQDSINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNV 143

Query: 137 DMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKNTG 196
           D+V++RENTE  Y     + I+      V ++ K I++ A+ ++ + A + A    +   
Sbjct: 144 DLVLIRENTEGEY-----SGIEHVVAPGVVQSIKLITQDASERVIRYAFEYA----RAVE 194

Query: 197 KATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPECFD 256
           +  + V HKS +   +DGLF  V     EK    Y ++    +++D+ V    R+P  + 
Sbjct: 195 RPKVLVVHKSTIQRLADGLFVSVA----EKLAKEYPDIELQTELIDNTVLHTVRDPLKYS 250

Query: 257 --VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPDIIIGEPCHGSAPDISGQGISNPV 313
             VVV PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDI+GQ  +NP 
Sbjct: 251 DVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPT 310

Query: 314 ATIRSAALMLQFLGYNEAAKDIQNAVDENIRSG-KIKTPDLGGDSSTTEVTDDILSKL 370
           A + S+ +ML  +G  E A  I+ AV   I SG + +T DL G +ST+   + ++S+L
Sbjct: 311 ALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368

>KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score =  176 bits (447), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 116/350 (33%), Positives = 182/350 (52%), Gaps = 24/350 (6%)

Query: 24  TIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQTFLDTGKALPDETVSIL 83
           T+ L+PGDG+GKE   +   V     +   ID++ +++       LD  + +     S+ 
Sbjct: 28  TVTLLPGDGVGKECTDSVVSVFNA--ENIPIDWEIVNISG-----LDHKEGVAAAVQSLR 80

Query: 84  KQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSGTNDR--PVDMVIV 141
           + +    L G   +      G+ S  VA RKQL +YAN+   KS+ G       VD+V++
Sbjct: 81  RNKI--GLKGLWHTSNADQSGHGSLNVAFRKQLDIYANVAVFKSLKGVKTMIPDVDLVVI 138

Query: 142 RENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKNTGKATLT 201
           RENTE  +   E   ++      V E+ K  +   T +IA+ A + A    +  G+  + 
Sbjct: 139 RENTEGEFSGLEHESVE-----GVVESLKVTTLPKTERIARFAFNYA----QKNGRKAVC 189

Query: 202 VTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPECFDVVVAP 261
             HK+N++   DGLFR     + EK    Y ++  +  IVD+   +   +P  FDV+V P
Sbjct: 190 AVHKANIMKLGDGLFRNTVTSIGEKE---YPDIETSSIIVDNASMQAVAKPHQFDVLVTP 246

Query: 262 NLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEP-CHGSAPDISGQGISNPVATIRSAA 320
           ++YG I+ +  AAL+G  G+V  AN G +  + EP       DI GQ I+NP A + S+A
Sbjct: 247 SMYGTIIGNIGAALIGGPGLVAGANFGREYAVFEPGSRHVGLDIKGQNIANPTAMLLSSA 306

Query: 321 LMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTTEVTDDILSKL 370
           LML  LG  ++ K I +AV E I  G ++T D+GGD++TTE T  ++ KL
Sbjct: 307 LMLNHLGLTKSGKRISDAVREVIAEGDVRTKDIGGDATTTEFTQAVIEKL 356

>CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037c IDH1 or uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2
          Length = 358

 Score =  175 bits (443), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 120/379 (31%), Positives = 197/379 (51%), Gaps = 38/379 (10%)

Query: 6   VYRACARRTVVNGARS---------NLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDF 56
           ++R   RR + + A+            T+ LIPGDG+GKE+  +   + E   +   +D+
Sbjct: 1   MFRTVQRRGMASMAKELVLPKKYGGRYTVTLIPGDGVGKEITDSVVSIFE--AENIPVDW 58

Query: 57  KFIDLHAGWQTFLDTGKALPD--ETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRK 114
           + +D+         T   + D  + V  LK+   G     +   +  +  + S  VALRK
Sbjct: 59  ERVDI--------STSDNIQDVSQAVESLKRNKIG--LKGIWHTSADIADHGSFNVALRK 108

Query: 115 QLGLYANIRPVKSVSGTNDR--PVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRI 172
           QL ++A++   KSV G   +   VD+V++RENTE  Y     + ++  +   V E+ K I
Sbjct: 109 QLDMFAHVAFFKSVPGVKTKIPNVDLVVIRENTEGEY-----SGLEHESVPGVVESLKII 163

Query: 173 SEVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYG 232
           ++  + +IA+ A D A    K   + ++   HK+N++   DGLFR     V E   + Y 
Sbjct: 164 TKAKSERIARFAFDFA----KKYNRKSVCAVHKANIMKMGDGLFRNT---VTEIGANEYP 216

Query: 233 NVSYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDII 292
           ++  +  IVD+   +   +P  FDV+V P++YG I+ +  AAL+G  G+V  A+ G +  
Sbjct: 217 DIQTSSIIVDNASMQAVAKPHQFDVMVTPSMYGTIIGNIGAALIGGPGLVAGAHYGREHA 276

Query: 293 IGEP-CHGSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTP 351
           + EP       DI G+ ++NP A I S+ LMLQ LG  E+AK I  A  + I  G++ T 
Sbjct: 277 VFEPGSQHVGLDIKGKNVANPTAMILSSTLMLQHLGLTESAKRIAKATHDVISLGQVTTK 336

Query: 352 DLGGDSSTTEVTDDILSKL 370
           D+GG +STTE T+ I+ +L
Sbjct: 337 DIGGSASTTEFTEAIIKRL 355

>TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {ON}
           Anc_5.473 YOR136W
          Length = 377

 Score =  174 bits (440), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 120/360 (33%), Positives = 191/360 (53%), Gaps = 28/360 (7%)

Query: 17  NGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQTFLDTGKALP 76
           N    N T+  I GDG+G E+     K + TI     +   +++   G    ++    +P
Sbjct: 39  NPETGNYTVPFIEGDGVGPEI----SKSVRTIFKAAKVPIDWVNCDIG-PLLINGETTIP 93

Query: 77  DETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVS--GTNDR 134
              V  +      AL G + +P    +G+ S  + LRK  GL+AN+RP KS+    +   
Sbjct: 94  QTAVDQINNSLI-ALKGPLATPVG--QGHRSINLTLRKTFGLFANVRPAKSIPNLASTYE 150

Query: 135 PVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKN 194
            VD++++RENTE  Y     + I+      V ++ K I+  A+ K+ K A +      ++
Sbjct: 151 NVDLIVIRENTEGEY-----SGIEHEIVPGVVQSIKLITRKASEKVIKYAFEYT----RS 201

Query: 195 TGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPEC 254
            G++ L V HK+ +  + DGLF +  +++ +K    Y +V+   +++D+ V      PE 
Sbjct: 202 IGRSNLIVVHKATIQRRGDGLFVQTAQEMADK----YPDVNLKLELIDNTVLNCIMNPEK 257

Query: 255 F--DVVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPDIIIGEPCHGSAPDISGQGISN 311
           +   V V PNLYGDILSD  + L  GSLG+ PSAN+G + ++ E  HGSAPDI+GQ  +N
Sbjct: 258 YADSVSVCPNLYGDILSDLNSGLSTGSLGLTPSANIG-ETVLYEAVHGSAPDIAGQDKAN 316

Query: 312 PVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGK-IKTPDLGGDSSTTEVTDDILSKL 370
           P A + S+ +ML  +G  + A  I+ AV   I SGK  +T DLGG ++TT  T  ++  L
Sbjct: 317 PTALLLSSVMMLNHMGLQKYADMIETAVLTTITSGKEFRTADLGGSATTTSFTKAVIENL 376

>ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} similar
           to uniprot|P28834 Saccharomyces cerevisiae YNL037C IDH1
           Subunit of mitochondrial NAD( )-dependent isocitrate
           dehydrogenase which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 361

 Score =  173 bits (439), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 122/350 (34%), Positives = 185/350 (52%), Gaps = 24/350 (6%)

Query: 24  TIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQTFLDTGKALPDETVSIL 83
           T+ LIPGDG+GKEV  +   + +   +   +D+  +D+ +G     D   A     V  L
Sbjct: 30  TVTLIPGDGVGKEVTDSVVSIFK--AENVPVDWDRVDI-SGVDRAEDVKSA-----VESL 81

Query: 84  KQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSGTNDR--PVDMVIV 141
           K+   G L G   +      G+ S  VALRK+L +YAN+   KS+ G   +   VD+V++
Sbjct: 82  KRNRIG-LKGIWHTSPADQAGHGSLNVALRKELDIYANVARFKSIPGVQVKIPDVDLVVI 140

Query: 142 RENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKNTGKATLT 201
           RENTE      E + ++  +   V E+ K +++    +IA+ A D A    K   +  + 
Sbjct: 141 RENTEG-----EFSGLEHESVPGVVESLKIMTQDNIERIARFAFDYA----KKNDRKQVV 191

Query: 202 VTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPECFDVVVAP 261
             HK+N++   DGLF+ + ++V EK    Y  +     IVD+   +    P  FDV+V P
Sbjct: 192 AVHKANIMKMGDGLFKNLVQEVGEKE---YPELQVGNIIVDNASMQTVANPHQFDVLVTP 248

Query: 262 NLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEP-CHGSAPDISGQGISNPVATIRSAA 320
           ++YG IL +  AAL+G  G+V  AN G D+ + EP       DI GQ ++NP A I S+ 
Sbjct: 249 SMYGTILGNIGAALIGGPGLVAGANYGRDVALFEPGSRHVGLDIKGQNVANPTAMILSSV 308

Query: 321 LMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTTEVTDDILSKL 370
           L+L  LG N +A  I  AV   I  GK  T D+GG +STTE T+ +++KL
Sbjct: 309 LLLNHLGLNTSADRISKAVHAVIAEGKSVTRDIGGTASTTEFTEAVINKL 358

>TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.473
           YOR136W
          Length = 371

 Score =  171 bits (434), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 124/360 (34%), Positives = 188/360 (52%), Gaps = 41/360 (11%)

Query: 24  TIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQTFLDTGKALPDETVSIL 83
           T+  I GDG+G E+  + K +           F    +   W++   T   L    V+ +
Sbjct: 40  TVSFIEGDGVGPEISKSVKDI-----------FAAAKVPIVWESCPVT--PLLVNGVTTI 86

Query: 84  KQQCQG-------ALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSG--TNDR 134
            +Q Q        AL G + +P  K  G+ S  + LRK  GL+AN+RP KSV G  T   
Sbjct: 87  PEQAQESINRNLVALKGPLATPIGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYE 144

Query: 135 PVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKN 194
            VD+V++RENTE  Y   E   +       V ++ K I+  A+ ++ + A + A    + 
Sbjct: 145 DVDLVLIRENTEGEYAGIEHVIVP-----GVVQSIKLITREASERVIRYAYEYA----RA 195

Query: 195 TGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPEC 254
            G+  L V HKS +   +DGLF  V +++  +  D    +    +++D+ V  +   P  
Sbjct: 196 VGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPD----IQLQTELIDNTVLNVVSNPSK 251

Query: 255 F-DVV-VAPNLYGDILSDGAAAL-VGSLGVVPSANVGPDIIIGEPCHGSAPDISGQGISN 311
           + DVV V PNLYGDILSD  + L  GSLG+ PS N+G  + I E  HGSAPDI+GQ  +N
Sbjct: 252 YSDVVYVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGQNKAN 311

Query: 312 PVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSG-KIKTPDLGGDSSTTEVTDDILSKL 370
           P A + S+ +ML  +G  E A  I+ AV   I +G + +T DL G +ST+  T+ ++S+L
Sbjct: 312 PTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371

>ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  169 bits (428), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 119/355 (33%), Positives = 190/355 (53%), Gaps = 27/355 (7%)

Query: 22  NLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQTFLDTGKALPDETVS 81
           N  +  I GDGIG E+  + K +      K  +DF+ + +       ++   ++P+E   
Sbjct: 35  NYKVSFIEGDGIGPEISKSVKDIFA--AAKVPVDFESVVVKP---ILVNGVTSIPEEAQK 89

Query: 82  ILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSG--TNDRPVDMV 139
            +      AL G + +P  K  G+ S  + LRK  GL+AN+RP KSV G  T    V++V
Sbjct: 90  SINTNLV-ALKGPLATPVGK--GHRSMNLTLRKTFGLFANLRPAKSVEGFKTIYDNVNLV 146

Query: 140 IVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKNTGKAT 199
           ++RENTE  Y       I+ A    V ++ K I+  A+ ++ + A + A    +   +  
Sbjct: 147 LIRENTEGEY-----AGIEHAIVPGVVQSIKLITREASERVIRFAYEYA----RAAERPR 197

Query: 200 LTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPECFD--V 257
           L V HKS +   SDGLF +V +++  +    + ++    +++D+ V     +P  +   V
Sbjct: 198 LIVVHKSTIQRLSDGLFVDVAKELQSE----FPDIKLETELIDNAVLNTVTDPTKYSDAV 253

Query: 258 VVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPDIIIGEPCHGSAPDISGQGISNPVATI 316
            V PNLYGDILSD  + L  GSLG+ PS N+G  + I E  HGSAPDI+G+  +NP A +
Sbjct: 254 SVCPNLYGDILSDMNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGKDKANPTALL 313

Query: 317 RSAALMLQFLGYNEAAKDIQNAVDENIRSG-KIKTPDLGGDSSTTEVTDDILSKL 370
            S+ +ML  +G +E A  I+ AV   I +G + +T DL G +ST+  T+ ++ KL
Sbjct: 314 LSSVMMLHHMGLHEHASQIEKAVLTTIAAGPESRTGDLKGSASTSSFTEAVIKKL 368

>Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar to
           Ashbya gossypii AAL012C
          Length = 363

 Score =  166 bits (421), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 135/366 (36%), Positives = 200/366 (54%), Gaps = 37/366 (10%)

Query: 27  LIPGDGIGKEVIPAGKKVLETIGD-KYSIDFKFIDLHAGWQTFLDTGKALPDETVSILKQ 85
           ++PGD IG+EVI    KVL  I + + SI+F+F     G      TG  L D+T+   K 
Sbjct: 9   VLPGDYIGQEVIAETIKVLNAIQEARPSINFEFEYHLIGGAAINATGAPLSDKTIEAAKA 68

Query: 86  QCQGALFGAVQSPTTKVEGYSSP---IVALRKQLGLYANIRPV----KSVSGTND-RP-- 135
                L GAV  P     G   P   ++A+RK+LGLYAN+RP     KS+ G +  +P  
Sbjct: 69  -ADAVLLGAVGGPEWD-SGAVRPEQGLLAIRKELGLYANLRPCSFISKSLLGLSPLKPEI 126

Query: 136 ---VDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQRL 192
               D VI+RE    +Y  E +    E  G  VA  +++ +     +I ++   +ALQ  
Sbjct: 127 AQGTDFVILRELVGGIYFGERK----EDDGDGVAWDSEKYTVSEVERITRMGAFLALQ-- 180

Query: 193 KNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREP 252
            +     L    K+NVL+ S  L+R   R V E  K  +  +S   Q++DS    + + P
Sbjct: 181 -HDPPLPLWSFDKANVLASSR-LWR---RTVNETIKREFPQLSVQHQLIDSAAMIMIKNP 235

Query: 253 ECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IIIGEPCHGSAPDIS 305
             F+ +V+  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAPD+ 
Sbjct: 236 RKFNGIVITSNIFGDIISDAASVIPGSLGLLPSASLASEPDKNNAFGLYEPCHGSAPDLE 295

Query: 306 GQGISNPVATIRSAALMLQF-LGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTTEVTD 364
            +G +NP+A I SAA+ML+  L   +  K I+NAV + I SG I+T DLGG+++TTEV D
Sbjct: 296 -KGQANPIACILSAAMMLKLSLNMVDEGKAIENAVKQVIESG-IRTGDLGGNNTTTEVGD 353

Query: 365 DILSKL 370
            +   L
Sbjct: 354 AVTHAL 359

>TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  160 bits (404), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 125/369 (33%), Positives = 198/369 (53%), Gaps = 38/369 (10%)

Query: 24  TIGLIPGDGIGKEVIPAGKKVLETIGDK-YSIDFKFIDLHAGWQTFLDTGKALPDETVSI 82
            I ++PGD +G+E++    KVL+ + +K + + F F     G      TG  LPDET+  
Sbjct: 6   NIVVLPGDHVGQEIVEEAVKVLKIVEEKRHGVKFNFQYHLIGGDAIDKTGDPLPDETLEA 65

Query: 83  LKQQCQGALFGAVQSP---TTKVEGYSSPIVALRKQLGLYANIRPVKSVS----GTND-- 133
            KQ     L GAV  P   T KV      ++ +RK+LGLY N+RP K +S    G +   
Sbjct: 66  AKQ-SDAVLLGAVGGPKWGTGKVRPEQG-LLKIRKELGLYGNLRPCKFISDKLIGLSPLK 123

Query: 134 ----RPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIAL 189
               +  D V+VRE    +Y  E +    E  G+ VA  +++ S    ++I K+A   A 
Sbjct: 124 EEVCKGTDFVVVRELVGGIYFGERQ----EDDGSGVAWDSEKYSIEEVKRITKMA---AF 176

Query: 190 QRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIF 249
             L+N     +    K+NVL+ S  L+R    +   +    + N+    Q++DS    + 
Sbjct: 177 LSLQNDPPLPIWSLDKANVLASSR-LWRAAVDETIAE----FPNLKVQHQLIDSAAMMLV 231

Query: 250 REPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IIIGEPCHGSAP 302
           + P   + +++  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAP
Sbjct: 232 KNPTQLNGIILTNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNKAFGLYEPCHGSAP 291

Query: 303 DISGQGISNPVATIRSAALMLQF-LGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTTE 361
           D++ +G  NPVATI SAA+ML+  L   +  + I+ AV   +  G I+T DLGG+S+T+E
Sbjct: 292 DLA-RGKVNPVATILSAAMMLKLSLDMVQEGEAIERAVSVVLDRG-IRTADLGGNSTTSE 349

Query: 362 VTDDILSKL 370
           + D +  +L
Sbjct: 350 LGDAVAQEL 358

>AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL018W
           (LEU2)
          Length = 372

 Score =  159 bits (402), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 127/364 (34%), Positives = 190/364 (52%), Gaps = 37/364 (10%)

Query: 25  IGLIPGDGIGKEVIPAGKKVLETIGDKYS-IDFKFIDLHAGWQTFLDTGKALPDETVSIL 83
           I ++PGD IG+EV+    KVL  +    S + F F     G      TG ALPDE +   
Sbjct: 7   IVVLPGDHIGREVVEEAVKVLGAVEQSLSDVHFDFQYHLVGGAAIDATGSALPDEALGAA 66

Query: 84  KQQCQGALFGAVQSPTTKVEGYSSP---IVALRKQLGLYANIRPVKSVSGTN-------- 132
           K+     L GAV  P  +  G   P   ++ LR++LG+YAN+RP    + +         
Sbjct: 67  KE-ADAVLLGAVGGPKWQ-GGAVRPEQGLLKLRQELGVYANLRPCNFAADSLLELSPLRP 124

Query: 133 --DRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQ 190
              R  D+++VRE     Y  E      E  G  VA  T + +    ++IA++A  +ALQ
Sbjct: 125 EIARDTDIMVVRELLGGSYFGERH----EDEGDGVAWDTDKYTVKEVQRIARMAGFLALQ 180

Query: 191 RLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFR 250
                   +L    K+NVL+ S  L+R+   + ++     + NV    Q++DS    + +
Sbjct: 181 HDPPLPVWSLD---KANVLASSR-LWRKTVEETFQSE---FPNVQLQHQLIDSAAMILVK 233

Query: 251 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IIIGEPCHGSAPD 303
            P  F+ VVV  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAPD
Sbjct: 234 NPRAFNGVVVTSNMFGDIISDEASVIPGSLGLLPSASLASLPDSKSAFGLYEPCHGSAPD 293

Query: 304 ISGQGISNPVATIRSAALMLQF-LGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTTEV 362
           +   G +NP+  I SAA+ML+  L    A + ++ AV E + SG ++T DL G SST+EV
Sbjct: 294 LPA-GKANPIGCILSAAMMLKLSLNMVAAGEAVEQAVQEVLDSG-VRTGDLLGSSSTSEV 351

Query: 363 TDDI 366
            D I
Sbjct: 352 GDAI 355

>KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 362

 Score =  156 bits (394), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 126/364 (34%), Positives = 188/364 (51%), Gaps = 37/364 (10%)

Query: 25  IGLIPGDGIGKEVIPAGKKVLETIGD-KYSIDFKFIDLHAGWQTFLDTGKALPDETVSIL 83
           I ++PGD +GKEV     KVL  I + +  I F F     G      TG  LPDE +   
Sbjct: 5   IVVLPGDHVGKEVTDEAIKVLNAIAEVRPEIKFNFQHHLIGGAAIDATGTPLPDEALEAS 64

Query: 84  KQQCQGALFGAVQSPTTKVEGYSSP---IVALRKQLGLYANIRPVKSVSGT--------- 131
           K+     L GAV  P     G   P   ++ +RK+LGLYAN+RP    S +         
Sbjct: 65  KK-ADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASDSLLDLSPLKP 122

Query: 132 -NDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQ 190
              +  D V+VRE    +Y  E +    E  G  VA  +++ S    ++I ++A  +ALQ
Sbjct: 123 EYAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFLALQ 178

Query: 191 RLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFR 250
           +        +    K+NVL+ S  L+R   + V E  K  +  ++   Q++DS    + +
Sbjct: 179 Q---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKTEFPQLTVQHQLIDSAAMILVK 231

Query: 251 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IIIGEPCHGSAPD 303
            P   + VV+  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAPD
Sbjct: 232 SPTKLNGVVITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNKAFGLYEPCHGSAPD 291

Query: 304 ISGQGISNPVATIRSAALMLQF-LGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTTEV 362
           +    + NP+ATI SAA+ML+  L   E  + ++ AV  N+    ++T DLGG +STTEV
Sbjct: 292 LPANKV-NPIATILSAAMMLKLSLDLVEEGRALEEAV-RNVLDAGVRTGDLGGSNSTTEV 349

Query: 363 TDDI 366
            D I
Sbjct: 350 GDAI 353

>Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  153 bits (387), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 125/364 (34%), Positives = 193/364 (53%), Gaps = 37/364 (10%)

Query: 25  IGLIPGDGIGKEVIPAGKKVLETIGD-KYSIDFKFIDLHAGWQTFLDTGKALPDETVSIL 83
           I ++PGD +G+E+     KVL+ I D + ++ F F +   G      TG  LPDE +   
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 84  KQQCQGALFGAVQSPTTKVEGYSSP---IVALRKQLGLYANIRPVKSVSGT--NDRPV-- 136
           K+     L GAV  P     G   P   ++ +RK+L LYAN+RP    S +  +  P+  
Sbjct: 67  KK-ADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPIKP 124

Query: 137 ------DMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQ 190
                 D V+VRE    +Y  E +    E  G  VA   ++ +    ++I ++A  +ALQ
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGERK----EDDGDGVAWDCEQYTVPEVQRITRMAAFMALQ 180

Query: 191 RLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFR 250
                   +L    K+NVL+ S  L+R   + V E  K+ +  +    Q++DS    + +
Sbjct: 181 HEPPLPIWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVK 233

Query: 251 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IIIGEPCHGSAPD 303
            P   + +++  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAPD
Sbjct: 234 NPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 293

Query: 304 ISGQGISNPVATIRSAALMLQF-LGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTTEV 362
           +    + NPVATI SAA+ML+  L   E  K I++AV   + +G I+T DLGG +STTEV
Sbjct: 294 LPKNKV-NPVATILSAAMMLKLSLNLPEEGKAIEDAVKRVLDAG-IRTGDLGGSNSTTEV 351

Query: 363 TDDI 366
            D +
Sbjct: 352 GDAV 355

>CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}
          Length = 365

 Score =  152 bits (385), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 126/366 (34%), Positives = 192/366 (52%), Gaps = 38/366 (10%)

Query: 24  TIGLIPGDGIGKEVIPAGKKVLETIGD--KYSIDFKFIDLHAGWQTFLDTGKALPDETVS 81
           TI ++PGD +G+E+     KVL  I +     ++FKF     G      TG  LPDE + 
Sbjct: 6   TIVVLPGDHVGQEITEEAIKVLNAIQECRPDKVNFKFDHHLIGGAAIDATGVPLPDEALE 65

Query: 82  ILKQQCQGALFGAVQSPTTKVEGYSSP---IVALRKQLGLYANIRPVKSVSGTN------ 132
             K+     L GAV  P     G   P   ++ +RK+L LYAN+RP    S +       
Sbjct: 66  ASKK-ADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPL 123

Query: 133 ----DRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIA 188
                R  D V+VRE    +Y  E +    E  G  VA  +++ S    ++I ++A  +A
Sbjct: 124 KPEIARGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFMA 179

Query: 189 LQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRI 248
           LQ   +     +    K+NVL+ S  L+R   + V E  K+ +  ++   Q++DS    +
Sbjct: 180 LQ---HNPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPQLTVQHQLIDSAAMIL 232

Query: 249 FREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IIIGEPCHGSA 301
            + P   + +++  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSA
Sbjct: 233 VKNPTHLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSA 292

Query: 302 PDISGQGISNPVATIRSAALMLQF-LGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTT 360
           PD+  +G  NPVATI SAA+ML+  L   E  + I+ AV + + SG I+T DL G +STT
Sbjct: 293 PDLP-KGKVNPVATILSAAMMLKLSLDLFEEGEIIEQAVKKVLDSG-IRTADLKGTNSTT 350

Query: 361 EVTDDI 366
           EV D +
Sbjct: 351 EVGDAV 356

>YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}
           LEU2Beta-isopropylmalate dehydrogenase (IMDH), catalyzes
           the third step in the leucine biosynthesis pathway
          Length = 364

 Score =  152 bits (385), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 123/364 (33%), Positives = 195/364 (53%), Gaps = 37/364 (10%)

Query: 25  IGLIPGDGIGKEVIPAGKKVLETIGD-KYSIDFKFIDLHAGWQTFLDTGKALPDETVSIL 83
           I ++PGD +G+E+     KVL+ I D + ++ F F +   G      TG  LPDE +   
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 84  KQQCQGALFGAVQSPTTKVEGYSSP---IVALRKQLGLYANIRPVKSVSGT--NDRPV-- 136
           K+     L GAV  P     G   P   ++ +RK+L LYAN+RP    S +  +  P+  
Sbjct: 67  KK-ADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPIKP 124

Query: 137 ------DMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQ 190
                 D V+VRE    +Y  + +    E  G  VA  +++ +    ++I ++A  +ALQ
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRMAAFMALQ 180

Query: 191 RLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFR 250
                   +L    K+NVL+ S  L+R   + V E  K+ +  +    Q++DS    + +
Sbjct: 181 HEPPLPIWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVK 233

Query: 251 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IIIGEPCHGSAPD 303
            P   + +++  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAPD
Sbjct: 234 NPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 293

Query: 304 ISGQGISNPVATIRSAALMLQF-LGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTTEV 362
           +    + NP+ATI SAA+ML+  L   E  K I++AV + + +G I+T DLGG +STTEV
Sbjct: 294 LPKNKV-NPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAG-IRTGDLGGSNSTTEV 351

Query: 363 TDDI 366
            D +
Sbjct: 352 GDAV 355

>NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa]
           {ON} Anc_1.402
          Length = 363

 Score =  151 bits (381), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 126/364 (34%), Positives = 196/364 (53%), Gaps = 37/364 (10%)

Query: 25  IGLIPGDGIGKEVIPAGKKVLETIGD-KYSIDFKFIDLHAGWQTFLDTGKALPDETVSIL 83
           I ++PGD +G+E+     KVL+ I +   SI+F F     G      TG  LPDE +   
Sbjct: 6   IVVLPGDHVGEEITAEAVKVLKAIAEVDNSINFDFQYHLIGGAAIDATGVPLPDEALEAS 65

Query: 84  KQQCQGALFGAVQSPTTKVEGYSSP---IVALRKQLGLYANIRPV----KSVSGTND-RP 135
           K      L GAV  P     G   P   ++ +RK+LGLYAN+RP     +S+ G +  RP
Sbjct: 66  KN-SDAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASESLLGLSPLRP 123

Query: 136 -----VDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQ 190
                 D ++VRE    +Y  + +    E  G  VA  +++ S    ++I ++A  +ALQ
Sbjct: 124 EIAKGTDFMVVRELVGGIYFGKRK----EDEGDGVAWDSEQYSVPEVQRITRMAAFLALQ 179

Query: 191 RLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFR 250
              +     +    K+NVL+ S  L+R   + V E  K+ +  ++   Q++DS    + +
Sbjct: 180 ---HNPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQNQLIDSAAMILVK 232

Query: 251 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IIIGEPCHGSAPD 303
            P   + +++  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAPD
Sbjct: 233 NPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 292

Query: 304 ISGQGISNPVATIRSAALMLQF-LGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTTEV 362
           +  +G  NP+ATI SAA+ML+  L   +    I+ AV + + +G I+T DLGG +STTEV
Sbjct: 293 LP-KGKVNPIATILSAAMMLKLSLNLVKQGDAIEEAVKKVLDAG-IRTGDLGGSNSTTEV 350

Query: 363 TDDI 366
            D I
Sbjct: 351 GDAI 354

>KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 364

 Score =  151 bits (381), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 122/364 (33%), Positives = 192/364 (52%), Gaps = 37/364 (10%)

Query: 25  IGLIPGDGIGKEVIPAGKKVLETIGD-KYSIDFKFIDLHAGWQTFLDTGKALPDETVSIL 83
           I ++PGD +G+E+     KVL+ I + + S+ F+F     G      TG+ LPD ++   
Sbjct: 7   IVVLPGDHVGQEITDEAIKVLKAISEVRSSVKFEFQQHLIGGAAIDATGEPLPDASLEAA 66

Query: 84  KQQCQGALFGAVQSPTTKVEGYSSP---IVALRKQLGLYANIRP----------VKSVSG 130
           K+     L GAV  P     G   P   ++ +RK+L LYAN+RP          +  +  
Sbjct: 67  KK-ADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPLKA 124

Query: 131 TNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQ 190
            + R  D V+VRE    +Y  E +    E  G  VA  +++ S    ++I ++A  +ALQ
Sbjct: 125 EHARGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFLALQ 180

Query: 191 RLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFR 250
                   +L    K+NVL+ S  L+R   + V E  K+ +  ++   Q++DS    + +
Sbjct: 181 HNPPLPVWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMIMVK 233

Query: 251 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IIIGEPCHGSAPD 303
            P   + V++  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAPD
Sbjct: 234 NPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 293

Query: 304 ISGQGISNPVATIRSAALMLQF-LGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTTEV 362
           +  +G  NP+ATI SAA+ML+  L   E    ++ AV   + SG I+T DL G +ST EV
Sbjct: 294 LE-KGKVNPIATILSAAMMLELSLDMFEEGTAVEEAVRRVLDSG-IRTGDLRGSNSTQEV 351

Query: 363 TDDI 366
            D +
Sbjct: 352 GDAV 355

>Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  151 bits (381), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 122/364 (33%), Positives = 195/364 (53%), Gaps = 37/364 (10%)

Query: 25  IGLIPGDGIGKEVIPAGKKVLETIGD-KYSIDFKFIDLHAGWQTFLDTGKALPDETVSIL 83
           I ++PGD +G+E+     KVL+ I + +  ++F F +   G      TG  LPDE +   
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISEVRSDVNFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 84  KQQCQGALFGAVQSPTTKVEGYSSP---IVALRKQLGLYANIRPVKSVSGT--NDRPV-- 136
           K+     L GAV  P     G   P   ++ +RK+L LYAN+RP    S +  +  P+  
Sbjct: 67  KK-ADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPIKP 124

Query: 137 ------DMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQ 190
                 D V+VRE    +Y  + +    E  G  VA  +++ +    ++I ++A  +ALQ
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRMAAFMALQ 180

Query: 191 RLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFR 250
                   +L    K+NVL+ S  L+R   + V E  K+ +  +    Q++DS    + +
Sbjct: 181 HEPPLPIWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVK 233

Query: 251 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IIIGEPCHGSAPD 303
            P   + +++  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAPD
Sbjct: 234 NPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 293

Query: 304 ISGQGISNPVATIRSAALMLQF-LGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTTEV 362
           +    + NP+ATI SAA+ML+  L   E  K I++AV + + +G I+T DLGG +STTEV
Sbjct: 294 LPKNKV-NPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAG-IRTGDLGGSNSTTEV 351

Query: 363 TDDI 366
            D +
Sbjct: 352 GDAV 355

>TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON}
           Anc_1.402 YCL018W
          Length = 362

 Score =  150 bits (379), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 123/365 (33%), Positives = 190/365 (52%), Gaps = 39/365 (10%)

Query: 25  IGLIPGDGIGKEVIPAGKKVLETIGD-KYSIDFKFIDLHAGWQTFLDTGKALPDETVSIL 83
           I ++PGD +G+E+     KVL+ I + + +  F F     G      TG  LPDE +   
Sbjct: 5   IVVLPGDHVGQEITEEAIKVLKAISEVRPNATFNFQHHLIGGAAIDATGVPLPDEALEAS 64

Query: 84  KQQCQGALFGAVQSPTTKVEGYSSP---IVALRKQLGLYANIRPVKSVSGT--------- 131
           K+     L GAV  P     G   P   ++ +RK+L LYAN+RP    S +         
Sbjct: 65  KK-ADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASDSLLELSPLKA 122

Query: 132 -NDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQ 190
              +  D V+VRE    +Y  E +    E  G  VA  +++ S    ++I ++A  +ALQ
Sbjct: 123 QYAQGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEQYSVPEVQRITRMAAFLALQ 178

Query: 191 RLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKN-KDLYGNVSYNEQIVDSMVYRIF 249
              +     +    K+NVL+ S      + R   EK  K+ +  +S N Q++DS    + 
Sbjct: 179 ---HNPPLPIWSLDKANVLASS-----RLWRKTVEKTIKEEFPTLSVNHQLIDSAAMILV 230

Query: 250 REPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IIIGEPCHGSAP 302
           + P   + +++  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAP
Sbjct: 231 KNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAP 290

Query: 303 DISGQGISNPVATIRSAALMLQF-LGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTTE 361
           D++ +G  NPVATI SAA+ML+  L   E    I+ AV + +  G I+T DLGG +ST+E
Sbjct: 291 DLA-KGKVNPVATILSAAMMLKLSLNMVEEGVAIEKAVKKVLDDG-IRTGDLGGSNSTSE 348

Query: 362 VTDDI 366
           V D +
Sbjct: 349 VGDAV 353

>KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.402
           YCL018W
          Length = 365

 Score =  150 bits (378), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 126/360 (35%), Positives = 190/360 (52%), Gaps = 37/360 (10%)

Query: 25  IGLIPGDGIGKEVIPAGKKVLETIGD-KYSIDFKFIDLHAGWQTFLDTGKALPDETVSIL 83
           I + PGD IG E++    KVL+ I +   ++ FK+     G      TG+ L DE + + 
Sbjct: 7   ITVFPGDHIGTEIVRETVKVLDAIAEVSPNVSFKYNYQLIGGAAIDATGEPLTDEALQVA 66

Query: 84  KQQCQGALFGAVQSPTTKVEGYSSP---IVALRKQLGLYANIRPVKSVSGT--NDRPV-- 136
           K      L GAV  P     G   P   ++ +RK+LG+YAN+RP + VS T  +  P+  
Sbjct: 67  KNS-DAILLGAVGGPKWG-HGLVRPEQGLLKIRKELGVYANLRPCQFVSETLLDLSPLKR 124

Query: 137 ------DMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQ 190
                 D VIVRE    +Y  E +    EA    VA   +  S    ++I ++A  +ALQ
Sbjct: 125 EIVQGTDFVIVRELVGGIYFGERQ----EAGDDGVAWDKESYSVPEIQRITRMAAFLALQ 180

Query: 191 RLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFR 250
                   +L    K+NVL+ S  L+R   + V E  K+ +  ++ N  ++DS    + +
Sbjct: 181 HNPPLPVWSL---DKANVLATSR-LWR---KTVEETIKNEFPTLTINHHLIDSAAMTLVQ 233

Query: 251 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IIIGEPCHGSAPD 303
            P   + VV+  N++GDI+SD A+ + GSLG++PSA++   PD    + + EPCHGSAPD
Sbjct: 234 NPTKLNGVVITTNMFGDIISDEASVIPGSLGLLPSASLASLPDKNDALGLYEPCHGSAPD 293

Query: 304 ISGQGISNPVATIRSAALMLQF-LGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTTEV 362
           +     +NP+ATI SAA+M +  L   +    I+ AV   I +G IKT DLGG ++TTEV
Sbjct: 294 LPADH-ANPIATILSAAMMCKLSLNLTKEGNAIEEAVKRTIDAG-IKTGDLGGKNTTTEV 351

>Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C
           (REAL)
          Length = 300

 Score =  146 bits (369), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 105/318 (33%), Positives = 166/318 (52%), Gaps = 35/318 (11%)

Query: 8   RACARRTVVNGAR----------SNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFK 57
           R  A+R++   A+             T+ LIPGDG+GKEV  + K + E   +   ID++
Sbjct: 4   RTIAKRSLATAAQVEHILPKKYGGRFTVTLIPGDGVGKEVTDSVKTIFEA--ENIPIDWE 61

Query: 58  FIDLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLG 117
            I++    QT    G    +E V  L++   G L G   +P  +  G+ S  VALRKQL 
Sbjct: 62  TINIK---QTDHKEGV---NEAVESLRRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLD 113

Query: 118 LYANIRPVKSVSGTNDR--PVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEV 175
           +YAN+   KS+ G   R   +D++++RENTE      E + ++  +   V E+ K +++ 
Sbjct: 114 IYANVALFKSLKGVKTRIPDIDLIVIRENTEG-----EFSGLEHESVPGVVESLKIMTKP 168

Query: 176 ATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVS 235
            T +IA+ A D A    K   +  +T  HK+N++   DGLFR +  ++ +K    Y ++ 
Sbjct: 169 KTERIARFAFDFA----KKYNRKAVTAVHKANIMKLGDGLFRNIITEIGQKE---YPDID 221

Query: 236 YNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGE 295
            +  IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G D  + E
Sbjct: 222 VSSIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFE 281

Query: 296 P-CHGSAPDISGQGISNP 312
           P       DI GQ ++NP
Sbjct: 282 PGSRHVGLDIKGQNVANP 299

>Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W
           (LEU2) - beta-IPM (isopropylmalate) dehydrogenase
           [contig 82] FULL
          Length = 364

 Score =  148 bits (373), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 121/368 (32%), Positives = 195/368 (52%), Gaps = 37/368 (10%)

Query: 25  IGLIPGDGIGKEVIPAGKKVLETIGD-KYSIDFKFIDLHAGWQTFLDTGKALPDETVSIL 83
           I ++PGD +G+E+     KVL+ I + +    F+F     G      TG+ LPD ++   
Sbjct: 7   IVVLPGDHVGQEITEEAVKVLKAISEVRPEKQFEFQYHLIGGAAIDATGEPLPDASLEAA 66

Query: 84  KQQCQGALFGAVQSPTTKVEGYSSP---IVALRKQLGLYANIRPVKSVSGT--------- 131
           K+     L GAV  P     G   P   ++ +RK+L LYAN+RP    S +         
Sbjct: 67  KK-SDAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPLKP 124

Query: 132 -NDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQ 190
              R  D V+VRE    +Y  E +    E TG  VA  +++ S    ++I ++A  +ALQ
Sbjct: 125 ECARGTDFVVVRELVGGIYFGERK----EDTGDGVAWDSEQYSVPEVQRITRMAAFLALQ 180

Query: 191 RLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFR 250
              ++    +    K+NVL+ S  L+R   + V E  K+ +  ++   Q++DS    + +
Sbjct: 181 ---HSPPLPVWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMILVK 233

Query: 251 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IIIGEPCHGSAPD 303
            P   + V++  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAPD
Sbjct: 234 NPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPD 293

Query: 304 ISGQGISNPVATIRSAALMLQF-LGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTTEV 362
           +  +G  NP+ATI SAA+ML+  L   E    ++ AV + + SG ++T DL G S+T+EV
Sbjct: 294 LP-KGKVNPIATILSAAMMLKLSLDMFEEGAAVEEAVRKVLDSG-VRTADLKGTSTTSEV 351

Query: 363 TDDILSKL 370
            + ++  L
Sbjct: 352 GEAVVKAL 359

>KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {ON}
           Anc_1.402 YCL018W
          Length = 447

 Score =  149 bits (376), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 127/370 (34%), Positives = 194/370 (52%), Gaps = 37/370 (10%)

Query: 19  ARSNLTIGLIPGDGIGKEVIPAGKKVLETIGD-KYSIDFKFIDLHAGWQTFLDTGKALPD 77
           A++   I ++PGD +G+E+     KVL  I   + +++F F     G      TG  LPD
Sbjct: 84  AQTTKHIVVLPGDHVGQEITEEAIKVLNAISSVRPNVNFDFQHHLIGGAAIDATGVPLPD 143

Query: 78  ETVSILKQQCQGALFGAVQSPTTKVEGYSSP---IVALRKQLGLYANIRPVKSVSGT--N 132
           E +   K+     L GAV  P     G   P   ++ +RK+L LYAN+RP    S +  +
Sbjct: 144 EALEASKK-ADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLD 201

Query: 133 DRPV--------DMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIA 184
             P+        D+ IVRE    +Y  E +   DE  G         +SEV  ++I ++A
Sbjct: 202 LSPLKPEIVKGTDICIVRELVGGIYFGERKE--DEGDGVAWDSEKYSVSEV--QRITRMA 257

Query: 185 LDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSM 244
             +ALQ        +L    K+NVL+ S  L+R   + V E  K+ +  ++   Q++DS 
Sbjct: 258 GFLALQHNPPLPVWSLD---KANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSA 310

Query: 245 VYRIFREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IIIGEPC 297
              + + P   + VV+A N++GDI+SD A+ + GSLG++PSA++   PD      + EPC
Sbjct: 311 AMILVKNPTHLNGVVIANNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPC 370

Query: 298 HGSAPDISGQGISNPVATIRSAALMLQF-LGYNEAAKDIQNAVDENIRSGKIKTPDLGGD 356
           HGSAPD+  +G  NPVATI S A+ML+  L   E    ++ AV + + SG ++T DL G 
Sbjct: 371 HGSAPDLP-KGKVNPVATILSVAMMLKLSLNMTEEGIAVEKAVKQVLDSG-VRTADLRGS 428

Query: 357 SSTTEVTDDI 366
           +ST+EV D I
Sbjct: 429 NSTSEVGDAI 438

>Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON}
           (182096..183190) [1095 nt, 365 aa]
          Length = 364

 Score =  144 bits (364), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 122/369 (33%), Positives = 191/369 (51%), Gaps = 38/369 (10%)

Query: 21  SNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYS--IDFKFIDLHAGWQTFLDTGKALPDE 78
           S   I ++PGD +G+E++    KVLE +    S  I F+F     G  +   TG  LPDE
Sbjct: 2   STKKIVVLPGDHVGEEIVDEAIKVLEAVASSSSKGIKFEFQRHLIGGASIDATGTPLPDE 61

Query: 79  TVSILKQQCQGALFGAVQSPTTKVEGYSSP---IVALRKQLGLYANIRPVKSVSGTN--- 132
            +   K      L GAV  P     G   P   ++ +RK+L LYAN+RP   VS +    
Sbjct: 62  ALDAAKN-SDAVLLGAVGGPKWGT-GDVRPEQGLLKIRKELQLYANLRPCNFVSDSLLGL 119

Query: 133 -------DRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIAL 185
                   +  D  +VRE    +Y  + +   D+  G+        I EV  ++I ++A 
Sbjct: 120 SPLKEEIAKGTDFTVVRELVGGIYFGDRKE--DDGDGSAWDCEKYTIPEV--QRITRMAA 175

Query: 186 DIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMV 245
            +ALQ   +     +    K+NVL+ S  L+R   + V E  K+ + N+    Q++DS  
Sbjct: 176 FLALQ---HDPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPNLKVQHQLIDSAA 228

Query: 246 YRIFREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IIIGEPCH 298
             + + P   + +++  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCH
Sbjct: 229 MILVKSPRQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCH 288

Query: 299 GSAPDISGQGISNPVATIRSAALMLQF-LGYNEAAKDIQNAVDENIRSGKIKTPDLGGDS 357
           GSAPD+  +G  NP+ATI SAA+ML+  L   +    I+ AV + + +G I+T DL G +
Sbjct: 289 GSAPDLP-KGKVNPIATILSAAMMLKLSLNLVDEGIAIEQAVKQVLDAG-IRTADLKGSN 346

Query: 358 STTEVTDDI 366
           ST+EV D +
Sbjct: 347 STSEVGDAV 355

>ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON}
           uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2 3-
           isopropylmalate dehydrogenase
          Length = 362

 Score =  142 bits (359), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 120/364 (32%), Positives = 192/364 (52%), Gaps = 37/364 (10%)

Query: 25  IGLIPGDGIGKEVIPAGKKVLETIGD-KYSIDFKFIDLHAGWQTFLDTGKALPDETVSIL 83
           I ++PGD  G+E+     KVLE I +      F F     G      TG  LPD+ ++  
Sbjct: 5   IVVLPGDHAGQEIAQEAIKVLEAISEVSPEAKFNFQHHLIGGAAIDATGSPLPDDALAAA 64

Query: 84  KQQCQGALFGAVQSPTTKVEGYSSP---IVALRKQLGLYANIRPVKSVSGT--------- 131
           K+     L GAV  P     G   P   ++ +RK+L LYAN+RP    S +         
Sbjct: 65  KKADA-VLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPLKP 122

Query: 132 -NDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQ 190
            + +  D V+VRE    +Y  E +    E  G  VA  +++ ++   +++ ++A  +ALQ
Sbjct: 123 QHAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYTKPEVQRLTRMAAFLALQ 178

Query: 191 RLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFR 250
              +     +    K+NVL+ S  L+R   + V E  K+ +  +  N Q++DS    + +
Sbjct: 179 ---HNPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPQLKLNHQLIDSAAMILVK 231

Query: 251 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IIIGEPCHGSAPD 303
            P   + +V+  NL+GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAPD
Sbjct: 232 SPTQLNGIVLTSNLFGDIISDEASVIPGSLGLLPSASLASLPDTNEAFGLYEPCHGSAPD 291

Query: 304 ISGQGISNPVATIRSAALMLQF-LGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTTEV 362
           +  +G  NP+A I SAA+ML+  L  ++  + ++ AV + + SG ++T DLGG +ST+EV
Sbjct: 292 LP-KGKVNPIAMILSAAMMLKLSLNLSKEGEAVEKAVKQVLDSG-VRTGDLGGSNSTSEV 349

Query: 363 TDDI 366
            D I
Sbjct: 350 GDAI 353

>Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  140 bits (354), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 118/364 (32%), Positives = 189/364 (51%), Gaps = 37/364 (10%)

Query: 25  IGLIPGDGIGKEVIPAGKKVLETIGD-KYSIDFKFIDLHAGWQTFLDTGKALPDETVSIL 83
           I ++PGD +G+E+     KVL+ I + + ++ F F     G      TG  L DE +   
Sbjct: 7   IVVLPGDHVGQEITEEAIKVLKAISEVRPNVKFDFEYHLIGGAAIDATGVPLTDEALEAS 66

Query: 84  KQQCQGALFGAVQSPTTKVEGYSSP---IVALRKQLGLYANIRPVKSVSGT--------- 131
           K+     L GAV  P     G   P   ++ +RK+L LYAN+RP    S +         
Sbjct: 67  KK-ADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLELSPIKP 124

Query: 132 -NDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQ 190
              R  D V+VRE    +Y  + +    E  G  VA  +++ +    ++I ++A  +ALQ
Sbjct: 125 QFARGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRMAAFMALQ 180

Query: 191 RLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFR 250
                   +L    K+NVL+ S  L+R   + V E  K+ +  +    Q++DS    + +
Sbjct: 181 HQPPLPIWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVK 233

Query: 251 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IIIGEPCHGSAPD 303
            P   + +++  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAPD
Sbjct: 234 NPTQLNGIIITSNMFGDIISDEASCIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 293

Query: 304 ISGQGISNPVATIRSAALMLQF-LGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTTEV 362
           +    + NP+ATI SAA+ML+  L      + I++AV + + +G I+T DLGG +ST EV
Sbjct: 294 LPKNKV-NPIATILSAAMMLKLSLNMTAEGQAIEDAVKKVLDAG-IRTGDLGGSNSTIEV 351

Query: 363 TDDI 366
            D +
Sbjct: 352 GDAV 355

>SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {ON}
           highly similar to uniprot|P04173 Saccharomyces
           cerevisiae YCL018W LEU2 Beta-isopropylmalate
           dehydrogenase catalyzes the third step in the leucine
           biosynthesis pathway
          Length = 364

 Score =  139 bits (349), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 117/365 (32%), Positives = 190/365 (52%), Gaps = 37/365 (10%)

Query: 25  IGLIPGDGIGKEVIPAGKKVLETIGD-KYSIDFKFIDLHAGWQTFLDTGKALPDETVSIL 83
           I ++PGD +G+E+     +VL+ I + +  + F +     G      TG  LPDE +   
Sbjct: 7   IVVLPGDHVGQEITAEAIRVLDAISEVRPDVKFDYQYHLIGGAAIDATGVPLPDEALDAA 66

Query: 84  KQQCQGALFGAVQSPTTKVEGYSSP---IVALRKQLGLYANIRPVKSVSGT--------- 131
           K+     L GAV  P     G   P   ++ +RK+L LYAN+RP    S +         
Sbjct: 67  KKADA-VLLGAVGGPKWGT-GQVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPLKP 124

Query: 132 -NDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQ 190
              +  D V+VRE    +Y  E +    E  G  VA  +++ S    ++I ++A  +ALQ
Sbjct: 125 EYAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFLALQ 180

Query: 191 RLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFR 250
           +        +    K+NVL+ S  L+R   + V E  K+ +  ++   Q++DS    + +
Sbjct: 181 Q---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMILVK 233

Query: 251 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IIIGEPCHGSAPD 303
            P   + +V+  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAPD
Sbjct: 234 SPTKLNGIVITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPD 293

Query: 304 ISGQGISNPVATIRSAALMLQF-LGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTTEV 362
           +    + NP+ATI SAA+ML+  L   E    ++ AV   + +G I+T DL G++ST+EV
Sbjct: 294 LPKNKV-NPIATILSAAMMLKLSLNLVEEGNAVEEAVRRVLDAG-IRTADLRGENSTSEV 351

Query: 363 TDDIL 367
            D ++
Sbjct: 352 GDAVV 356

>NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {ON}
           Anc_1.402
          Length = 365

 Score =  136 bits (342), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 120/368 (32%), Positives = 188/368 (51%), Gaps = 44/368 (11%)

Query: 25  IGLIPGDGIGKEVIPAGKKVLETI----GDKYSIDFKFIDLHAGWQTFLDT-GKALPDET 79
           I ++PGD +G E+     KVL+ I      K   DF++   H      +D  G  L DE 
Sbjct: 7   IVVLPGDHVGGEITEEAIKVLKAIEQVESSKVKFDFQY---HLIGGAAIDAAGVPLTDEA 63

Query: 80  VSILKQQCQGALFGAVQSPTTKVEGYSSP---IVALRKQLGLYANIRPVKSVSG-----T 131
           +   K+     L GAV  P     G   P   ++ +RK+LGLYAN+RP    S      +
Sbjct: 64  LEASKK-ADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASEPLLGLS 121

Query: 132 NDRP-----VDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALD 186
             RP      D ++VRE    +Y  E +    E  G  VA  +++ S     +I ++A  
Sbjct: 122 PLRPEIAKGTDFMVVRELVGGIYFGERK----EDDGDGVAWDSEKYSVPEVERITRMAAF 177

Query: 187 IALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVY 246
           +ALQ   +     +    K+NVL+ S  L+R   + V    K+ +  ++   Q++DS   
Sbjct: 178 LALQ---HNPPLPIWSLDKANVLASSR-LWR---KTVEATIKNEFPTLTVQNQLIDSAAM 230

Query: 247 RIFREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IIIGEPCHG 299
            + + P   + +++  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHG
Sbjct: 231 ILVKNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHG 290

Query: 300 SAPDISGQGISNPVATIRSAALMLQF-LGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSS 358
           SAPD+    + NPVATI SAA+ML+  L   +  + ++ AV   + +G ++T DLGG +S
Sbjct: 291 SAPDLPKNKV-NPVATILSAAMMLKLSLNMVKEGEAVEEAVRRVLDAG-VRTGDLGGSNS 348

Query: 359 TTEVTDDI 366
           T EV D I
Sbjct: 349 TQEVGDAI 356

>TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  116 bits (291), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 108/367 (29%), Positives = 181/367 (49%), Gaps = 42/367 (11%)

Query: 25  IGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKF-IDLHAGWQTFLD-TGKALPDETVSI 82
           I ++PGD +G EV     K+L+ I +  +   KF  + H      +D TG  LPDE++  
Sbjct: 7   IVVLPGDHVGGEVTEEAVKILKAIEEVRNNKVKFNFEYHLIGGAAIDATGNPLPDESLEA 66

Query: 83  LKQQCQGALFGAVQSPTTKVEGYSSP---IVALRKQLGLYANIRPVKSVSGT-------- 131
            K+     L GAV  P     G   P   ++ +RK+L LYAN+RP    S +        
Sbjct: 67  SKR-ADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPLK 124

Query: 132 --NDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIAL 189
               +  D  +VRE    +Y  + +    E  G  VA  +++ S    ++I ++A  +A+
Sbjct: 125 EKYAKGTDFTVVRELVGGIYFGKRK----EDDGDGVAWDSEQYSVPEVQRITRMAAFLAM 180

Query: 190 QRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIF 249
           Q   +     +    K+NVL+ S  L+R   + V E  ++ + ++  + Q++DS    + 
Sbjct: 181 Q---HNPPLPIWSLDKANVLASSR-LWR---KTVEETIQNEFPSLKVSHQLIDSAAMILV 233

Query: 250 REPECFD-VVVAPNLYGDILSDGAAALVG--------SLGVVPSANVGPDIIIGEPCHGS 300
           + P   + +++  N++GDI+SD A+ + G        SL  +P  N      + EPCHGS
Sbjct: 234 KNPTQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLSSLPDTNSA--FGLYEPCHGS 291

Query: 301 APDISGQGISNPVATIRSAALMLQF-LGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSST 359
           APD+  +G  NP+ TI S A+ML+  L   E    ++ AV   +    I+T DLGG +ST
Sbjct: 292 APDLP-KGKVNPIGTILSVAMMLKLSLNLKEEGIAVEEAV-RRVLDNNIRTADLGGSNST 349

Query: 360 TEVTDDI 366
           +++ D +
Sbjct: 350 SDIGDAV 356

>CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066w IDP1 isocitrate dehydrogenase or uniprot|P41939
           Saccharomyces cerevisiae YLR174w IDP2 or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3
          Length = 423

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 67/128 (52%), Gaps = 11/128 (8%)

Query: 178 RKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYE---KNKDLYGNV 234
           R  A  +  +ALQ+     K  L ++ K+ +L + DG F+++ ++VY+   K K    N+
Sbjct: 202 RGFAHSSFKLALQK-----KLNLFLSTKNTILKKYDGRFKDIFQEVYDSEYKQKFAELNI 256

Query: 235 SYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--II 292
           +Y  +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  + PD    
Sbjct: 257 TYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILITPDGKTF 315

Query: 293 IGEPCHGS 300
             E  HG+
Sbjct: 316 ESEAAHGT 323

>KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {ON}
           Anc_1.396 YLR174W
          Length = 421

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 69/133 (51%), Gaps = 15/133 (11%)

Query: 177 TRK----IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYG 232
           TRK     A+ + ++AL+R     K  L  T K+ VL + DG F+++ +++YE +  +  
Sbjct: 188 TRKSIKGFARASFEMALKR-----KMPLFFTTKNTVLKRYDGKFKDIFQEMYESDYKVQF 242

Query: 233 N---VSYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP 289
           +   + Y  +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  V P
Sbjct: 243 DEIGILYEHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSMLVAP 301

Query: 290 D--IIIGEPCHGS 300
           D      E  HG+
Sbjct: 302 DGKTFESEAAHGT 314

>TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {ON}
           Anc_1.396 YLR174W
          Length = 418

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKN-KDLYG--NVSY 236
            AK + + AL+R     K  L  T K+ +L Q DG F+++  ++Y K  +D +   N+ Y
Sbjct: 198 FAKASFEFALER-----KIPLYSTTKNTILKQYDGKFKDIFEEMYAKEYEDKFKVLNIWY 252

Query: 237 NEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IIIG 294
             +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  + PD      
Sbjct: 253 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDVVAQGFGSLGLMTSVLLTPDGSSFES 311

Query: 295 EPCHGS 300
           E  HG+
Sbjct: 312 EAAHGT 317

>CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174w IDP2 isocitrate dehydrogenase or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3 or uniprot|P21954
           Saccharomyces cerevisiae YDL066w IDP1
          Length = 418

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 68/128 (53%), Gaps = 15/128 (11%)

Query: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYE-----KNKDLYGNV 234
            A+ + ++A++R     K  L  T K+ +L + DG F+++ + +Y+     K K+L   +
Sbjct: 193 FARASFELAIKR-----KLPLFFTTKNTILKKYDGRFKDIFQKMYDEDYKGKFKEL--GI 245

Query: 235 SYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--II 292
           SY  +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  + PD  I 
Sbjct: 246 SYEHRLIDDMVAQMIKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSTLLTPDGKIF 304

Query: 293 IGEPCHGS 300
             E  HG+
Sbjct: 305 ESEAAHGT 312

>Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii AAL022W
          Length = 415

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 63/126 (50%), Gaps = 11/126 (8%)

Query: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYE---KNKDLYGNVSY 236
            AK + ++AL+R     K  L  T K+ +L + DG F+++   +YE   K K     + Y
Sbjct: 194 FAKSSFELALER-----KMPLYSTTKNTILKKYDGQFKDIFEGMYEREYKQKFEAVGIWY 248

Query: 237 NEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IIIG 294
             +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  V PD      
Sbjct: 249 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVSPDGKTFES 307

Query: 295 EPCHGS 300
           E  HG+
Sbjct: 308 EAAHGT 313

>AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR174W (IDP2) and
           YNL009W (IDP3)
          Length = 415

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 62/126 (49%), Gaps = 11/126 (8%)

Query: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYE---KNKDLYGNVSY 236
            AK + ++ALQR     K  L  T K+ +L + DG F+++   +Y    K K     + Y
Sbjct: 194 FAKSSFELALQR-----KMPLYSTTKNTILKKYDGKFKDIFEGMYAAEYKEKFEAAGIWY 248

Query: 237 NEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IIIG 294
             +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  V PD      
Sbjct: 249 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVSPDGKTFES 307

Query: 295 EPCHGS 300
           E  HG+
Sbjct: 308 EAAHGT 313

>Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C
           (REAL)
          Length = 53

 Score = 51.2 bits (121), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%)

Query: 321 LMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTTEVTDDILSKL 370
           LML  LG NE+A  I  AV E I  GK  T D+GG SSTT+ T++I++KL
Sbjct: 1   LMLNHLGLNESATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEIINKL 50

>NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa]
           {ON} Anc_1.396
          Length = 413

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 65/132 (49%), Gaps = 15/132 (11%)

Query: 176 ATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKN-----KDL 230
           A    A+ +  +AL+R     +  L  T K+ +L + DG F+ V  D+YE+      +DL
Sbjct: 190 AIEGFARSSFQLALER-----QLPLYSTTKNTILKKYDGKFKSVFEDMYEREYKQQFEDL 244

Query: 231 YGNVSYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD 290
              + Y  +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  V PD
Sbjct: 245 --GIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVAPD 301

Query: 291 --IIIGEPCHGS 300
                 E  HG+
Sbjct: 302 GKTFESEAAHGT 313

>Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W
           (IDP1) - Mitochondrial form of NADP-specific isocitrate
           dehydrogenase [contig 1] FULL
          Length = 422

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 85/195 (43%), Gaps = 24/195 (12%)

Query: 178 RKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGN---V 234
           R  A  +  +AL +  N     L ++ K+ +L Q DG F+++ ++VY +          +
Sbjct: 200 RGFAHASFKLALSKRLN-----LFMSTKNTILKQYDGRFKDIFQEVYAQEYQTQFRDEGI 254

Query: 235 SYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--II 292
           SY  +++D MV ++ +    F V+   N  GD+LSD  A   GSLG++ S  V PD    
Sbjct: 255 SYEHRLIDDMVAQMIKSRGGF-VMALKNYDGDVLSDIVAQGFGSLGLMTSMLVTPDGKTF 313

Query: 293 IGEPCHGSAPDI---SGQGISNPVATIRSAALMLQFLGYN----------EAAKDIQNAV 339
             E  HG+         QG      +I S     + LG            E A+ ++ A 
Sbjct: 314 ESEAAHGTVTRHFRQHQQGKETSTNSIASIFAWSRGLGKRGELDGTPDVVEFARKLEAAT 373

Query: 340 DENIRSGKIKTPDLG 354
            E ++   I T DL 
Sbjct: 374 IETVQQHGIMTKDLA 388

>KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 413

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 63/128 (49%), Gaps = 11/128 (8%)

Query: 178 RKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYE---KNKDLYGNV 234
           R  A+ + ++ALQR     K  L  T K+ +L + DG F++    +YE   + +     +
Sbjct: 192 RGFARASFELALQR-----KMPLYSTTKNTILKRYDGRFKDEFEAMYEAEYRERFERAGI 246

Query: 235 SYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--II 292
            Y  +++D MV ++ +    F V+   N  GD+ SD  A   GSLG++ S  V PD    
Sbjct: 247 WYEHRLIDDMVAQMLKSAGGF-VIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGRAF 305

Query: 293 IGEPCHGS 300
             E  HG+
Sbjct: 306 ESEAAHGT 313

>TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.254
           YDL066W
          Length = 423

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 72/144 (50%), Gaps = 12/144 (8%)

Query: 162 GTKVAEATKRISEVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCR 221
           G  VA A     E + R  A  +  +AL +     K  L ++ K+ +L + DG F+++ +
Sbjct: 187 GAGVALAMYNTDE-SIRGFAHASFKLALNK-----KLNLFLSTKNTILKKYDGRFKDIFQ 240

Query: 222 DVYE---KNKDLYGNVSYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGS 278
           ++++   K +    N+SY  +++D MV ++ +    F ++   N  GD+ SD  A   GS
Sbjct: 241 EIFDAEYKTQFEAANISYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 299

Query: 279 LGVVPSANVGPD--IIIGEPCHGS 300
           LG++ S  V PD      E  HG+
Sbjct: 300 LGLMTSVLVTPDGKTFESEAAHGT 323

>Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON}
           (207889..209172) [1284 nt, 428 aa]
          Length = 427

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 67/128 (52%), Gaps = 11/128 (8%)

Query: 178 RKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKN-KDLYGN--V 234
           R  A  +  +A+ +     K  L ++ K+ +L + DG F+++ +++YE + K  + N  +
Sbjct: 201 RGFAHSSFKLAINK-----KLNLFLSTKNTILKKYDGRFKDIFQEIYESDYKSQFENLGI 255

Query: 235 SYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--II 292
           SY  +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  V PD    
Sbjct: 256 SYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTF 314

Query: 293 IGEPCHGS 300
             E  HG+
Sbjct: 315 ESEAAHGT 322

>KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.396
           YLR174W
          Length = 424

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 65/129 (50%), Gaps = 17/129 (13%)

Query: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGN------ 233
            AK + ++AL+R     K  L    K+ +L + DGLF+++   +Y   KD Y        
Sbjct: 195 FAKSSFELALKR-----KLPLFFATKNTILKEYDGLFKDIFEKLY---KDHYKTKFEELG 246

Query: 234 VSYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--I 291
           +++  +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  V PD  +
Sbjct: 247 ITFEHRLIDDMVAQMLKSNGGF-ILSLKNYDGDVQSDIVAQGFGSLGLMTSMLVTPDDSV 305

Query: 292 IIGEPCHGS 300
              E  HG+
Sbjct: 306 FESEAAHGT 314

>NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {ON}
           Anc_4.254
          Length = 426

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 74/144 (51%), Gaps = 12/144 (8%)

Query: 162 GTKVAEATKRISEVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCR 221
           G+ VA A     E + R  A  +  +AL     T K  L ++ K+ +L + DG F+++ +
Sbjct: 190 GSGVALAMYNTDE-SIRGFAHSSFKLAL-----TKKLNLFLSTKNTILKKYDGRFKDIFQ 243

Query: 222 DVYE-KNKDLYGN--VSYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGS 278
           ++++ + K  + N  +SY  +++D MV ++ +    F ++   N  GD+ SD  A   GS
Sbjct: 244 EIFDMEYKTKFANLGISYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 302

Query: 279 LGVVPSANVGPD--IIIGEPCHGS 300
           LG++ S  V PD      E  HG+
Sbjct: 303 LGLMTSILVTPDGKTFESEAAHGT 326

>NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON}
           Anc_4.254
          Length = 424

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 58/109 (53%), Gaps = 6/109 (5%)

Query: 197 KATLTVTHKSNVLSQSDGLFREVCRDVYE---KNKDLYGNVSYNEQIVDSMVYRIFREPE 253
           K  L ++ K+ +L + DG F+++ + +YE   K K    N++Y  +++D MV ++ +   
Sbjct: 221 KLNLFLSTKNTILKKYDGRFKDIFQSIYETHYKAKFQQLNINYEHRLIDDMVAQMIKSKG 280

Query: 254 CFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IIIGEPCHGS 300
            F ++   N  GD+ SD  A   GSLG++ S  V PD      E  HG+
Sbjct: 281 GF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {ON}
           Anc_1.396 YLR174W
          Length = 412

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 63/126 (50%), Gaps = 11/126 (8%)

Query: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYE---KNKDLYGNVSY 236
            AK +  +A++R     K  L  T K+ +L + DG+F+++   +YE   K K     + Y
Sbjct: 195 FAKASFQLAVER-----KMPLYSTTKNTILKKYDGMFKDIFEGMYEREYKEKFEELGIWY 249

Query: 237 NEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IIIG 294
             +++D MV ++ +    + ++   N  GD+ SD  A   GSLG++ S  + PD      
Sbjct: 250 EHRLIDDMVAQMLKSSGGY-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFES 308

Query: 295 EPCHGS 300
           E  HG+
Sbjct: 309 EAAHGT 314

>ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174W IDP2 Cytosolic NADP-specific
           isocitrate dehydrogenase catalyzes oxidation of
           isocitrate to alpha- ketoglutarate levels are elevated
           during growth on non- fermentable carbon sources and
           reduced during growth on glucose
          Length = 411

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKN-KDLYGN--VSY 236
            AK + ++AL+R     K  L  T K+ +L + DG F+++   +YEK  +  +    + Y
Sbjct: 193 FAKASFELALER-----KQPLYSTTKNTILKKYDGKFKDIFEAMYEKEYRSQFEKLGIWY 247

Query: 237 NEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IIIG 294
             +++D MV ++ +    + ++   N  GD+ SD  A   GSLG++ S  V PD      
Sbjct: 248 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFES 306

Query: 295 EPCHGS 300
           E  HG+
Sbjct: 307 EAAHGT 312

>SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 421

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 67/133 (50%), Gaps = 11/133 (8%)

Query: 173 SEVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYE---KNKD 229
           +E + R  A  +  +AL     T K  L ++ K+ +L + DG F+++ +++Y+   K + 
Sbjct: 195 TEESIRGFAHASFKLAL-----TKKLNLYLSTKNTILKKYDGRFKDIFQELYDAEYKKQF 249

Query: 230 LYGNVSYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP 289
               + Y  +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  V P
Sbjct: 250 EAAGIYYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTP 308

Query: 290 D--IIIGEPCHGS 300
           D      E  HG+
Sbjct: 309 DGKTFESEAAHGT 321

>YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}
           IDP3Peroxisomal NADP-dependent isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to alpha-ketoglutarate
           with the formation of NADP(H+), required for growth on
           unsaturated fatty acids
          Length = 420

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKN-KDLYG--NVSY 236
            AK + ++AL+R     K  L  T K+ +L   D  F+++  ++++K  K+ +    ++Y
Sbjct: 192 FAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDNLFDKEYKEKFQALKITY 246

Query: 237 NEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IIIG 294
             +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  + PD      
Sbjct: 247 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILITPDGKTFES 305

Query: 295 EPCHGS 300
           E  HG+
Sbjct: 306 EAAHGT 311

>TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa]
           {ON} Anc_1.396 YLR174W
          Length = 414

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 63/129 (48%), Gaps = 17/129 (13%)

Query: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGN------ 233
            AK + ++AL+R     K  L  T K+ +L + DG F++V   +Y    D Y +      
Sbjct: 191 FAKASFELALER-----KLPLYSTTKNTILKKYDGKFKDVFEQMY---ADQYQSRFEELG 242

Query: 234 VSYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--I 291
           + Y  +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  V PD   
Sbjct: 243 IWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLVTPDGKT 301

Query: 292 IIGEPCHGS 300
              E  HG+
Sbjct: 302 FESEAAHGT 310

>KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.396
           YLR174W
          Length = 408

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 63/126 (50%), Gaps = 11/126 (8%)

Query: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKN-KDLYGN--VSY 236
            A+ +  +A++R     K  L  T K+ +L Q DG F+++ + VYE   K+ +    + Y
Sbjct: 190 FARASFTMAIER-----KLPLYSTTKNTILKQYDGQFKDIFKTVYENEYKETFEELGIWY 244

Query: 237 NEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IIIG 294
             +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  +  D      
Sbjct: 245 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSTLIAADGKTFES 303

Query: 295 EPCHGS 300
           E  HG+
Sbjct: 304 EAAHGT 309

>NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396
          Length = 419

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 63/126 (50%), Gaps = 11/126 (8%)

Query: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYE---KNKDLYGNVSY 236
            AK +  +AL+R     K  L +  K+ +L + DG F+ +  D+Y+   K K     ++Y
Sbjct: 195 FAKASFIMALKR-----KLPLFLATKNTILKKYDGRFKSIFDDMYQNEFKEKFEKLGLTY 249

Query: 237 NEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IIIG 294
             +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  + PD      
Sbjct: 250 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSQLITPDGKTFQS 308

Query: 295 EPCHGS 300
           E  HG+
Sbjct: 309 EAAHGT 314

>YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}
           IDP1Mitochondrial NADP-specific isocitrate
           dehydrogenase, catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate; not required for mitochondrial
           respiration and may function to divert
           alpha-ketoglutarate to biosynthetic processes
          Length = 428

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 58/109 (53%), Gaps = 6/109 (5%)

Query: 197 KATLTVTHKSNVLSQSDGLFREVCRDVYE---KNKDLYGNVSYNEQIVDSMVYRIFREPE 253
           K  L ++ K+ +L + DG F+++ ++VYE   K+K     + Y  +++D MV ++ +   
Sbjct: 221 KLNLFLSTKNTILKKYDGRFKDIFQEVYEAQYKSKFEQLGIHYEHRLIDDMVAQMIKSKG 280

Query: 254 CFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IIIGEPCHGS 300
            F ++   N  GD+ SD  A   GSLG++ S  V PD      E  HG+
Sbjct: 281 GF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.396
           YLR174W
          Length = 422

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 63/128 (49%), Gaps = 15/128 (11%)

Query: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVY-----EKNKDLYGNV 234
            A+ + + AL+R     K  L  T K+ +L + DG F+++   +Y     EK K L  N+
Sbjct: 203 FARSSFEFALER-----KLPLYSTTKNTILKKYDGQFKDIFESMYKEEYEEKFKAL--NI 255

Query: 235 SYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--II 292
            Y  +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  +  D    
Sbjct: 256 WYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISDDGKTF 314

Query: 293 IGEPCHGS 300
             E  HG+
Sbjct: 315 ESEAAHGT 322

>Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 58/109 (53%), Gaps = 6/109 (5%)

Query: 197 KATLTVTHKSNVLSQSDGLFREVCRDVYE---KNKDLYGNVSYNEQIVDSMVYRIFREPE 253
           K  L ++ K+ +L + DG F+++ ++VYE   K+K     + Y  +++D MV ++ +   
Sbjct: 222 KLNLFLSTKNTILKKYDGRFKDIFQEVYEAEYKSKFEKLGIHYEHRLIDDMVAQMIKSKG 281

Query: 254 CFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IIIGEPCHGS 300
            F ++   N  GD+ SD  A   GSLG++ S  V PD      E  HG+
Sbjct: 282 GF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 329

>KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 420

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 74/150 (49%), Gaps = 12/150 (8%)

Query: 156 YIDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGL 215
           ++ +  G  VA A     E + R  A  +  +AL +  N   AT     K+ +L Q DG 
Sbjct: 178 HVHDFEGAGVALAMYNTDE-SIRGFAHASFRLALSKQLNLFLAT-----KNTILKQYDGR 231

Query: 216 FREVCRDVYE-KNKDLY--GNVSYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGA 272
           F+++ + +Y+ + ++ +    +SY  +++D MV ++ +    F V+   N  GD+ SD  
Sbjct: 232 FKDLFQQLYDAEYREAFERAGISYEHRLIDDMVAQMIKSRGGF-VLALKNYDGDVQSDIV 290

Query: 273 AALVGSLGVVPSANVGPD--IIIGEPCHGS 300
           A   GSLG++ S  + PD      E  HG+
Sbjct: 291 AQGFGSLGLMSSVLITPDGNAFESEAAHGT 320

>Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 66/126 (52%), Gaps = 11/126 (8%)

Query: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKN-KDLYGN--VSY 236
            AK + ++A++R     K  L  T K+ +L + DG F++V   +Y +N K+ + +  + Y
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYAENYKEKFESLGIWY 246

Query: 237 NEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IIIG 294
             +++D MV ++ +    + ++   N  GD+ SD  A   GSLG++ S  + PD      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSMLITPDGKTFES 305

Query: 295 EPCHGS 300
           E  HG+
Sbjct: 306 EAAHGT 311

>SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 411

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKN-KDLYG--NVSY 236
            AK + ++AL+R     K  L  T K+ +L + DG F+++   +Y  + +D +    + Y
Sbjct: 192 FAKASFELALER-----KLPLYSTTKNTILKRYDGKFKDIFESMYASDYQDKFEVIGIWY 246

Query: 237 NEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IIIG 294
             +++D MV ++ +    + ++   N  GD+ SD  A   GSLG++ S  V PD      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMSSVLVTPDGKTFES 305

Query: 295 EPCHGS 300
           E  HG+
Sbjct: 306 EAAHGT 311

>Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W
           (REAL)
          Length = 428

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 57/109 (52%), Gaps = 6/109 (5%)

Query: 197 KATLTVTHKSNVLSQSDGLFREVCRDVYE---KNKDLYGNVSYNEQIVDSMVYRIFREPE 253
           K  L ++ K+ +L + DG F+++ + VYE   K+K     + Y  +++D MV ++ +   
Sbjct: 221 KLNLFLSTKNTILKKYDGRFKDIFQKVYEAQYKSKFEALGIHYEHRLIDDMVAQMIKSKG 280

Query: 254 CFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IIIGEPCHGS 300
            F ++   N  GD+ SD  A   GSLG++ S  V PD      E  HG+
Sbjct: 281 GF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009W
           (REAL)
          Length = 420

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 62/126 (49%), Gaps = 11/126 (8%)

Query: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYE---KNKDLYGNVSY 236
            AK + ++AL+R     +  L  T K+ +L   D  F+E+   +++   K K     ++Y
Sbjct: 192 FAKASFELALKR-----RLPLFFTTKNTILKSYDNQFKEIFDKLFDAEYKEKFQALGITY 246

Query: 237 NEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IIIG 294
             +++D MV ++ +    F +V   N  GD+ SD  A   GSLG++ S  + PD      
Sbjct: 247 EHRLIDDMVAQMLKSRGGF-IVAMKNYDGDVQSDIVAQGFGSLGLMTSLLITPDAKTFES 305

Query: 295 EPCHGS 300
           E  HG+
Sbjct: 306 EAAHGT 311

>Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 65/127 (51%), Gaps = 13/127 (10%)

Query: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCR----DVYEKNKDLYGNVS 235
            AK + ++AL+R     K  L  T K+ +L + DG F++V      +VY++  +  G + 
Sbjct: 192 FAKASFELALER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYAEVYKEKFEALG-IW 245

Query: 236 YNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--III 293
           Y  +++D MV ++ +    + ++   N  GD+ SD  A   GSLG++ S  + PD     
Sbjct: 246 YEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSLLITPDGKTFE 304

Query: 294 GEPCHGS 300
            E  HG+
Sbjct: 305 SEAAHGT 311

>Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVY-EKNKDLYGN--VSY 236
            AK + ++A++R     K  L  T K+ +L + DG F++V   +Y E  K+ + +  + Y
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEGMYAESYKEKFESLGIWY 246

Query: 237 NEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IIIG 294
             +++D MV ++ +    + ++   N  GD+ SD  A   GSLG++ S  + PD      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKTFES 305

Query: 295 EPCHGS 300
           E  HG+
Sbjct: 306 EAAHGT 311

>TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.254
           YDL066W
          Length = 433

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 59/109 (54%), Gaps = 6/109 (5%)

Query: 197 KATLTVTHKSNVLSQSDGLFREVCRDVYE---KNKDLYGNVSYNEQIVDSMVYRIFREPE 253
           K  L ++ K+ +L + DG F++V ++V++   K+K    N+ Y  +++D MV ++ +   
Sbjct: 226 KLDLFLSTKNTILKKYDGRFKDVFQEVFDSTYKDKFEALNIKYEHRLIDDMVAQMIKSKG 285

Query: 254 CFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IIIGEPCHGS 300
            + ++   N  GD+ SD  A   GSLG++ S  V PD      E  HG+
Sbjct: 286 GY-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 333

>KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 429

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 94/204 (46%), Gaps = 19/204 (9%)

Query: 102 VEGYSSPIVALRKQLGLYANIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEERTYIDEAT 161
           V G+  PIV     +G +A+    K+       P  + +V + T+    K    Y  +  
Sbjct: 140 VPGWEKPIV-----IGRHAHGDQYKATDLVVPGPGKLELVYKPTDGSETKTLEVY--DYK 192

Query: 162 GTKVAEATKRISEVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCR 221
           G  +A A     E + R  A  +  +A+     T K  L ++ K+ +L + DG F+++ +
Sbjct: 193 GPGIALAMYNTDE-SIRGFAHASFKLAI-----TKKLNLYLSTKNTILKKYDGRFKDIFQ 246

Query: 222 DVYE---KNKDLYGNVSYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGS 278
           ++Y+   K++     + Y  +++D MV ++ +    F ++   N  GD+ SD  A   GS
Sbjct: 247 EIYDSEYKSEFEKLGIWYEHRLIDDMVAQMIKSKGGF-ILAFKNYDGDVQSDIVAQGFGS 305

Query: 279 LGVVPSANVGPD--IIIGEPCHGS 300
           LG++ S  V PD      E  HG+
Sbjct: 306 LGLMTSVLVTPDGKAFESEAAHGT 329

>Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP2)
           - Cytosolic form of NADP-dependent isocitrate
           dehydrogenase [contig 82] FULL
          Length = 411

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 64/128 (50%), Gaps = 15/128 (11%)

Query: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVY-----EKNKDLYGNV 234
            A+ + ++ALQR     +  L  T K+ +L + DG F++V   +Y      + ++L   +
Sbjct: 192 FARASFELALQR-----RMPLYSTTKNTILKKYDGKFKDVFEAMYAAEYQSRFEEL--GI 244

Query: 235 SYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--II 292
            Y  +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  V PD    
Sbjct: 245 WYEHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTF 303

Query: 293 IGEPCHGS 300
             E  HG+
Sbjct: 304 ESEAAHGT 311

>Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa]
           {ON} complement(198298..199557) [1260 nt, 420 aa]
          Length = 419

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 56/106 (52%), Gaps = 6/106 (5%)

Query: 200 LTVTHKSNVLSQSDGLFREVCRDVYEKN-KDLY--GNVSYNEQIVDSMVYRIFREPECFD 256
           L  T K+ +L + DG ++++  D+YEK+ KD +    + Y  +++D MV ++ +    F 
Sbjct: 212 LYSTTKNTILKKYDGQYKDIFNDMYEKDYKDKFEAKGIWYEHRLIDDMVAQMLKSKGGF- 270

Query: 257 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IIIGEPCHGS 300
           V+   N  GD+ SD  A   GSLG++ S  +  D      E  HG+
Sbjct: 271 VIAMKNYDGDVQSDVVAQGFGSLGLMSSILISDDGKTFESEAAHGT 316

>AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL066W
           (IDP1)
          Length = 425

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/210 (25%), Positives = 92/210 (43%), Gaps = 31/210 (14%)

Query: 102 VEGYSSPIVALRKQLGLYANIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEE------RT 155
           V G+  PI+     +G +A+        G   +  D V+    T DL  +          
Sbjct: 139 VPGWEKPII-----IGRHAH--------GDQYKATDAVVPGAGTLDLVFRPADGSAPTSL 185

Query: 156 YIDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGL 215
           ++ +  G  VA A     E + R  A  +  +AL +  N     L ++ K+ +L Q DG 
Sbjct: 186 HVYDFAGPGVALAMYNTEE-SIRGFAHASFRLALAKQLN-----LFLSTKNTILKQYDGR 239

Query: 216 FREVCRDVYE---KNKDLYGNVSYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGA 272
           F++V  ++Y+   K +     + Y  +++D MV ++ +    F ++   N  GD+ SD  
Sbjct: 240 FKDVFEELYQAQYKAEFERLGIYYEHRLIDDMVAQMVKSKGGF-IMALKNYDGDVQSDIV 298

Query: 273 AALVGSLGVVPSANVGPD--IIIGEPCHGS 300
           A   GSLG++ S  V PD      E  HG+
Sbjct: 299 AQGFGSLGLMTSVLVTPDGKTFESEAAHGT 328

>CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174w IDP2 isocitrate dehydrogenase or
           uniprot|P53982 Saccharomyces cerevisiae YNL009w IDP3 or
           uniprot|P21954 Saccharomyces cerevisiae YDL066w IDP1
          Length = 411

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 63/130 (48%), Gaps = 11/130 (8%)

Query: 176 ATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYE---KNKDLYG 232
           + R  A+ + ++AL+      +  L  T K+ +L + DG F++    +YE   K +    
Sbjct: 188 SIRGFARASFNMALEH-----EMPLYSTTKNTILKKYDGKFKDTFESMYEAEYKEQFEAK 242

Query: 233 NVSYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD-- 290
            + Y  +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  + PD  
Sbjct: 243 GIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLISPDGK 301

Query: 291 IIIGEPCHGS 300
               E  HG+
Sbjct: 302 TFESEAAHGT 311

>Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174W
           (REAL)
          Length = 418

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 63/126 (50%), Gaps = 11/126 (8%)

Query: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVY-EKNKDLYG--NVSY 236
            AK + ++AL+R     K  L  T K+ +L   D  F+++   ++ EK ++ +    + Y
Sbjct: 192 FAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDGLFNEKYREKFQALGIKY 246

Query: 237 NEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IIIG 294
             +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  V PD      
Sbjct: 247 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFES 305

Query: 295 EPCHGS 300
           E  HG+
Sbjct: 306 EAAHGT 311

>YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}
           IDP2Cytosolic NADP-specific isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to
           alpha-ketoglutarate; levels are elevated during growth
           on non-fermentable carbon sources and reduced during
           growth on glucose
          Length = 412

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 64/128 (50%), Gaps = 15/128 (11%)

Query: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVY-----EKNKDLYGNV 234
            AK + ++A++R     K  L  T K+ +L + DG F++V   +Y     EK + L   +
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYARSYKEKFESL--GI 244

Query: 235 SYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--II 292
            Y  +++D MV ++ +    + ++   N  GD+ SD  A   GSLG++ S  + PD    
Sbjct: 245 WYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKTF 303

Query: 293 IGEPCHGS 300
             E  HG+
Sbjct: 304 ESEAAHGT 311

>KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 73/150 (48%), Gaps = 17/150 (11%)

Query: 178 RKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYE---KNKDLYGNV 234
           R  A  +  +AL +     K  L ++ K+ +L + DG F+++ +++++   K +     +
Sbjct: 207 RGFAHASFKLALSK-----KLDLFLSTKNTILKRYDGRFKDLFQEIFDAEYKQQFEESGI 261

Query: 235 SYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--II 292
            Y  +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  V PD    
Sbjct: 262 QYQHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTF 320

Query: 293 IGEPCHGSAPDI-----SGQGIS-NPVATI 316
             E  HG+          G+  S NP+A+I
Sbjct: 321 ESEAAHGTVTRHYRKYQRGEETSTNPIASI 350

>NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {ON}
           Anc_1.396
          Length = 418

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVY-EKNKDLYGN--VSY 236
            A+ +  +A+++     K  L  T K+ +L + DG F+++  ++Y  + KD +    + Y
Sbjct: 196 FARASFQMAIKK-----KIPLYFTTKNTILKKYDGTFKDIFMEMYLNEYKDEFDKLGIFY 250

Query: 237 NEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IIIG 294
             +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  + PD      
Sbjct: 251 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFQS 309

Query: 295 EPCHGS 300
           E  HG+
Sbjct: 310 EAAHGT 315

>Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 57/109 (52%), Gaps = 6/109 (5%)

Query: 197 KATLTVTHKSNVLSQSDGLFREVCRDVYE---KNKDLYGNVSYNEQIVDSMVYRIFREPE 253
           K  L ++ K+ +L + DG F+++ +++YE   K K     + Y  +++D MV ++ +   
Sbjct: 222 KLNLFLSTKNTILKKYDGRFKDIFQNIYEAQYKPKFEELGIHYEHRLIDDMVAQMVKSKG 281

Query: 254 CFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IIIGEPCHGS 300
            F ++   N  GD+ SD  A   GSLG++ S  V PD      E  HG+
Sbjct: 282 GF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 329

>KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {ON}
           Anc_4.254 YDL066W
          Length = 421

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 90/203 (44%), Gaps = 24/203 (11%)

Query: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYE---KNKDLYGNVSY 236
            A  +  +AL +     K  L +  K+ +L + DG F+++ + +Y    K K     ++Y
Sbjct: 204 FAHSSFQVALNK-----KLNLFLATKNTILKKYDGRFKDIFQQIYNGQYKAKFEQLGITY 258

Query: 237 NEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IIIG 294
             +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  V PD      
Sbjct: 259 EHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVSPDGKTFES 317

Query: 295 EPCHGSAP------DISGQGISNPVATIRSAALMLQFLGYNEAAKDI-------QNAVDE 341
           E  HG+         +  +  +N +A+I + +  L   G  +  KD+       + A  +
Sbjct: 318 EAAHGTVTRHFRRHQMGEETSTNSIASIFAWSRGLAKRGELDGTKDVIAFANKLEAATLD 377

Query: 342 NIRSGKIKTPDLGGDSSTTEVTD 364
           +++   I T DL   S     +D
Sbjct: 378 SVQEDGIMTKDLALASGKNNRSD 400

>Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009W
           (REAL)
          Length = 417

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 62/126 (49%), Gaps = 11/126 (8%)

Query: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYE---KNKDLYGNVSY 236
            AK + ++AL+R     K  L  T K+ +L   D  F+++   +++   K +     ++Y
Sbjct: 192 FAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDKLFDAEYKEQFQALGITY 246

Query: 237 NEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IIIG 294
             +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  + PD      
Sbjct: 247 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILITPDGKTFES 305

Query: 295 EPCHGS 300
           E  HG+
Sbjct: 306 EAAHGT 311

>TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 66/130 (50%), Gaps = 11/130 (8%)

Query: 176 ATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYE---KNKDLYG 232
           + R  A  + ++A+ +  N   AT     K+ +L + DG F+++ +++YE   K +    
Sbjct: 203 SIRGFAYSSFNLAVNKNMNLFLAT-----KNTILKKYDGRFKDIFQEIYENEYKKEFERL 257

Query: 233 NVSYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD-- 290
           N++Y  +++D MV ++ +    + ++   N  GD+ SD  A   GSLG++ S    PD  
Sbjct: 258 NITYEHRLIDDMVAQMIKSKGGY-IMALKNYDGDVQSDIVAQGFGSLGLMTSILASPDGK 316

Query: 291 IIIGEPCHGS 300
               E  HG+
Sbjct: 317 TFESEAAHGT 326

>Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar to
           Ashbya gossypii AER061C
          Length = 424

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 64/128 (50%), Gaps = 11/128 (8%)

Query: 178 RKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYE-KNKDLYGN--V 234
           R  A  +  +AL     T K  L ++ K+ +L   DG F+++ +++Y+ + K  + N  +
Sbjct: 203 RGFAHASFKLAL-----TKKLNLFLSTKNTILKTYDGRFKDIFQELYDTQYKTEFENHGI 257

Query: 235 SYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--II 292
            Y  +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S    PD    
Sbjct: 258 YYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILATPDGKTF 316

Query: 293 IGEPCHGS 300
             E  HG+
Sbjct: 317 ESEAAHGT 324

>ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 422

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 94/206 (45%), Gaps = 23/206 (11%)

Query: 102 VEGYSSPIVALRKQLGLYANIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEERTYID--E 159
           V G+  PI+     +G +A+    K+      +P  + +V    ED     E T ++  +
Sbjct: 133 VPGWEKPII-----IGRHAHADQYKATDTLVAKPGKLELV-HRPED---GSEPTTLEVYD 183

Query: 160 ATGTKVAEATKRISEVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREV 219
             G  VA A     E + R     +  +AL +     K  L ++ K+ +L + DG F+++
Sbjct: 184 YKGPGVALAMYNTDE-SIRGFGHASFKLALDK-----KLNLYLSTKNTILKKYDGRFKDI 237

Query: 220 CRDVYE---KNKDLYGNVSYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALV 276
            +++Y+   K +     + Y  +++D MV ++ +    F ++   N  GD+ SD  A   
Sbjct: 238 FQELYDTQYKAEFEKAGIFYEHRLIDDMVAQMVKSKGGF-IMALKNYDGDVQSDIVAQGF 296

Query: 277 GSLGVVPSANVGPD--IIIGEPCHGS 300
           GSLG++ S  + PD      E  HG+
Sbjct: 297 GSLGLMTSVLITPDGKTFESEAAHGT 322

>KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 415

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 68/149 (45%), Gaps = 12/149 (8%)

Query: 157 IDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLF 216
            DE +   VA A     E  T   A  +  +AL+R        L  T K+ +L + DG F
Sbjct: 173 FDEESKGGVAMAMYNTLESIT-GFAHASFKMALER-----GLPLYSTTKNTILKKYDGKF 226

Query: 217 REVCRDVYE---KNKDLYGNVSYNEQIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAA 273
           ++V   +YE   K+      + Y  +++D MV ++ +    + ++   N  GD+ SD  A
Sbjct: 227 KDVFESLYESQYKSAFEAKGIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVA 285

Query: 274 ALVGSLGVVPSANVGPD--IIIGEPCHGS 300
              GSLG++ S  + PD      E  HG+
Sbjct: 286 QGFGSLGLMTSVLITPDGKAFESEAAHGT 314

>NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa]
           {ON} Anc_1.396
          Length = 420

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 59/122 (48%), Gaps = 11/122 (9%)

Query: 184 ALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYG---NVSYNEQI 240
           +  +AL+R     K  L  T K+ +L + DG F+++  ++YE+          + Y  ++
Sbjct: 204 SFKLALER-----KMPLYSTTKNTILKRYDGKFKDIFENMYEEQFREQFEELGIWYEHRL 258

Query: 241 VDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IIIGEPCH 298
           +D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  +  D      E  H
Sbjct: 259 IDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISSDGKSFESEAAH 317

Query: 299 GS 300
           G+
Sbjct: 318 GT 319

>KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON}
           Anc_3.455 YPR122W
          Length = 1201

 Score = 32.0 bits (71), Expect = 2.9,   Method: Composition-based stats.
 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 1/68 (1%)

Query: 204 HKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPECFDVVVAPNL 263
           ++ N++ Q   L+R V +D  E+  DL G +  N Q++D + Y     P    +    N 
Sbjct: 421 NEQNIIEQVRFLYRGVEKDPMEECSDLSGLLQENMQVLD-IKYLFKGSPSITQLYSGKNQ 479

Query: 264 YGDILSDG 271
           Y + ++DG
Sbjct: 480 YSESMTDG 487

>ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507C
          Length = 1189

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 42/84 (50%), Gaps = 11/84 (13%)

Query: 287 VGPDIIIGEPCHGSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSG 346
             P+I+ G P HG A DI   G+          AL+   L ++E   +I+N + + ++SG
Sbjct: 198 AAPEIVSGIPYHGFASDIWSCGVI-------FFALLTGRLPFDEEDGNIRNLLLK-VQSG 249

Query: 347 KIKTPDLGGDSSTTEVTDDILSKL 370
           K + PD   D   +    D+L+K+
Sbjct: 250 KFEMPD---DDEISPEAQDLLAKI 270

>Suva_16.483 Chr16 complement(831888..833729) [1842 bp, 613 aa] {ON}
           YPR155C (REAL)
          Length = 613

 Score = 30.4 bits (67), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 15/77 (19%), Positives = 37/77 (48%)

Query: 161 TGTKVAEATKRISEVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVC 220
           T  ++ ++ + I+      + K+ LD+  Q +++  K T  +    + L Q   +  +VC
Sbjct: 3   TNRRILKSFEEINHSLEESLQKVTLDLQQQLVQDDNKETRELARLQDQLQQVRSIVEKVC 62

Query: 221 RDVYEKNKDLYGNVSYN 237
             +   N + Y ++S++
Sbjct: 63  VSIKSDNVESYCSISFD 79

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.135    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,375,930
Number of extensions: 1618360
Number of successful extensions: 4787
Number of sequences better than 10.0: 147
Number of HSP's gapped: 4586
Number of HSP's successfully gapped: 147
Length of query: 370
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 259
Effective length of database: 40,753,473
Effective search space: 10555149507
Effective search space used: 10555149507
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)