Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1003.382.286ON49649625210.0
TPHA0C034002.286ON49449619000.0
NDAI0G006602.286ON49649818390.0
Skud_14.3072.286ON49049618070.0
Suva_14.3252.286ON49049617870.0
KAFR0H033102.286ON48849817650.0
YNL022C2.286ON49049717520.0
Smik_14.3092.286ON49049617440.0
NCAS0G037902.286ON49249717350.0
TDEL0G021702.286ON48449517080.0
KNAG0H020002.286ON49850017050.0
CAGL0M06941g2.286ON49250216960.0
TBLA0B069602.286ON50850816930.0
KLLA0E08361g2.286ON49150016670.0
SAKL0E07678g2.286ON47749616360.0
ZYRO0A01892g2.286ON46549716130.0
Kwal_27.115322.286ON47949615980.0
KLTH0G10362g2.286ON52949615890.0
ADL215W2.286ON48449815610.0
Ecym_33252.286ON49649715600.0
AFR179C8.171ON7003021883e-14
TPHA0C028708.171ON6743051795e-13
KNAG0I018702.247ON6292981751e-12
ADL254W2.247ON6032221732e-12
Ecym_23538.171ON6903031732e-12
TPHA0H001508.171ON6493071723e-12
Kpol_1003.152.247ON6332091714e-12
CAGL0J10032g2.247ON6192091705e-12
NDAI0B018308.171ON6863041705e-12
SAKL0E08624g2.247ON6112901696e-12
SAKL0H19448g8.171ON6913021697e-12
TPHA0C031502.247ON6082091688e-12
KLTH0H08096g8.171ON6883021689e-12
KAFR0J009702.247ON6103031671e-11
Smik_14.2662.247ON6182981671e-11
KLLA0F03399g2.247ON6192981671e-11
TBLA0E038502.247ON6322901671e-11
TDEL0B043908.171ON6733091671e-11
NCAS0G030302.247ON4902171661e-11
YNL061W (NOP2)2.247ON6182981661e-11
Suva_14.2802.247ON6202981661e-11
NDAI0D010502.247ON6252091661e-11
NCAS0B043908.171ON6713051652e-11
ZYRO0G08998g8.171ON6833051652e-11
Skud_14.2712.247ON6192091643e-11
Kwal_23.48412.247ON6272221643e-11
Ecym_32842.247ON6062141633e-11
ZYRO0A01562g2.247ON6172071633e-11
KNAG0D020508.171ON6823051634e-11
TDEL0C041502.247ON6142171624e-11
KLTH0G09460g2.247ON6372221625e-11
KNAG0G015108.171ON6663041625e-11
Kpol_1002.1098.171ON6703051625e-11
KAFR0B022208.171ON6863051553e-10
Suva_2.978.171ON6703051544e-10
NCAS0B056408.171ON6593071536e-10
TBLA0A087408.171ON6863091529e-10
Skud_2.818.171ON6813051492e-09
Smik_2.928.171ON6743051492e-09
YBL024W (NCL1)8.171ON6843051482e-09
CAGL0K01991g8.171ON6722991431e-08
NDAI0B029808.171ON6793101402e-08
KLLA0F12562g8.171ON7043061375e-08
Kwal_14.20818.171ON2721271071e-04
Suva_5.3058.237ON777103840.14
CAGL0L11924g8.237ON77594790.50
YER171W (RAD3)8.237ON77894790.54
Smik_5.3438.237ON77594790.55
Skud_5.3108.237ON77594780.58
Kpol_1032.548.237ON77694761.2
ZYRO0B11836g8.237ON77094741.7
TBLA0E042308.237ON77994742.0
TPHA0A019208.237ON77394732.4
NCAS0A052104.126ON34960704.5
KLLA0C17776g8.237ON77895705.5
TPHA0K014304.145ON33327695.7
Ecym_30036.1ON31973696.6
Ecym_35178.237ON75692696.7
AGL161C8.352ON770133697.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1003.38
         (496 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON} (94479....   975   0.0  
TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.2...   736   0.0  
NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.2...   712   0.0  
Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {...   700   0.0  
Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {...   692   0.0  
KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {O...   684   0.0  
YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON} ...   679   0.0  
Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {...   676   0.0  
NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {O...   672   0.0  
TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.2...   662   0.0  
KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {O...   661   0.0  
CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa] ...   657   0.0  
TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON} Anc_2...   656   0.0  
KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {...   646   0.0  
SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {...   634   0.0  
ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} simila...   625   0.0  
Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {...   620   0.0  
KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly...   616   0.0  
ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic ho...   605   0.0  
Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar t...   605   0.0  
AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON} S...    77   3e-14
TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.1...    74   5e-13
KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {O...    72   1e-12
ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic ho...    71   2e-12
Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}...    71   2e-12
TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171...    71   3e-12
Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON} (41683....    70   4e-12
CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highl...    70   5e-12
NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.1...    70   5e-12
SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {...    70   6e-12
SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} high...    70   7e-12
TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.2...    69   8e-12
KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} simila...    69   9e-12
KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2....    69   1e-11
Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061...    69   1e-11
KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} simila...    69   1e-11
TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.2...    69   1e-11
TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.1...    69   1e-11
NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.2...    69   1e-11
YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Proba...    69   1e-11
Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061...    69   1e-11
NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.2...    69   1e-11
NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {O...    68   2e-11
ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {...    68   2e-11
Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061...    68   3e-11
Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W...    68   3e-11
Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar t...    67   3e-11
ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} simila...    67   3e-11
KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.1...    67   4e-11
TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {O...    67   4e-11
KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} simila...    67   5e-11
KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {O...    67   5e-11
Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON} (272...    67   5e-11
KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {O...    64   3e-10
Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W (...    64   4e-10
NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa] ...    64   6e-10
TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON} Anc_8...    63   9e-10
Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W (...    62   2e-09
Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W (...    62   2e-09
YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}  NCL1S-aden...    62   2e-09
CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highl...    60   1e-08
NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {O...    59   2e-08
KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} high...    57   5e-08
Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W ...    46   1e-04
Suva_5.305 Chr5 (494912..497245) [2334 bp, 777 aa] {ON} YER171W ...    37   0.14 
CAGL0L11924g Chr12 (1279776..1282103) [2328 bp, 775 aa] {ON} hig...    35   0.50 
YER171W Chr5 (527082..529418) [2337 bp, 778 aa] {ON}  RAD35' to ...    35   0.54 
Smik_5.343 Chr5 (526697..529024) [2328 bp, 775 aa] {ON} YER171W ...    35   0.55 
Skud_5.310 Chr5 (512188..514515) [2328 bp, 775 aa] {ON} YER171W ...    35   0.58 
Kpol_1032.54 s1032 (122377..124707) [2331 bp, 776 aa] {ON} (1223...    34   1.2  
ZYRO0B11836g Chr2 (940987..943299) [2313 bp, 770 aa] {ON} highly...    33   1.7  
TBLA0E04230 Chr5 (1071883..1074222) [2340 bp, 779 aa] {ON} Anc_8...    33   2.0  
TPHA0A01920 Chr1 complement(387645..389966) [2322 bp, 773 aa] {O...    33   2.4  
NCAS0A05210 Chr1 (1031496..1032545) [1050 bp, 349 aa] {ON} Anc_4...    32   4.5  
KLLA0C17776g Chr3 (1577323..1579659) [2337 bp, 778 aa] {ON} high...    32   5.5  
TPHA0K01430 Chr11 complement(300282..301283) [1002 bp, 333 aa] {...    31   5.7  
Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} simi...    31   6.6  
Ecym_3517 Chr3 complement(972456..974726) [2271 bp, 756 aa] {ON}...    31   6.7  
AGL161C Chr7 complement(394886..397198) [2313 bp, 770 aa] {ON} S...    31   7.3  

>Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON}
           (94479..95969) [1491 nt, 497 aa]
          Length = 496

 Score =  975 bits (2521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/496 (95%), Positives = 474/496 (95%)

Query: 1   MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY 60
           MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY
Sbjct: 1   MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY 60

Query: 61  LEKVMKRSGILDDIPNKKGKPQFERXXXXXXXXXXXXSKSKRIQMGKHPIKTYILKYKTR 120
           LEKVMKRSGILDDIPNKKGKPQFER            SKSKRIQMGKHPIKTYILKYKTR
Sbjct: 61  LEKVMKRSGILDDIPNKKGKPQFERLTLLLLCHDLLLSKSKRIQMGKHPIKTYILKYKTR 120

Query: 121 LHSEXXXXXXXXXXRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKF 180
           LHSE          RDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKF
Sbjct: 121 LHSELVKLKLKLKVRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKF 180

Query: 181 PTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNP 240
           PTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNP
Sbjct: 181 PTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNP 240

Query: 241 GKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSN 300
           GKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSN
Sbjct: 241 GKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSN 300

Query: 301 TIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQDD 360
           TIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQDD
Sbjct: 301 TIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQDD 360

Query: 361 EDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEG 420
           EDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEG
Sbjct: 361 EDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEG 420

Query: 421 VVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDEDEKCQELADGCIRVLP 480
           VVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDEDEKCQELADGCIRVLP
Sbjct: 421 VVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDEDEKCQELADGCIRVLP 480

Query: 481 KEDGGIGFFAVCFERN 496
           KEDGGIGFFAVCFERN
Sbjct: 481 KEDGGIGFFAVCFERN 496

>TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.286
           YNL022C
          Length = 494

 Score =  736 bits (1900), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/496 (70%), Positives = 416/496 (83%), Gaps = 3/496 (0%)

Query: 1   MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY 60
           M+FYRD+TWVLE+LEKE+AK KISGS+Q +VLKSCK YKV+SNP+H+YA ++SCWK KPY
Sbjct: 1   MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY 60

Query: 61  LEKVMKRSGILDDIPNKKGKPQFERXXXXXXXXXXXXSKSKRIQMGKHPIKTYILKYKTR 120
           LE +MK+SGIL++IP K GKP+FER            SKSKRIQMGKHP+K Y+LKYKT 
Sbjct: 61  LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS 120

Query: 121 LHSEXXXXXXXXXXRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKF 180
           L SE          +   +LI  ++  +DITPVRW RINPIR    KG+E I+ EL KKF
Sbjct: 121 LRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKF 180

Query: 181 PTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNP 240
           PTRV+HWS I  GTIYHD++IPNLFGVHTKDKITSHELYK GK+IIQDRASCFPAH+LNP
Sbjct: 181 PTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNP 240

Query: 241 GKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSN 300
           GK+DIVID+CAAPGNKTTHTA+YILGGP KDQ  QI+AFEKDPERAK+LQ M++ AGC+ 
Sbjct: 241 GKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCAR 300

Query: 301 TIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQDD 360
           TI+VNVGDFTKIATPEKF+NVTGFIVDPSCSGSGIFGRK++D++NKKK+    D    D+
Sbjct: 301 TIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKE--GEDVDEDDE 358

Query: 361 EDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEG 420
            +++P EQ+EEF  K+DDLKTRLSKLASFQFQVVKHAM+FPKA+K+VYSTCSIHAEENE 
Sbjct: 359 SESIPVEQDEEFS-KKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENER 417

Query: 421 VVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDEDEKCQELADGCIRVLP 480
           VVIDLLLD+ +++ GW+VA R +VIPTWPRRG+  EF +VFRD++EKC+E+A GCIR LP
Sbjct: 418 VVIDLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDDEEKCKEIAGGCIRALP 477

Query: 481 KEDGGIGFFAVCFERN 496
           KEDGGIGFFAVCFER+
Sbjct: 478 KEDGGIGFFAVCFERD 493

>NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.286
           YNL022C
          Length = 496

 Score =  712 bits (1839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/498 (67%), Positives = 407/498 (81%), Gaps = 5/498 (1%)

Query: 1   MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY 60
           M+FYRD+TWVLEY+E++ AK +ISGSLQ LVL+SC KYK+K NP+HVYA + SCWK KPY
Sbjct: 1   MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY 60

Query: 61  LEKVMKRSGILDDIPNKKGKPQFERXXXXXXXXXXXXSKSKRIQMGKHPIKTYILKYKTR 120
           LEKVMK+SGILDDIP KKGKP + R            SKSKRIQMGKHPIK Y+LK+K+R
Sbjct: 61  LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR 120

Query: 121 LHSEXXXXXXXXXXRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKF 180
           LHSE          ++LSE++++ +S +D+TPVRWIRINP+R    + +  ++ EL KKF
Sbjct: 121 LHSELVRLKLKLKVKNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKF 180

Query: 181 PTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNP 240
           P RV +W+DIVPG+IY+D+YIP+L+G+H +DKITSHELYK GK+IIQDRASCFPAHILNP
Sbjct: 181 PKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 241 GKNDIVIDACAAPGNKTTHTASYILGGPKK-DQTTQIYAFEKDPERAKILQHMIKVAGCS 299
            K+DI+IDACAAPGNKTTH ASY+ G  K+ D   QIYAFEKDPERAKIL+ MIKVAGCS
Sbjct: 241 SKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCS 300

Query: 300 NTIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQ- 358
             IQV VGDFTK ATP+KF++VTGFIVDPSCSGSGIFGRKYVDS+N+++   + D   + 
Sbjct: 301 KNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNDTTDKDKKS 360

Query: 359 -DDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEE 417
            +++D VPDEQE+    K++DLKTRL+KL+SFQFQV+KHAMSFP AKKIVYSTCSIHAEE
Sbjct: 361 TEEDDEVPDEQEDYN--KKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEE 418

Query: 418 NEGVVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDEDEKCQELADGCIR 477
           NE VV+DLLLD KV++WGWKVA +  VIPTWPRRG   EF +VFRD+  KCQ LADGCIR
Sbjct: 419 NERVVLDLLLDSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDDPAKCQALADGCIR 478

Query: 478 VLPKEDGGIGFFAVCFER 495
            LP++DGGIGFFAVCFER
Sbjct: 479 ALPRDDGGIGFFAVCFER 496

>Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  700 bits (1807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/496 (67%), Positives = 398/496 (80%), Gaps = 8/496 (1%)

Query: 1   MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY 60
           M+FYRD+TWVLE +EKE AK++ISGS+Q LVL+SCKKYK+KSNP+H+YA + SCWK KPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LEKVMKRSGILDDIPNKKGKPQFERXXXXXXXXXXXXSKSKRIQMGKHPIKTYILKYKTR 120
           LEKVMK++ IL+DIP KKGKP F R            SK KRIQMGKHPIK Y+LK+K+ 
Sbjct: 61  LEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LHSEXXXXXXXXXXRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKF 180
           LHSE          RDLSE++  E+  +D+ PVRWIRINP++   +   EP++ EL KKF
Sbjct: 121 LHSEMVKLKLKLKVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKF 180

Query: 181 PTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNP 240
             +VN WSD+VPG+IY+D+YIPNLFG+H  DKIT+HELYK GK+IIQDRASCFPAHIL+P
Sbjct: 181 TLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240

Query: 241 GKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSN 300
           G +DIVIDAC+APGNKTTHTASYI  GP KD   +IYAFEKDPERAKILQ M+KVAGCS+
Sbjct: 241 GADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVAGCSS 300

Query: 301 TIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQDD 360
            I V VGDFTK+ATP+K +  TGFIVDPSCSGSGIFGRK+ DS+NK+K +        DD
Sbjct: 301 NIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDE-----KDDD 355

Query: 361 EDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEG 420
            D +PDEQEE   + +++L+TRL+KL+SFQFQ+VKHAMSFP AKKIVYSTCSIHAEENE 
Sbjct: 356 NDVIPDEQEEF--MAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENER 413

Query: 421 VVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRD-EDEKCQELADGCIRVL 479
           VVIDLLLDK VQEWGWKVAPR+EVIP+WPRRG   EF +VFRD      ++LA+GCIR L
Sbjct: 414 VVIDLLLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRAL 473

Query: 480 PKEDGGIGFFAVCFER 495
           PKEDGGIGFFAVCFER
Sbjct: 474 PKEDGGIGFFAVCFER 489

>Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/496 (68%), Positives = 399/496 (80%), Gaps = 8/496 (1%)

Query: 1   MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY 60
           M+FYRD+TWVLE +EKE AK +ISGS+Q LVLKSCK+YK+KSNP+H+YA + SCWK KPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LEKVMKRSGILDDIPNKKGKPQFERXXXXXXXXXXXXSKSKRIQMGKHPIKTYILKYKTR 120
           LEKVMK++ IL++IP KKGKP F R            SK KRIQMGKHPIK Y+LK+K+ 
Sbjct: 61  LEKVMKKARILEEIPKKKGKPLFARLTLLLLCHDLLLSKQKRIQMGKHPIKEYVLKFKSP 120

Query: 121 LHSEXXXXXXXXXXRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKF 180
           LHSE          RDLSEL+  E+  +D+ PVRWIRINP++   D   EP++ EL KKF
Sbjct: 121 LHSEMVKLKLKLKVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKF 180

Query: 181 PTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNP 240
             +V++WS++VPG+IYHD+YIPNLFG+H  DKIT+HELYK GK+IIQDRASCFPAHIL+P
Sbjct: 181 TQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240

Query: 241 GKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSN 300
           G NDIVIDAC+APGNKTTHTASYI   P KD+  QIYAFEKDPERAKILQ MIKVAGCS 
Sbjct: 241 GSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEKDPERAKILQKMIKVAGCSA 300

Query: 301 TIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQDD 360
            I VNVGDFTK+ATPEK + VTGFIVDPSCSGSGIFGRK+ DS+N++K +        D+
Sbjct: 301 NIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIDEK-----DDE 355

Query: 361 EDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEG 420
           +DAVPDEQEE   + +++L+TRL+KL+SFQFQ+VKHAMSFP AKKIVYSTCSIHAEENE 
Sbjct: 356 DDAVPDEQEE--FMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENER 413

Query: 421 VVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRD-EDEKCQELADGCIRVL 479
           VVIDLLLDK VQEWGWKVA R+EV+P+WPRRG   EF +VFRD      Q+LA+GCIR L
Sbjct: 414 VVIDLLLDKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRAL 473

Query: 480 PKEDGGIGFFAVCFER 495
           PKEDGGIGFFAVCF R
Sbjct: 474 PKEDGGIGFFAVCFVR 489

>KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {ON}
           Anc_2.286 YNL022C
          Length = 488

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/498 (65%), Positives = 393/498 (78%), Gaps = 13/498 (2%)

Query: 1   MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY 60
           M+FYRD+TWVLEY+E++++K +ISGSLQ LVLKSC+KYK+K+NP+H+YA + SCWK KP+
Sbjct: 1   MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF 60

Query: 61  LEKVMKRSGILDDIPNKKGKPQFERXXXXXXXXXXXXSKSKRIQMGKHPIKTYILKYKTR 120
           LEKVM +SGIL DIP KKGKP + R            SK KRIQMGKHPIK ++L+YK+R
Sbjct: 61  LEKVMSKSGILKDIPKKKGKPVYTRLTLLLLIHDLLLSKQKRIQMGKHPIKLFVLRYKSR 120

Query: 121 LHSEXXXXXXXXXXRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKF 180
           LHSE          RDLSEL++  +S++DITPVRW RINP+R         +M EL KKF
Sbjct: 121 LHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRC---PDASAVMKELEKKF 177

Query: 181 PTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNP 240
           P RV  W  IVPG+IYHD++IP LFG+H +DKITSHELYK G++IIQDRASCFPAHILNP
Sbjct: 178 PQRVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNP 237

Query: 241 GKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSN 300
              D +IDAC+APGNKTTH ASY+ G    D   +I+AFEKDPERAK+LQ MIKVAGCS 
Sbjct: 238 TLEDKIIDACSAPGNKTTHVASYMFGNGLVDD-VRIFAFEKDPERAKVLQKMIKVAGCSK 296

Query: 301 TIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINK-KKQESSGDNGNQD 359
            I VNVGDFTK+ATP KF +VTGFIVDPSCSGSGIFGRKY+DS+N+ KK +   DNG   
Sbjct: 297 QISVNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDIVDNG--- 353

Query: 360 DEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENE 419
               VPDEQEE  + +  +L+ RLSKL+SFQFQVVKHAMSFPKAK+IVYSTCSIHAEENE
Sbjct: 354 ----VPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENE 409

Query: 420 GVVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDED-EKCQELADGCIRV 478
            V +DLLLD+KV++WGWK+A R  VIP WPRRGF +EF ++FRD+   +CQE+ADGCIR 
Sbjct: 410 RVALDLLLDEKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRA 469

Query: 479 LPKEDGGIGFFAVCFERN 496
           LP+EDGGIGFFA+CFER+
Sbjct: 470 LPREDGGIGFFAICFERD 487

>YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON}
           Putative cytosine 5-methyltransferase, contains seven
           beta-strand methyltransferase motif similar to
           NOP2/YNL061W; green fluorescent protein (GFP)-fusion
           protein localizes to the nucleus; predicted to be
           involved in ribosome biogenesis
          Length = 490

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/497 (66%), Positives = 398/497 (80%), Gaps = 8/497 (1%)

Query: 1   MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY 60
           M+FYRD+TWVLE +EKE AK++ISGS+Q LVLKSCK+YK+KSNP+H+YA + SCWK KPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LEKVMKRSGILDDIPNKKGKPQFERXXXXXXXXXXXXSKSKRIQMGKHPIKTYILKYKTR 120
           LEKVMK++ IL+DIP KKGKP F R            SK KRIQMGKHPIK Y+LK+K+ 
Sbjct: 61  LEKVMKKAHILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LHSEXXXXXXXXXXRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKF 180
           LHSE          R+LSEL+  E+ ++D+ PVRWIRINP++   +   EP++ EL KKF
Sbjct: 121 LHSEMVKLKLKLKVRELSELVLSEDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKF 180

Query: 181 PTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNP 240
             +V+ WS++VPG+IY+D++IPNLFG+H  DKIT+HELYK GK+IIQDRASCFPAHILNP
Sbjct: 181 TLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNP 240

Query: 241 GKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSN 300
           G +DIVID+C+APGNKTTHTASYI   P KD  T+IYAFEKDPERAK+LQ MIK+AGCS 
Sbjct: 241 GPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSP 300

Query: 301 TIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQDD 360
            I VNVGDFTK+ATPEK+++VT FIVDPSCSGSGIFGRK+ DS N++K +        DD
Sbjct: 301 NISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNRRKIDDK-----DDD 355

Query: 361 EDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEG 420
              VPDEQEE   + +++L+TRL+KL+SFQFQ+VKHAMSFP AKKIVYSTCSIHAEENE 
Sbjct: 356 GGIVPDEQEE--FIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENER 413

Query: 421 VVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDE-DEKCQELADGCIRVL 479
           VVIDLLLDK V+EWGWKVAP+ EVIP+WPRRG   EF +VFRD      Q+LA+GCIR L
Sbjct: 414 VVIDLLLDKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRAL 473

Query: 480 PKEDGGIGFFAVCFERN 496
           PK DGGIGFFAVCFER+
Sbjct: 474 PKSDGGIGFFAVCFERD 490

>Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/496 (67%), Positives = 392/496 (79%), Gaps = 8/496 (1%)

Query: 1   MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY 60
           M+FYRD+TWVLE +EKE AK++ISGS+Q LVLKSCK+YK+KSNP+HVYA + SCWK KPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY 60

Query: 61  LEKVMKRSGILDDIPNKKGKPQFERXXXXXXXXXXXXSKSKRIQMGKHPIKTYILKYKTR 120
           LEKVMK++ IL+DIP KKGKP F R            SK KRIQMGKHPIK Y+LK+K+ 
Sbjct: 61  LEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLISKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LHSEXXXXXXXXXXRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKF 180
           LHSE          R+LSEL+  E+  +D+ PVRWIRINP++   +   EP++ EL KKF
Sbjct: 121 LHSEMVKLKLKLKVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKF 180

Query: 181 PTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNP 240
             +V  WS++VP +IY+D+YIPNLFG+H  DKIT+HELYK GK+IIQDRASCFPAHILNP
Sbjct: 181 TLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNP 240

Query: 241 GKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSN 300
           G NDIVIDAC+APGNKTTHTASYI   P KD  T+IYAFEKDPERAKILQ MIK+AGCS+
Sbjct: 241 GPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSS 300

Query: 301 TIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQDD 360
            I V+VGDFTK+ATPEKF++ TGFIVDPSCSGSGIFGRK+ DS+N+KK +        DD
Sbjct: 301 NIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRKKMDDK-----DDD 355

Query: 361 EDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEG 420
            D VPDEQEE   + +++L+TRL+KL+SFQFQ+VKHAMSFP AKKIVYSTCSIHAEENE 
Sbjct: 356 NDIVPDEQEE--FMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENER 413

Query: 421 VVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRG-FQAEFSKVFRDEDEKCQELADGCIRVL 479
           VVIDLLLDK VQEWGW+VAPRSEVIP WPRRG  +              QELA+GCIR L
Sbjct: 414 VVIDLLLDKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRAL 473

Query: 480 PKEDGGIGFFAVCFER 495
           PK+DGGIGFFAVCFER
Sbjct: 474 PKDDGGIGFFAVCFER 489

>NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {ON}
           Anc_2.286 YNL022C
          Length = 492

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/497 (67%), Positives = 405/497 (81%), Gaps = 7/497 (1%)

Query: 1   MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY 60
           M+FYRD+TWVLE++E+E+AK +ISGSLQ LV +SCK+YK+K NP+HVYA + SCWK KPY
Sbjct: 1   MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY 60

Query: 61  LEKVMKRSGILDDIPNKKGKPQFERXXXXXXXXXXXXSKSKRIQMGKHPIKTYILKYKTR 120
           LEKVMK+SGILD+IP +KGKP + R            SK+KRIQMGK PIKTY+LK+K+R
Sbjct: 61  LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR 120

Query: 121 LHSEXXXXXXXXXXRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKF 180
           LHSE          ++LSEL+ + +S +D+TPVRWIRINP+R      +E    E+ KKF
Sbjct: 121 LHSELVKLKLKLKVKNLSELVSNADSENDMTPVRWIRINPLRCD----VEATKLEIQKKF 176

Query: 181 PTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNP 240
           PTRV +WSDIVPG+IY+D+YIPNLFG+H +DKITSH LYK GK+IIQDRASCFPAHIL+P
Sbjct: 177 PTRVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHP 236

Query: 241 GKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSN 300
            +ND+VID CAAPGNKTTHTASY++  P KD   QIYAFEK+PERAKIL  MIKVAGCS 
Sbjct: 237 DENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSK 296

Query: 301 TIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQDD 360
            I++NVGDFTKIA PEK+++VTGFIVDPSCSGSGIFGRK++DS+N+KK      +  + D
Sbjct: 297 NIKINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNKDEADKKEGD 356

Query: 361 EDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEG 420
           E+    +++EE++ KR+DLKTRLSKL+SFQFQVVKHAMSFP AKKIVYSTCSIHAEENE 
Sbjct: 357 EEEEVPDEQEEYN-KREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENER 415

Query: 421 VVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDE--DEKCQELADGCIRV 478
           VVIDL+LD KV++WGWKVAPRS+VIPTWPRRG   EF +VFR++    KC+ELA GCIR 
Sbjct: 416 VVIDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRA 475

Query: 479 LPKEDGGIGFFAVCFER 495
           LP+ DGGIGFFAVCFER
Sbjct: 476 LPRSDGGIGFFAVCFER 492

>TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.286
           YNL022C
          Length = 484

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/495 (64%), Positives = 390/495 (78%), Gaps = 11/495 (2%)

Query: 1   MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY 60
           M+FYRD+TWVLEY+E+E+ K ++SGS+Q LVLKSC++YK+KS+P+H+YA V SCW+ K  
Sbjct: 1   MNFYRDATWVLEYVEQEDEKGRLSGSMQTLVLKSCQRYKLKSDPKHLYAVVDSCWRYKAL 60

Query: 61  LEKVMKRSGILDDIPNKKGKPQFERXXXXXXXXXXXXSKSKRIQMGKHPIKTYILKYKTR 120
           LEK+MKRS I DDIP KKGKP + R            SK KRIQMGK PIK Y+LK+KTR
Sbjct: 61  LEKIMKRSKIYDDIPKKKGKPIYSRLTLLLMCHDLLISKQKRIQMGKLPIKEYVLKHKTR 120

Query: 121 LHSEXXXXXXXXXXRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKF 180
           L+SE          + LSE+++ E+S++D+TPVRWIRINP+R   +  +EP++ EL KKF
Sbjct: 121 LNSELVKLKLKLKVKSLSEIVDKEDSSNDVTPVRWIRINPLRCPKN-DVEPVLKELIKKF 179

Query: 181 PTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNP 240
           P RV+HWSDI  GT+Y+D+++PNLFGVH +DKITSHELY+ GK+IIQDR+SCFPAHILNP
Sbjct: 180 PQRVSHWSDITSGTLYYDEFVPNLFGVHPRDKITSHELYRQGKIIIQDRSSCFPAHILNP 239

Query: 241 GKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSN 300
           GKND+VIDACAAPGNKTTH A++IL    ++QT +IYAFEKDP RA IL+ M  VAGC  
Sbjct: 240 GKNDVVIDACAAPGNKTTHVAAHILPEYTREQTPKIYAFEKDPARANILKKMTSVAGCGQ 299

Query: 301 TIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQDD 360
           T++++VGDFTK+A P  F++VTG IVDPSCSGSGIFGRK VDS N  K+++  D+     
Sbjct: 300 TVEIHVGDFTKLAVPANFKDVTGLIVDPSCSGSGIFGRKSVDSHNVAKKKTETDS----- 354

Query: 361 EDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEG 420
              +PDE+E+   +  DD+  RLSKLASFQFQVVKHAMS P AKKIVYSTCSIHAEENE 
Sbjct: 355 --EIPDEEEK---MVGDDVANRLSKLASFQFQVVKHAMSMPNAKKIVYSTCSIHAEENER 409

Query: 421 VVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDEDEKCQELADGCIRVLP 480
           VVIDLLLD+ ++EWGWKVA R EVIP WPRRG   EF +VFRD+  KC ELADGCIR LP
Sbjct: 410 VVIDLLLDRNIKEWGWKVASREEVIPKWPRRGKVKEFEQVFRDDPVKCNELADGCIRALP 469

Query: 481 KEDGGIGFFAVCFER 495
           +EDGGIGFFAVCF+R
Sbjct: 470 QEDGGIGFFAVCFKR 484

>KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {ON}
           Anc_2.286 YNL022C
          Length = 498

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/500 (64%), Positives = 394/500 (78%), Gaps = 7/500 (1%)

Query: 1   MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY 60
           MDFYRD+TWVLE +E ++AK K+SGSLQ LVL SCK++KVK+NP+H+YA VSSCW+ KP+
Sbjct: 1   MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF 60

Query: 61  LEKVMKRSGILDDIPNKKGKPQFERXXXXXXXXXXXXSKSKRIQMGKHPIKTYILKYKTR 120
           LEKVMK+S ILD++P KKG P F+R            SKSKRIQMGKHPIK ++LKYKTR
Sbjct: 61  LEKVMKKSKILDEVPQKKGAPVFQRLTLLLLCHDLLLSKSKRIQMGKHPIKMFVLKYKTR 120

Query: 121 LHSEXXXXXXXXXXRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKF 180
           L++E          +DLS+L + ++  +DITPVRW R+NP+R   +K ++ ++ EL KKF
Sbjct: 121 LNAELAKMKVKLKVKDLSQLTDSDDLTNDITPVRWFRVNPLRCTAEKPVQSVVTELRKKF 180

Query: 181 PTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNP 240
             +V+ W D+VPG+IY+D+YIPNLF VH +DKITSHELYK GK+IIQDRASCFPAHILNP
Sbjct: 181 TEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 241 GKNDIVIDACAAPGNKTTHTASYILGGPKKDQ--TTQIYAFEKDPERAKILQHMIKVAGC 298
             +DIVIDACAAPGNKTTH A+++      D+    QIYAFEKDPERA++L  MIK+AGC
Sbjct: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300

Query: 299 SNTIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQ 358
           S  I+V VGDFTK+ATP+   NV G IVDPSCSGSGIFGRKY+DSIN KK +       +
Sbjct: 301 SKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDEEK-EEEE 359

Query: 359 DDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEEN 418
            + DAVP+EQEE+     D+LKTRLSKL+SFQFQ+VK+A+SFP+A K+VYSTCSIHAEEN
Sbjct: 360 RELDAVPEEQEEQ--ELDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEEN 417

Query: 419 EGVVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDEDEK--CQELADGCI 476
           E VVIDLLLDKKV+E GW+VAPRS+VIPTW RRG   EF +VFR++ E   CQE+ADGCI
Sbjct: 418 ERVVIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCI 477

Query: 477 RVLPKEDGGIGFFAVCFERN 496
           R LP+EDGGIGFFAVCFER 
Sbjct: 478 RALPREDGGIGFFAVCFERT 497

>CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa]
           {ON} similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022c
          Length = 492

 Score =  657 bits (1696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/502 (63%), Positives = 390/502 (77%), Gaps = 16/502 (3%)

Query: 1   MDFYRDSTWVLEYLEKENAKD-KISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKP 59
           M+FYRDSTWVLEYLE +  K  ++SGSLQ +VL+ CK+Y++K+NP+H+YA VSSCWK KP
Sbjct: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60

Query: 60  YLEKVMKRSGILDDIPNKKGKPQFERXXXXXXXXXXXXSKSKRIQMGKHPIKTYILKYKT 119
           YL+K+MK+SG+LD IP KKGKP F +            SK+KRIQMGKHPIK Y+LKYK 
Sbjct: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKLTLLLLCHDLLLSKAKRIQMGKHPIKNYVLKYKN 120

Query: 120 RLHSEXXXXXXXXXXRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKK 179
            L++E           DLS++++ +++ DD+TPVRWIRINP+R   +   + ++NEL KK
Sbjct: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRIS-NHDTDQVLNELKKK 179

Query: 180 FPTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILN 239
           FPTRVN W DI+PG+IY+D++IPNL+G+H  DKITSHELYK GK+IIQDRASCFPAHILN
Sbjct: 180 FPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILN 239

Query: 240 PGKNDIVIDACAAPGNKTTHTASYILGGPK--KDQTTQIYAFEKDPERAKILQHMIKVAG 297
           P  +D+VIDAC+APGNKTTH A++I G P+  ++   QIYAFEKDPERA+ILQ MIK AG
Sbjct: 240 PSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAG 299

Query: 298 CSNTIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGN 357
           C   I VNVGDFT+IATP K+ +VTGFI+DPSCSGSGIFGRK VD +N         N  
Sbjct: 300 CHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILN---------NHG 350

Query: 358 QDDEDAVPDEQ--EEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHA 415
           +   D VPDE   EE  D K + LK RLSKLASFQFQ+V+HAMSFP AKKIVYSTCSIHA
Sbjct: 351 KKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHA 410

Query: 416 EENEGVVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDEDEK-CQELADG 474
           EENE VVIDLLLDKKVQ WGW+VA +  V+PTW RRGF+ EF +VF D+ E+ CQELADG
Sbjct: 411 EENERVVIDLLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADG 470

Query: 475 CIRVLPKEDGGIGFFAVCFERN 496
           C+R LPKEDGGIGFFAVCF R+
Sbjct: 471 CVRALPKEDGGIGFFAVCFVRD 492

>TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON}
           Anc_2.286 YNL022C
          Length = 508

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/508 (64%), Positives = 390/508 (76%), Gaps = 13/508 (2%)

Query: 1   MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY 60
           M+FYRD+TWVLE+LE ++ K ++SGSL  LV+KSCK++K++SNP+HVYA V S WK KP+
Sbjct: 1   MNFYRDATWVLEHLEAQDKKGRVSGSLLSLVVKSCKQFKIQSNPKHVYAVVESAWKFKPF 60

Query: 61  LEKVMKRSGILDDIPNKKGKPQFERXXXXXXXXXXXXSKSKRIQMGKHPIKTYILKYKTR 120
           +E++M +SGILDDIP KKGKP ++R            SKS+RIQMGKHPIKT++L YKTR
Sbjct: 61  IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR 120

Query: 121 LHSEXXXXXXXXXXRDLSELIE-DENSND---DITPVRWIRINPIRAQYDKGLEPIMNEL 176
           LHSE           +L+++I  + NSND   DITPVRWIRINPIR    K  + I+ EL
Sbjct: 121 LHSELVKLKLKLKVTNLNDMINANSNSNDSTDDITPVRWIRINPIRIPKQKSSDDIILEL 180

Query: 177 NKKFPTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAH 236
            KKF T+V+HWS I PG IY+D+YIPNLFG+   DKITSHELYK GK+IIQDRASCFPAH
Sbjct: 181 RKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAH 240

Query: 237 ILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTT----QIYAFEKDPERAKILQHM 292
           ILN   +D +IDACAAPGNKTTH ASYI+             +++AFEKDPER+KIL  M
Sbjct: 241 ILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKM 300

Query: 293 IKVAGCSNTIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSI--NKKKQE 350
           +K+AGC   +++N GDFTKIATPEK+ NVTGFIVDPSCSGSGIFGRK++D+I  NKK  E
Sbjct: 301 VKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLTE 360

Query: 351 SSGDNGNQDDEDAVPDEQEEEFDLK-RDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYS 409
              D G +DDE  +P EQE   + K +DDL+TRLSKL+SFQFQVVKHAMSFP AKKIVYS
Sbjct: 361 KVKDEG-EDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYS 419

Query: 410 TCSIHAEENEGVVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFR-DEDEKC 468
           TCSIHAEENE VVIDLLLDKKV+EWGWKV PRS  IPTW RRG  +EF  VF+ D     
Sbjct: 420 TCSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMDP 479

Query: 469 QELADGCIRVLPKEDGGIGFFAVCFERN 496
           ++LA+GCIR LPKEDGGIGFFAVCFERN
Sbjct: 480 KQLAEGCIRTLPKEDGGIGFFAVCFERN 507

>KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {ON}
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 491

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/500 (63%), Positives = 387/500 (77%), Gaps = 13/500 (2%)

Query: 1   MDFYRDSTWVLEYLEKENAKDK-ISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKP 59
           M+FYRD+TWVLE++E+E +KDK ++GSLQ LVL SCK+YK+K+NPRH+YA VSS W+ + 
Sbjct: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60

Query: 60  YLEKVMKRSGILDDIPNKKGKPQFERXXXXXXXXXXXXSKSKRIQMGKHPIKTYILKYKT 119
           YL+K++K+SGIL+D+P KKGKP F +            SKSKRIQMGKHPIKT+ILK++T
Sbjct: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120

Query: 120 RLHSEXXXXXXXXXXRDLSELIEDENSNDDITPVRWIRINPI--RAQYDKGLEPIMNELN 177
           RL +E            LS+LI+ ++  +D+TPVRWIRINPI  + +YD     ++ ELN
Sbjct: 121 RLKAELTKLKVKLKVTSLSQLIKTDD-GEDVTPVRWIRINPILVKERYDD----VLAELN 175

Query: 178 KKFPTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHI 237
           KKFP RVN W  IVPG+IY+D+YIPNLFG+H  DKITSHE YK GK+IIQDRASCFPAHI
Sbjct: 176 KKFPQRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHI 235

Query: 238 LNPGKNDIVIDACAAPGNKTTHTASYILGG-PKKDQTTQIYAFEKDPERAKILQHMIKVA 296
           LNP   D+VIDACAAPGNKTTH A++I G    K  + +I+AFEKDPERAK LQ M+  A
Sbjct: 236 LNPNSTDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATA 295

Query: 297 GCSNTIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNG 356
           GC+  ++++VGDFTK+  PE F+NVTGFIVDPSCSGSGIFGRK +D +N  K  SS  N 
Sbjct: 296 GCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSS--NT 353

Query: 357 NQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAE 416
           ++D     P EQE+E   K  DLK RL+KL+SFQ+Q+VKHAMSFP AKKI YSTCSIHAE
Sbjct: 354 DEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAE 413

Query: 417 ENEGVVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDEDEKCQELADGCI 476
           ENE VVIDLLLD KV+EWGWKV  R+ VIPTWPRRG+ +EF +VF  E+ K  ELA+GCI
Sbjct: 414 ENERVVIDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVFPKEEAK--ELAEGCI 471

Query: 477 RVLPKEDGGIGFFAVCFERN 496
           R LPKEDGGIGFFAVCFER+
Sbjct: 472 RALPKEDGGIGFFAVCFERD 491

>SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P53972 Saccharomyces
           cerevisiae YNL022C
          Length = 477

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/496 (61%), Positives = 387/496 (78%), Gaps = 19/496 (3%)

Query: 1   MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY 60
           M+ YRD+TWV EY+E+E +K KI+GSLQ LVL SCK+YK+K+NP+H+YA V SCWK KP+
Sbjct: 1   MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF 60

Query: 61  LEKVMKRSGILDDIPNKKGKPQFERXXXXXXXXXXXXSKSKRIQMGKHPIKTYILKYKTR 120
           LEK++K+SGIL DIP KKG+P F              SK+KRIQMGKHPIK ++LK+K R
Sbjct: 61  LEKILKKSGILKDIPKKKGQPAFSNTTILLLVHDLLLSKNKRIQMGKHPIKEFVLKHKVR 120

Query: 121 LHSEXXXXXXXXXXRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKF 180
           L +E           +LS+L++D++  +D+TPVRWIRINP+R   +  ++ +  EL KKF
Sbjct: 121 LQAELAKLKVKLRVTNLSQLVKDDS--NDMTPVRWIRINPVRC--NGKVDDVKGELQKKF 176

Query: 181 PTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNP 240
           PT+V++WS+IVPGTIYHD++IPNLFGVH  DKITSHELYK GK+IIQDRASCFPAHILNP
Sbjct: 177 PTKVSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNP 236

Query: 241 GKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSN 300
              D++ID+C+APGNKTTH A+++       +  QI+AFEKDPERAK LQ MI+VAGC  
Sbjct: 237 TPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDK 296

Query: 301 TIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQDD 360
           +I+V+VGDFTK+A P+KF  VTGFIVDPSCSGSGIFGRK +D  N K             
Sbjct: 297 SIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNK------------- 343

Query: 361 EDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEG 420
            + +P+E++E+ ++ + DLKTRL+KL+SFQFQ++KHAMSFP AKK+VYSTCSIHAEENE 
Sbjct: 344 NEVLPEEEQEKEEMDQ-DLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENER 402

Query: 421 VVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDEDEKCQELADGCIRVLP 480
           VVIDLLLD KVQ+WGW+V  R+ VIPTW RRGF  EF +V++D+ ++ QELADGCIR LP
Sbjct: 403 VVIDLLLDDKVQQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQDK-QQAQELADGCIRALP 461

Query: 481 KEDGGIGFFAVCFERN 496
           KEDGGIGFFAVCFER+
Sbjct: 462 KEDGGIGFFAVCFERD 477

>ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} similar
           to uniprot|P53972 Saccharomyces cerevisiae YNL022C
          Length = 465

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/497 (59%), Positives = 369/497 (74%), Gaps = 34/497 (6%)

Query: 1   MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY 60
           MDFYRDSTW+LEYLE E  K K+SGSLQ  VLK+C KYKVK+NP+H+YA V+SCWK + Y
Sbjct: 1   MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY 60

Query: 61  LEKVMKRSGILDDIPNKKGKPQFERXXXXXXXXXXXXSKSKRIQMGKHPIKTYILKYKTR 120
           LE++M +SGIL  IP KKGKP F R            SK KRIQMGKHPIK Y+LKYKTR
Sbjct: 61  LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR 120

Query: 121 LHSEXXXXXXXXXXRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKF 180
           LH+E          ++LSEL+ D++  DD TPVRWIRINP++      +  ++ +LNKKF
Sbjct: 121 LHAELVKLKVKLKVKELSELV-DQDDGDDATPVRWIRINPLKCD----IPVVVEQLNKKF 175

Query: 181 PTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNP 240
           P RV+HW  + PG+IY+D+Y+PNLFG+H  +KITSH+LYK GKVIIQDRASC PAHILNP
Sbjct: 176 PHRVDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNP 235

Query: 241 GKNDIVIDACAAPGNKTTHTASYIL--GGPKKDQTTQIYAFEKDPERAKILQHMIKVAGC 298
           GK D+V+DACAAPGNKTTH A++I+   G       QI+AFEK+P RAK+LQ M   AGC
Sbjct: 236 GKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGC 295

Query: 299 SNTIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQ 358
            + ++++VGDFT++A P++F +VT  +VDPSCSGSGIFGRK ++S N             
Sbjct: 296 GSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSN------------- 342

Query: 359 DDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEEN 418
                  D Q+++       L+ RLSKL+SFQFQVVKHAMS P A+KIVYSTCS+HAEEN
Sbjct: 343 -------DSQDQK-------LQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEEN 388

Query: 419 EGVVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDEDEKCQELADGCIRV 478
           E VVIDLLLD KV+EWGW+++PRSEV+PTWPRRG   EF +VFRD+  KCQ LA+ CIR 
Sbjct: 389 ERVVIDLLLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDKPKCQLLAESCIRA 448

Query: 479 LPKEDGGIGFFAVCFER 495
           LP+EDGGIGFFAVCF+R
Sbjct: 449 LPREDGGIGFFAVCFQR 465

>Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {ON}
           YNL022C - Non-essential protein with similarity to S.
           pombe hypothetical protein E349594 [contig 27] FULL
          Length = 479

 Score =  620 bits (1598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/496 (60%), Positives = 374/496 (75%), Gaps = 17/496 (3%)

Query: 1   MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY 60
           M+FYRD+TWVLEY+EK  +  +++GSLQ LVL SCKKY +K+NP+H+YAAV SCW+   +
Sbjct: 1   MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNEF 60

Query: 61  LEKVMKRSGILDDIPNKKGKPQFERXXXXXXXXXXXXSKSKRIQMGKHPIKTYILKYKTR 120
           LEK++K+S IL D+P KKGK  F              +K+KRIQMGKHP+K ++LK+KTR
Sbjct: 61  LEKLLKKSEILKDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR 120

Query: 121 LHSEXXXXXXXXXXRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKF 180
           L+SE           DL +L++D+   +D+TPVRW RINP+R       E +M EL KKF
Sbjct: 121 LNSELVRLKIKLKVTDLHQLLKDDR--NDMTPVRWFRINPVRCHGKH--EEVMAELAKKF 176

Query: 181 PTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNP 240
           PTRV+ W D+VPG+IYHD+YIPNLFGVH  DKITSHELYKTGK+IIQDRASCFPAHILNP
Sbjct: 177 PTRVDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNP 236

Query: 241 GKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSN 300
             +D++IDACAAPGNKTTH A+++     + Q   I+AFEKDPERAK L+ M+K AGCS 
Sbjct: 237 SPSDVIIDACAAPGNKTTHVAAHMFLN-DQPQEPLIHAFEKDPERAKTLRTMVKTAGCSK 295

Query: 301 TIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQDD 360
            I ++VGDFTK+A P  F NV+GFIVDPSCSGSGIFGR+ +D  NK ++E          
Sbjct: 296 GINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSREEG--------- 346

Query: 361 EDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEG 420
             A+P ++EE  +++  D+K RL+KLASFQF++VK+A+SFP AKK+VYSTCSIHAEENE 
Sbjct: 347 --ALPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENER 404

Query: 421 VVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDEDEKCQELADGCIRVLP 480
           +VIDLLLD KV+EWGW+V  R+  IPTWPRRGF  EF  VFR+ D   +ELA+ CIRV P
Sbjct: 405 IVIDLLLDSKVKEWGWRVRKRAGAIPTWPRRGFYHEFEDVFREGD-TAKELAEACIRVAP 463

Query: 481 KEDGGIGFFAVCFERN 496
           KEDGGIGFFAVCFER+
Sbjct: 464 KEDGGIGFFAVCFERD 479

>KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 529

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/496 (60%), Positives = 371/496 (74%), Gaps = 13/496 (2%)

Query: 1   MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY 60
           M+FYRD+TWVLEY+E      +++GSLQ LVL SCKKY++K+NP+H+YAAV SCW+   +
Sbjct: 47  MNFYRDATWVLEYVESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEF 106

Query: 61  LEKVMKRSGILDDIPNKKGKPQFERXXXXXXXXXXXXSKSKRIQMGKHPIKTYILKYKTR 120
           L+K++KRSGIL DIP KKGK  F              SK+KRIQMGKHP+K ++LKYK R
Sbjct: 107 LDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKAR 166

Query: 121 LHSEXXXXXXXXXXRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKF 180
           L SE           DL +L++D+   +D+TPVRW R+NPIR       E I+ EL+KKF
Sbjct: 167 LSSELVRLKIKLKVTDLQQLLKDDR--NDMTPVRWFRLNPIRCGAKS--EDILQELSKKF 222

Query: 181 PTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNP 240
           PTRVN W++I PG IYHD+YIP LFGVH  DKITSHELYKTGKVIIQDRASCFPAHILN 
Sbjct: 223 PTRVNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNA 282

Query: 241 GKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSN 300
              D++IDACAAPGNKTTH A++I    +  ++ +I+AFEKDPERAK L+ MI  AGC+ 
Sbjct: 283 SSEDLIIDACAAPGNKTTHVAAHIFQD-QAVESVRIHAFEKDPERAKTLRTMINTAGCTK 341

Query: 301 TIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQDD 360
            I+V+VGDFT++A P KF +VTGFI+DPSCSGSGIFGRK +D  NK K + +     +  
Sbjct: 342 GIEVHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSKADGASPVEEE-- 399

Query: 361 EDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEG 420
                +++EE  D+   DLK RL KLASFQF++VKHAMSFP AKK+VYSTCS+HAEENE 
Sbjct: 400 -----EKEEEREDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENER 454

Query: 421 VVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDEDEKCQELADGCIRVLP 480
           +V+DLLLD KV+EWGW+V  R+ VIPTW RRGF  EF +VFRDED   +ELA+ CIRV P
Sbjct: 455 IVVDLLLDSKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRDEDT-AKELAEACIRVAP 513

Query: 481 KEDGGIGFFAVCFERN 496
           KEDGGIGFFAVCFER+
Sbjct: 514 KEDGGIGFFAVCFERD 529

>ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL022C
          Length = 484

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/498 (59%), Positives = 371/498 (74%), Gaps = 16/498 (3%)

Query: 1   MDFYRDSTWVLEYLEKENA-KDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKP 59
           M+FYRD++WVLEY+E+E A K K++GSL  LVL+S KKYK+KS+ RHVYA V+S WK K 
Sbjct: 1   MEFYRDASWVLEYIEQEFARKSKVAGSLHSLVLQSHKKYKLKSDVRHVYAIVASFWKYKA 60

Query: 60  YLEKVMKRSGILDDIPNKKGKPQFERXXXXXXXXXXXXSKSKRIQMGKHPIKTYILKYKT 119
           YL++++++SG+L D+P KKG+P F+R            SK KRI MGKHP+K ++LK++T
Sbjct: 61  YLDRIIEKSGLLKDVPRKKGEPAFKRSTLGLVVHDLLLSKKKRIHMGKHPLKAFVLKHQT 120

Query: 120 RLHSEXXXXXXXXXXRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKK 179
           RL  E           DLS L++DE   +D TPVRWIR+NP R +  +  E ++ EL KK
Sbjct: 121 RLRGEYAKQLVKLGVADLSVLVQDER--EDATPVRWIRLNPFRIRGQR--EEVLQELQKK 176

Query: 180 FPTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILN 239
           FP RV  W ++ PG+IY D+Y+  L+GVH  DKITSHELYK GK+IIQDRASCFPA IL 
Sbjct: 177 FPRRVADWRELTPGSIYEDEYVAGLYGVHPADKITSHELYKRGKIIIQDRASCFPAQILA 236

Query: 240 PGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCS 299
           PG++D++IDACAAPGNKTTH A++I      D   QI+AFE+DP+RAK L+ MI  AGC 
Sbjct: 237 PGRSDVIIDACAAPGNKTTHVAAHIFPEGGADHA-QIHAFERDPQRAKTLRKMIATAGCD 295

Query: 300 NTIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQD 359
           N I+V+VGDFT+ A PE F+NVTGFIVDPSCSGSGIFGR+ VD+  + ++      G + 
Sbjct: 296 NAIEVHVGDFTRDAQPEIFKNVTGFIVDPSCSGSGIFGRQLVDATQETQK------GTET 349

Query: 360 DEDA-VPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEEN 418
           D  A VP+E+  E      +LK RL+KL+SFQFQ+VKHAMSFP AKK++YSTCS+HAEEN
Sbjct: 350 DPSADVPEEETFEATKSAVELKNRLAKLSSFQFQIVKHAMSFPSAKKLIYSTCSVHAEEN 409

Query: 419 EGVVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDEDEKCQELADGCIRV 478
           E VVIDLLLD KVQ+ GWKVA RS+VIP WPRRG QAEF +VF D+ E   ELA GCIRV
Sbjct: 410 ERVVIDLLLDSKVQKGGWKVASRSKVIPAWPRRGHQAEFEEVFPDQAE---ELAGGCIRV 466

Query: 479 LPKEDGGIGFFAVCFERN 496
           LPKEDGGIGFFAVCFER 
Sbjct: 467 LPKEDGGIGFFAVCFERE 484

>Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar to
           Ashbya gossypii ADL215W
          Length = 496

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/497 (59%), Positives = 375/497 (75%), Gaps = 17/497 (3%)

Query: 1   MDFYRDSTWVLEYLEKENAKD-KISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKP 59
           M+FYRDS+WVLEY+E+E +K+ +ISGSLQ LVL+SCK+YK+K+NP+H+YA VSSCWK K 
Sbjct: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73

Query: 60  YLEKVMKRSGILDDIPNKKGKPQFERXXXXXXXXXXXXSKSKRIQMGKHPIKTYILKYKT 119
           YLEK++K SG+L D+P KKG+P F +            SK+KRI MGKHPIK ++LK + 
Sbjct: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133

Query: 120 RLHSEXXXXXXXXXXRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKK 179
           RL  E          + LSEL+ED ++  D++PVRWIRINP R Q    ++ ++ EL KK
Sbjct: 134 RLSGEFKKMLVKLKVKSLSELVEDNDA--DMSPVRWIRINPFRCQ--GKVDDVLKELRKK 189

Query: 180 FPTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILN 239
           FP +V+ W+ IVPG+IY D+YIPNL+GVH  DKITSHELYK GK+IIQDRASCFPA+ILN
Sbjct: 190 FPKQVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILN 249

Query: 240 PGKNDIVIDACAAPGNKTTHTASYIL-GGPKKDQTTQIYAFEKDPERAKILQHMIKVAGC 298
           P  +D+VIDAC+APGNKTTH A++I   G   D   +IYAFE+D +RA+IL+ M+  AGC
Sbjct: 250 PTPHDVVIDACSAPGNKTTHIAAHIFPDGNASD--VKIYAFERDAKRAEILEKMVTSAGC 307

Query: 299 SNTIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQ 358
            + IQ++VGDFT++A P+ F++VTGFI+DPSCSGSGIFGR+ VD  NK K      N   
Sbjct: 308 ESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAEKVPNEVF 367

Query: 359 DDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEEN 418
           +++D    EQ E +       KTRL+KL+SFQFQ+VKHAMSFP AKK+VYSTCSIHAEEN
Sbjct: 368 EEQDPKEMEQNELY-------KTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEEN 420

Query: 419 EGVVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDEDEKCQELADGCIRV 478
           E VVIDLLLD+ ++++GWKVA R  VIP W RRG  +EF +VF    E+ QELADGCIR 
Sbjct: 421 ERVVIDLLLDQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVF--PHEQAQELADGCIRA 478

Query: 479 LPKEDGGIGFFAVCFER 495
           LPKEDGGIGFFAVCFER
Sbjct: 479 LPKEDGGIGFFAVCFER 495

>AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL024W
           (NCL1)
          Length = 700

 Score = 77.0 bits (188), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 77/302 (25%), Positives = 121/302 (40%), Gaps = 67/302 (22%)

Query: 222 GKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYI-LGGPKKDQTTQIYAFE 280
           G +  Q+  S  P ++L    +  V+D CAAPG+KT      +   GP  + +  + A +
Sbjct: 146 GNISRQEAVSMIPPNVLGVEPHHSVLDMCAAPGSKTAQLVEALHANGP--EPSGFVVAND 203

Query: 281 KDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATPEKFRNVTGF---IVDPSCSGSGI 335
            D  R+ +L H +K    +N I VN     F +I T E  ++   F   + D  CSG G 
Sbjct: 204 ADYRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTAEGSKDFLKFDRVLCDVPCSGDGT 263

Query: 336 FGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVK 395
             +    +IN  K   +G                                L + Q  ++ 
Sbjct: 264 MRK----NINVWKDWGTGSGLG----------------------------LHTVQLNILN 291

Query: 396 HAMSFPK-AKKIVYSTCSIHAEENEGVVIDLLLDKKVQEWGWKV-----------APRSE 443
             ++  K   ++VYSTCS++  ENE VV   L     ++WG K+             RS 
Sbjct: 292 RGLTLLKNGGRLVYSTCSLNPIENEAVVAAAL-----RKWGAKIKLVNCDDQLLGLVRST 346

Query: 444 VIPTWP---------RRGFQAEFSKVFRDEDEKCQEL-ADGCIRVLPKEDGGIGFFAVCF 493
            I +WP          +G     +  F   +E+ +E   + CIRV P +    GFF   F
Sbjct: 347 GISSWPVLDKNYEEKNKGDDGTIATWFPPSEEEAKEFNLENCIRVYPHQQNTGGFFISVF 406

Query: 494 ER 495
           E+
Sbjct: 407 EK 408

>TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.171
           YBL024W
          Length = 674

 Score = 73.6 bits (179), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 80/305 (26%), Positives = 119/305 (39%), Gaps = 68/305 (22%)

Query: 221 TGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFE 280
            G +  Q+  S  P  +L    N  V+D CAAPG+KT       L   + + T  + A +
Sbjct: 143 VGNISRQEAVSMIPPILLEVESNHTVLDMCAAPGSKTAQLIE-ALHTNEDEPTGIVVAND 201

Query: 281 KDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATPEKFRNVTGF------IVDPSCSG 332
            D  R+ +L H +K    +N + VN     F +IA  E   +   F      + D  CSG
Sbjct: 202 ADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIALHENTTDSNDFLKFDRILCDVPCSG 261

Query: 333 SGIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQ 392
            G   RK V+    +   S G  G                             L + Q  
Sbjct: 262 DGTM-RKNVNVW--RDWTSQGGLG-----------------------------LHNIQLN 289

Query: 393 VVKHAMSFPKAK-KIVYSTCSIHAEENEGVVIDLLLDKKVQEWGWKV-----------AP 440
           ++   +   K K ++VYSTCS++  ENE V+   L     ++WG K+             
Sbjct: 290 ILNRGLHLLKPKGRLVYSTCSMNPIENEAVIAAAL-----RKWGSKIRVINCDEKLPGLV 344

Query: 441 RSEVIPTWP---------RRGFQAEFSKVF-RDEDEKCQELADGCIRVLPKEDGGIGFFA 490
           RS+ I +WP         ++G Q   +  F   E+EK Q     CIRV P +     FF 
Sbjct: 345 RSKGIDSWPVFNRDMEIRQKGDQGVSNTWFPPSEEEKSQFNLQNCIRVYPHQQNTGAFFI 404

Query: 491 VCFER 495
              E+
Sbjct: 405 TVIEK 409

>KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {ON}
           Anc_2.247 YNL061W
          Length = 629

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 77/298 (25%), Positives = 128/298 (42%), Gaps = 62/298 (20%)

Query: 138 SELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKFPTRVNHWSDIVPGTIYH 197
           +E +E   +N+   P+  IR N ++ +     + ++N      P  + +W+ +  G    
Sbjct: 268 AEALEFFEANEIARPI-TIRTNTLKTRRRDLAQSLVNRGVNLQP--IGNWTKV--GLQIF 322

Query: 198 DDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKT 257
           D  +P          I +   Y  G  I+Q  +S  P   L+P +N+ ++D  AAPG KT
Sbjct: 323 DSQVP----------IGATPEYLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKT 372

Query: 258 THTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATP 315
           T+ ++ +        T  ++A + +  R K L   I   GC+NTI  N    +F K+   
Sbjct: 373 TYISAMM------KNTGCVFANDANKNRTKSLIANIHRLGCTNTIVCNYDAREFPKV--- 423

Query: 316 EKFRNVTGF---IVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEF 372
                + GF   ++D  CSG+G+ G          K +S   +  + D   +P  Q++  
Sbjct: 424 -----IGGFDRILLDAPCSGTGVIG----------KDQSVKVSRTEKDFIQIPHLQKQLL 468

Query: 373 DLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEGVVIDLLLDKK 430
                     LS + S      K  +       IVYSTCS+  EE+E VV D  L K+
Sbjct: 469 ----------LSAIDSVDANSKKGGI-------IVYSTCSVAVEEDEAVV-DYALRKR 508

>ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL061W (NOP2)
          Length = 603

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 59/222 (26%), Positives = 96/222 (43%), Gaps = 57/222 (25%)

Query: 219 YKTGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYA 278
           Y  G  I+Q  +S  P   L+P +N+ ++D  AAPG KTT+ ++ +        T  ++A
Sbjct: 309 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM------KNTGCVFA 362

Query: 279 FEKDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATPEKFRNVTGF---IVDPSCSGS 333
            + +  R K L   I   GC+NTI  N    +F K+        + GF   ++D  CSG+
Sbjct: 363 NDANKARTKSLIANIHRLGCTNTIVCNYDAREFPKV--------IGGFDRILLDAPCSGT 414

Query: 334 GIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQV 393
           G+ G+     +N+ +++                                  ++   Q Q+
Sbjct: 415 GVIGKDQSVKVNRTEKD--------------------------------FMQIPHLQKQL 442

Query: 394 VKHAMSFPKAKK-----IVYSTCSIHAEENEGVVIDLLLDKK 430
           +  A+    +       IVYSTCS+  EENE VV D  L K+
Sbjct: 443 ILSAIDSVDSNSKHGGVIVYSTCSVAVEENEAVV-DYALRKR 483

>Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}
           similar to Ashbya gossypii AFR179C
          Length = 690

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 79/303 (26%), Positives = 123/303 (40%), Gaps = 67/303 (22%)

Query: 221 TGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILG-GPKKDQTTQIYAF 279
            G +  Q+  S  P  +L       V+D CAAPG+KT      +   GP  + +  + A 
Sbjct: 144 VGNISRQEAVSMIPPLLLEVEPQHTVLDMCAAPGSKTAQLIEALHAKGP--EPSGFVVAN 201

Query: 280 EKDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATPEKFRNVTGF---IVDPSCSGSG 334
           + D  R+ +L H +K    +N I VN     F +I T E  ++   F   + D  CSG G
Sbjct: 202 DADYRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTSEGSKDFLRFDRVLCDVPCSGDG 261

Query: 335 IFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVV 394
              RK ++ + K    +SG                                L + Q  ++
Sbjct: 262 TM-RKNIN-VWKDWATASG------------------------------LGLHTVQVNIL 289

Query: 395 KHAMSFPK-AKKIVYSTCSIHAEENEGVVIDLLLDKKVQEWGWKV-----------APRS 442
              ++  K   ++VYSTCS++  ENE VV   L     ++WG K+             RS
Sbjct: 290 NRGLNLLKDGGRLVYSTCSLNPIENEAVVAAAL-----RKWGDKIKLVECGDKLPGLIRS 344

Query: 443 EVIPTWP--RRGFQAEF-------SKVFRDEDEKCQEL-ADGCIRVLPKEDGGIGFFAVC 492
           + I  WP   +GF A+        +  F   DE+  +   + C+RV P +    GFF   
Sbjct: 345 QGISQWPVYDKGFNAKQRSDEGVDASWFPPTDEEISKFHLESCVRVYPHQQNTGGFFIAV 404

Query: 493 FER 495
           FE+
Sbjct: 405 FEK 407

>TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171
           YBL024W
          Length = 649

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 77/307 (25%), Positives = 121/307 (39%), Gaps = 70/307 (22%)

Query: 221 TGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFE 280
            G +  Q+  S  P  +L+   +  V+D CAAPG+KT       L     + +  + A +
Sbjct: 139 VGNISRQEAVSMLPPILLDVKPHHTVLDMCAAPGSKTAQLMES-LHIDSDEPSGFVIAND 197

Query: 281 KDPERAKILQHMIKVAGCSNTIQVN--------VGDFTKIATPEKFRNVTGFIVDPSCSG 332
            D +R+ +L H +K    SN + VN        +   TK A+ ++       + D  CSG
Sbjct: 198 ADNKRSHLLVHQLKRLSTSNVLIVNHDAQFFPNLKINTKDASSQEDLKFDRILCDVPCSG 257

Query: 333 SGIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQ 392
            G   +      N   Q + G                                L + QF 
Sbjct: 258 DGTMRKNVNVWKNWNTQNALG--------------------------------LHNVQFN 285

Query: 393 VVKHAMSFPK-AKKIVYSTCSIHAEENEGVVIDLLLDKKVQEWGWKV-----------AP 440
           ++   ++  K   K+VYSTCS++  ENE VV  +L     ++WG KV             
Sbjct: 286 ILDRGLTLLKETGKLVYSTCSLNPIENEAVVAAVL-----RKWGDKVRLVCCDDKLKGLI 340

Query: 441 RSEVIPTWPRRGFQAEFSKVFRDED---EKC-----QELA----DGCIRVLPKEDGGIGF 488
           RS+ + TWP      E     R +D   + C     +E++    D C+RV P +    GF
Sbjct: 341 RSKGLTTWPVINRDMEEVPRNRSDDKINKSCYPPTEEEVSKFNLDRCMRVYPHQQNTGGF 400

Query: 489 FAVCFER 495
           F   FE+
Sbjct: 401 FITMFEK 407

>Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON}
           (41683..43584) [1902 nt, 634 aa]
          Length = 633

 Score = 70.5 bits (171), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 60/209 (28%), Positives = 93/209 (44%), Gaps = 46/209 (22%)

Query: 219 YKTGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYA 278
           Y  G+ I+Q  +S  P   L+P +N+ V+D  AAPG KTT+ ++ +        T  ++A
Sbjct: 337 YLAGQYILQAASSFLPVVALDPQENERVLDMAAAPGGKTTYISALM------KNTGCVFA 390

Query: 279 FEKDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATPEKFRNVTGF---IVDPSCSGS 333
            + +  R K L   I   GC+NTI  N    +F K+        + GF   ++D  CSG+
Sbjct: 391 NDANKARTKSLIANIHRLGCTNTIVCNYDAREFPKV--------IGGFDRILLDAPCSGT 442

Query: 334 GIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQV 393
           G+ G          K +S   +  + D   +P  Q++            LS + S     
Sbjct: 443 GVIG----------KDQSVKSSRTEKDFIQIPHLQKQLL----------LSAIDSVDANS 482

Query: 394 VKHAMSFPKAKKIVYSTCSIHAEENEGVV 422
               +       IVYSTCS+  EE+E VV
Sbjct: 483 KTGGV-------IVYSTCSVAVEEDEAVV 504

>CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highly
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061w NOP2
          Length = 619

 Score = 70.1 bits (170), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 60/209 (28%), Positives = 94/209 (44%), Gaps = 46/209 (22%)

Query: 219 YKTGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYA 278
           Y  G  I+Q  +S  P   L+P +N+ V+D  +APG KTT+ ++ +        T  ++A
Sbjct: 325 YLAGNYILQAASSFLPVVALDPQENERVLDMASAPGGKTTYISALM------KNTGCVFA 378

Query: 279 FEKDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATPEKFRNVTGF---IVDPSCSGS 333
            + + +R K L   I   GC+NTI  N    +F K+        + GF   ++D  CSG+
Sbjct: 379 NDANKKRTKSLIANIHRLGCTNTIVCNYDAREFPKV--------IGGFDRVLLDAPCSGT 430

Query: 334 GIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQV 393
           G+ G          K +S   +  + D   +P  Q++            LS + S     
Sbjct: 431 GVIG----------KDQSVKVSRTEKDFIQIPHLQKQLL----------LSAIDSVDANS 470

Query: 394 VKHAMSFPKAKKIVYSTCSIHAEENEGVV 422
            K  +       IVYSTCS+  EE+E VV
Sbjct: 471 KKGGV-------IVYSTCSVAVEEDEAVV 492

>NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.171
           YBL024W
          Length = 686

 Score = 70.1 bits (170), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 78/304 (25%), Positives = 121/304 (39%), Gaps = 68/304 (22%)

Query: 222 GKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFEK 281
           G +  Q+  S  P  +L    +  V+D CAAPG+KT       L     + T  + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLIE-ALHKDTDEPTGFVVANDA 203

Query: 282 DPERAKILQHMIKVAGCSNTIQVN--VGDFTKI---ATPEKFRNVTGF---IVDPSCSGS 333
           D +R+ +L H +K    +N + VN     F +I      EK + +  F   + D  CSG 
Sbjct: 204 DAKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHTDAEKKKEMLKFDRILCDVPCSGD 263

Query: 334 GIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQV 393
           G   RK V+    K   + G  G                             L + Q  +
Sbjct: 264 GTM-RKNVNVW--KDWNTQGGLG-----------------------------LHTVQLNI 291

Query: 394 VKHAMSFPKAK-KIVYSTCSIHAEENEGVVIDLLLDKKVQEWGWKV-----------APR 441
           +   ++  K+  ++VYSTCS++  ENE VV + L     ++WG K+             R
Sbjct: 292 LNRGLNLLKSGGRLVYSTCSMNPIENEAVVAEAL-----RKWGSKIKLVNCDDKLVGLVR 346

Query: 442 SEVIPTWP---------RRGFQAEFSKVFRDEDEKCQEL-ADGCIRVLPKEDGGIGFFAV 491
           S+ I  WP          +G +      F   +E+ +    D CIRV P +    GFF  
Sbjct: 347 SKGISNWPVLDRNMAVKNKGDEGTIESWFPPTEEEREIFHLDSCIRVYPHQQNTGGFFIT 406

Query: 492 CFER 495
            FE+
Sbjct: 407 VFEK 410

>SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {ON}
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061W NOP2 Probable RNA m(5)C methyltransferase
           essential for processing and maturation of 27S pre-rRNA
           and large ribosomal subunit biogenesis localized to the
           nucleolus
          Length = 611

 Score = 69.7 bits (169), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 76/290 (26%), Positives = 124/290 (42%), Gaps = 61/290 (21%)

Query: 138 SELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKFPTRVNHWSDIVPGTIYH 197
           +E +E   +N+   P+  IR N ++ +     + ++N      P  +  W+ +  G    
Sbjct: 250 AEAMEFFEANEIARPI-TIRTNTLKTRRRDLAQTLVNRGVNLQP--IGSWTKV--GLQIF 304

Query: 198 DDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKT 257
           D  +P          I +   Y  G  I+Q  +S  P   L+P +N+ ++D  AAPG KT
Sbjct: 305 DSQVP----------IGATPEYLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKT 354

Query: 258 THTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATP 315
           T+ ++ +        T  ++A + +  R K L   I   GC NTI  N    +F K+   
Sbjct: 355 TYISALM------KNTGCVFANDANKARTKSLIANIHRLGCHNTIVCNYDAREFPKV--- 405

Query: 316 EKFRNVTGF---IVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEF 372
                + GF   ++D  CSG+G+ G          K +S   +  + D   +P  Q++  
Sbjct: 406 -----IGGFDRILLDAPCSGTGVIG----------KDQSVKVSRTEKDFMQIPHLQKQLI 450

Query: 373 DLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEGVV 422
                     LS + S    V  H+ +      IVYSTCS+  EENE VV
Sbjct: 451 ----------LSAIDS----VDAHSKT---GGVIVYSTCSVAVEENEAVV 483

>SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 691

 Score = 69.7 bits (169), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 74/302 (24%), Positives = 117/302 (38%), Gaps = 65/302 (21%)

Query: 221 TGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFE 280
            G +  Q+  S  P  +L    N  V+D CAAPG+KT       L   + + T  + A +
Sbjct: 144 VGNISRQEAVSMIPPIVLEVKPNHTVLDMCAAPGSKTAQLIE-ALHAQEDEPTGFVVAND 202

Query: 281 KDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIAT---PEKFRNVTGFIVDPSCSGSGI 335
            D +R+ +L H +K    +N + VN     F +I +    ++F      + D  CSG G 
Sbjct: 203 ADAKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKSQPDSKEFLKFDRVLCDVPCSGDGT 262

Query: 336 FGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVK 395
             RK V                               ++ RD        L + Q  ++ 
Sbjct: 263 M-RKNV-------------------------------NVWRDWGTASGLGLHTVQLNILN 290

Query: 396 HAMSFPK-AKKIVYSTCSIHAEENEGVVIDLLLDKKVQEWGWKV-----------APRSE 443
             ++  K   ++VYSTCS++  ENE V+   L     ++WG K+             RS+
Sbjct: 291 RGLNLLKDGGRLVYSTCSLNPIENESVIAAAL-----RKWGDKIRLVNCDEKLPGLVRSK 345

Query: 444 VIPTWP---------RRGFQAEFSKVFRDEDEKCQEL-ADGCIRVLPKEDGGIGFFAVCF 493
            I  WP          +G +      F   +E+      + CIRV P +    GFF   F
Sbjct: 346 GITQWPVYDKNFALKEKGDEGVIETWFPPTEEEATRFHLENCIRVYPHQQNTGGFFITVF 405

Query: 494 ER 495
           E+
Sbjct: 406 EK 407

>TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.247
           YNL061W
          Length = 608

 Score = 69.3 bits (168), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 92/209 (44%), Gaps = 46/209 (22%)

Query: 219 YKTGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYA 278
           Y  G+ I+Q  +S  P   L+P  N+ V+D  AAPG KTT+ ++ +        T  ++A
Sbjct: 317 YLAGQYILQAASSFLPVVALDPQLNERVLDMAAAPGGKTTYISALM------KNTGCVFA 370

Query: 279 FEKDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATPEKFRNVTGF---IVDPSCSGS 333
            + +  R K L   I   GC+NTI  N    +F K+        + GF   ++D  CSG+
Sbjct: 371 NDANKARTKSLIANIHRLGCTNTIVCNYDAREFPKV--------IGGFDRILLDAPCSGT 422

Query: 334 GIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQV 393
           G+ G          K +S   +  + D   +P  Q++      D +    SK   F    
Sbjct: 423 GVIG----------KDQSVKVSRTEKDFIQIPHLQKQLLLSAIDSVDAN-SKTGGF---- 467

Query: 394 VKHAMSFPKAKKIVYSTCSIHAEENEGVV 422
                       IVYSTCS+  EE+E VV
Sbjct: 468 ------------IVYSTCSVAVEEDEAVV 484

>KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} similar
           to uniprot|P38205 Saccharomyces cerevisiae YBL024W
          Length = 688

 Score = 69.3 bits (168), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 76/302 (25%), Positives = 118/302 (39%), Gaps = 65/302 (21%)

Query: 221 TGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFE 280
            G +  Q+  S  P  +L    +  V+D CAAPG+KT       L   + + T  + A +
Sbjct: 144 VGNISRQEAVSMIPPIVLEVESHHSVLDMCAAPGSKTAQMIE-ALHSSEDEPTGFVVAND 202

Query: 281 KDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATPEKFRNVTGF---IVDPSCSGSGI 335
            D  R+ +L H +K    +N + VN     F ++ T ++      F   + D  CSG G 
Sbjct: 203 ADARRSHMLVHQLKRLNSANLVVVNHDAQFFPRVKTDKETNQFLKFDRILCDVPCSGDGT 262

Query: 336 FGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVK 395
             RK V+ + K    +SG                                L + Q  ++K
Sbjct: 263 M-RKNVN-VWKDWGTASGLG------------------------------LHTVQLNILK 290

Query: 396 HAMS-FPKAKKIVYSTCSIHAEENEGVVIDLLLDKKVQEWGWKV-----------APRSE 443
             ++   K  ++VYSTCS++  ENE VV   L     ++WG K+             RS+
Sbjct: 291 RGLNLLKKGGRLVYSTCSMNPIENEAVVAAAL-----RQWGDKIKLVDCSDKLPGLVRSK 345

Query: 444 VIPTWP---------RRGFQAEFSKVFRDEDEKCQEL-ADGCIRVLPKEDGGIGFFAVCF 493
            I  WP          +G +      F    E+  +   D CIRV P +    GFF    
Sbjct: 346 GISNWPVIDKAFEKKEKGDEGTTESWFPPSAEEAADFHLDRCIRVYPHQQNTGGFFITVI 405

Query: 494 ER 495
           E+
Sbjct: 406 EK 407

>KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2.247
           YNL061W
          Length = 610

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 74/303 (24%), Positives = 128/303 (42%), Gaps = 72/303 (23%)

Query: 138 SELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKFPTRVNHWSDIVPGTIYH 197
           +E +E   +N+   P+  IR N ++ +     + ++N      P  + +W+ +  G    
Sbjct: 251 AEAVEFFEANEVARPI-TIRTNTLKTRRRDLAQTLVNRGVNLQP--IGNWTKV--GLQIF 305

Query: 198 DDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKT 257
           D  +P          I +   Y  G+ I+Q  +S  P   L+P +N+ ++D  +APG KT
Sbjct: 306 DSQVP----------IGATPEYLAGQYILQAASSFLPVIALDPQENERILDMASAPGGKT 355

Query: 258 THTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATP 315
           T+ ++ +        T  ++A + +  R K L   I   GC+NTI  N    +F K+   
Sbjct: 356 TYISALM------KNTGCVFANDANKNRTKSLIANIHRLGCTNTIVCNYDAREFPKV--- 406

Query: 316 EKFRNVTGF---IVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEF 372
                + GF   ++D  CSG+G+ G+                     D+       E++F
Sbjct: 407 -----IGGFDRILLDAPCSGTGVIGK---------------------DQSVKVSRTEKDF 440

Query: 373 DLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKK-----IVYSTCSIHAEENEGVVIDLLL 427
                       ++   Q Q++  A+    A       IVYSTCS+  EE+E VV D  L
Sbjct: 441 -----------IQIPHLQKQLLLSAIDSVDANSKSGGVIVYSTCSVAVEEDEAVV-DYAL 488

Query: 428 DKK 430
            K+
Sbjct: 489 RKR 491

>Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061W
           (REAL)
          Length = 618

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 78/298 (26%), Positives = 127/298 (42%), Gaps = 62/298 (20%)

Query: 138 SELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKFPTRVNHWSDIVPGTIYH 197
           +E +E   +N+   P+  IR N ++ +     + ++N      P  +  W+ +  G    
Sbjct: 256 AEAMEFFEANEIARPI-TIRTNTLKTRRRDLAQTLVNRGVNLQP--IGSWTKV--GLQIF 310

Query: 198 DDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKT 257
           D  +P          I +   Y  G  I+Q  +S  P   L+P +N+ ++D  AAPG KT
Sbjct: 311 DSQVP----------IGATPEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKT 360

Query: 258 THTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATP 315
           T+ ++ +        T  ++A + +  R K L   I   GC+NTI  N    +F K+   
Sbjct: 361 TYISAMM------KNTGCVFANDANKSRTKSLIANIHRLGCTNTIVCNYDAREFPKV--- 411

Query: 316 EKFRNVTGF---IVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEF 372
                + GF   ++D  CSG+G+ G          K +S   +  + D   +P  Q++  
Sbjct: 412 -----IGGFDRILLDAPCSGTGVIG----------KDQSVKVSRTEKDFIQIPHLQKQLL 456

Query: 373 DLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEGVVIDLLLDKK 430
                     LS + S      KH         IVYSTCS+  EE+E  VID  L K+
Sbjct: 457 ----------LSAIDSVDCN-SKHGGV------IVYSTCSVAVEEDEA-VIDYALRKR 496

>KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 619

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 77/298 (25%), Positives = 126/298 (42%), Gaps = 62/298 (20%)

Query: 138 SELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKFPTRVNHWSDIVPGTIYH 197
           +E +E   +N+   PV  IR N ++ +     + ++N      P  +  W+ +  G    
Sbjct: 253 AEAMEFFEANEIARPV-TIRTNTLKTRRRDLAQTLVNRGVNLQP--IGSWTKV--GLQIF 307

Query: 198 DDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKT 257
           D  +P          I +   Y  G  I+Q  +S  P   L+P +N+ ++D  AAPG KT
Sbjct: 308 DSQVP----------IGATPEYLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKT 357

Query: 258 THTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATP 315
           T+ ++ +        T  ++A + +  R K L   I   GC+NTI  N    +F K+   
Sbjct: 358 TYISAMM------KNTGCVFANDANKARTKSLIANIHRLGCTNTIVCNYDAREFPKV--- 408

Query: 316 EKFRNVTGF---IVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEF 372
                + GF   ++D  CSG+G+ G          K +S   +  + D   +P  Q++  
Sbjct: 409 -----IGGFDRILLDAPCSGTGVIG----------KDQSVKVSRTEKDFMQIPHLQKQLL 453

Query: 373 DLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEGVVIDLLLDKK 430
                     LS + S         +       IVYSTCS+  +ENE VV D  L K+
Sbjct: 454 ----------LSAIDSVDSNSKTGGV-------IVYSTCSVAVDENEAVV-DYALRKR 493

>TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.247
           YNL061W
          Length = 632

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 75/290 (25%), Positives = 122/290 (42%), Gaps = 61/290 (21%)

Query: 138 SELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKFPTRVNHWSDIVPGTIYH 197
           SE IE   +N+   P+  IR N ++ +     + ++N      P  +  W+ +  G    
Sbjct: 270 SEAIEFFEANEVSRPI-TIRTNTLKTRRRDLAQALVNRGVNLQP--IGAWTKV--GLQIF 324

Query: 198 DDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKT 257
           D  +P          I +   Y  G  I+Q  +S  P   L+P +N+ V+D  +APG KT
Sbjct: 325 DSQVP----------IGATPEYLAGNYILQAASSFLPVIALDPQENERVLDMASAPGGKT 374

Query: 258 THTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATP 315
           T+ ++ +        T  I+A + +  R K L   I   GC+NTI  N    +F K+   
Sbjct: 375 TYISALM------KNTGCIFANDANKARTKSLIANIHRLGCTNTIVCNYDAREFPKV--- 425

Query: 316 EKFRNVTGF---IVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEF 372
                + GF   ++D  CSG+G+ G          K +S   +  + D   +P  Q++  
Sbjct: 426 -----IGGFDRILLDAPCSGTGVIG----------KDQSVKVSRTEKDFIQIPHLQKQLI 470

Query: 373 DLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEGVV 422
                     LS + S         +       +VYSTCS+  EE+E VV
Sbjct: 471 ----------LSAIDSLDSNSKNGGV-------LVYSTCSVAVEEDEAVV 503

>TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.171
           YBL024W
          Length = 673

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 77/309 (24%), Positives = 118/309 (38%), Gaps = 75/309 (24%)

Query: 221 TGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFE 280
            G +  Q+  S  P  +L    +  V+D CAAPG+KT       L     + T  + A +
Sbjct: 142 VGNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQMIE-ALHKDTDEPTGFVVAND 200

Query: 281 KDPERAKILQHMIKVAGCSNTIQVN------------VGDFTKIATPEKFRNVTGFIVDP 328
            D +R+ +L H +K    +N + VN              D +  A   KF  V   + D 
Sbjct: 201 ADSKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKSSAADDSSKANVLKFDRV---LCDV 257

Query: 329 SCSGSGIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLAS 388
            CSG G   RK V+                               + RD        L +
Sbjct: 258 PCSGDGTM-RKNVN-------------------------------VWRDWTPQGGLGLHT 285

Query: 389 FQFQVVKHAMSFPKAK-KIVYSTCSIHAEENEGVVIDLLLDKKVQEWGWKV--------- 438
            QF ++   +   K K ++VYSTCS++  ENE VV + L     ++WG K+         
Sbjct: 286 VQFNILNRGLHLLKNKGRLVYSTCSMNPIENEAVVAEAL-----RKWGDKIRLVSCEDKL 340

Query: 439 --APRSEVIPTWP---------RRGFQAEFSKVFRDEDEKCQEL-ADGCIRVLPKEDGGI 486
               RS+ +  WP          +G +      F   +E+  +   + CIRV P +    
Sbjct: 341 PGLVRSKGVSQWPVIDRNMTPREKGDEGTHDSWFPPTEEEAAKFNLENCIRVYPHQQNTG 400

Query: 487 GFFAVCFER 495
           GFF   FE+
Sbjct: 401 GFFITVFEK 409

>NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.247
           YNL061W
          Length = 490

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 97/217 (44%), Gaps = 47/217 (21%)

Query: 219 YKTGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYA 278
           Y  G  I+Q  +S  P   L+P +N+ ++D  AAPG KTT+ ++ +        T  ++A
Sbjct: 194 YLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM------KNTGCVFA 247

Query: 279 FEKDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATPEKFRNVTGF---IVDPSCSGS 333
            + +  R K L   I   GC+NTI  N    +F K+        + GF   ++D  CSG+
Sbjct: 248 NDANKNRTKSLIANIHRLGCTNTIVCNYDAREFPKV--------IGGFDRILLDAPCSGT 299

Query: 334 GIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQV 393
           G+ G          K +S   +  + D   +P  Q++            LS + S     
Sbjct: 300 GVIG----------KDQSVKVSRTEKDFIQIPHLQKQLL----------LSAIDSVDCN- 338

Query: 394 VKHAMSFPKAKKIVYSTCSIHAEENEGVVIDLLLDKK 430
            KH         IVYSTCS+  EE+E VV D  L K+
Sbjct: 339 SKH------GGVIVYSTCSVAVEEDEAVV-DYALRKR 368

>YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Probable
           RNA m(5)C methyltransferase, essential for processing
           and maturation of 27S pre-rRNA and large ribosomal
           subunit biogenesis; localized to the nucleolus;
           constituent of 66S pre-ribosomal particles
          Length = 618

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 78/298 (26%), Positives = 127/298 (42%), Gaps = 62/298 (20%)

Query: 138 SELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKFPTRVNHWSDIVPGTIYH 197
           +E +E   +N+   P+  IR N ++ +     + ++N      P  +  W+ +  G    
Sbjct: 256 AEAMEFFEANEIARPI-TIRTNTLKTRRRDLAQTLVNRGVNLQP--IGSWTKV--GLQIF 310

Query: 198 DDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKT 257
           D  +P          I +   Y  G  I+Q  +S  P   L+P +N+ ++D  AAPG KT
Sbjct: 311 DSQVP----------IGATPEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKT 360

Query: 258 THTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATP 315
           T+ ++ +        T  ++A + +  R K L   I   GC+NTI  N    +F K+   
Sbjct: 361 TYISAMM------KNTGCVFANDANKSRTKSLIANIHRLGCTNTIVCNYDAREFPKV--- 411

Query: 316 EKFRNVTGF---IVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEF 372
                + GF   ++D  CSG+G+ G          K +S   +  + D   +P  Q++  
Sbjct: 412 -----IGGFDRILLDAPCSGTGVIG----------KDQSVKVSRTEKDFIQIPHLQKQLL 456

Query: 373 DLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEGVVIDLLLDKK 430
                     LS + S      KH         IVYSTCS+  EE+E  VID  L K+
Sbjct: 457 ----------LSAIDSVDCN-SKHGGV------IVYSTCSVAVEEDEA-VIDYALRKR 496

>Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061W
           (REAL)
          Length = 620

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 79/298 (26%), Positives = 127/298 (42%), Gaps = 62/298 (20%)

Query: 138 SELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKFPTRVNHWSDIVPGTIYH 197
           +E +E   +N+   PV  IR N ++ +     + ++N      P  +  W+ +  G    
Sbjct: 258 AEAMEFFEANEIARPV-TIRTNTLKTRRRDLAQTLVNRGVNLQP--IGSWTKV--GLQIF 312

Query: 198 DDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKT 257
           D  +P          I +   Y  G  I+Q  +S  P   L+P +N+ ++D  AAPG KT
Sbjct: 313 DSQVP----------IGATPEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKT 362

Query: 258 THTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATP 315
           T+ ++ +        T  ++A + +  R K L   I   GC+NTI  N    +F K+   
Sbjct: 363 TYISAMM------KNTGCVFANDANKSRTKSLIANIHRLGCTNTIVCNYDAREFPKV--- 413

Query: 316 EKFRNVTGF---IVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEF 372
                + GF   ++D  CSG+G+ G          K +S   +  + D   +P  Q++  
Sbjct: 414 -----IGGFDRILLDAPCSGTGVIG----------KDQSVKVSRTEKDFIQIPHLQKQLL 458

Query: 373 DLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEGVVIDLLLDKK 430
                     LS + S      KH         IVYSTCS+  EE+E VV D  L K+
Sbjct: 459 ----------LSAIDSVDCN-SKHGGV------IVYSTCSVAVEEDEAVV-DYALRKR 498

>NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.247
           YNL061W
          Length = 625

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 93/209 (44%), Gaps = 46/209 (22%)

Query: 219 YKTGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYA 278
           Y  G  I+Q  +S  P   L+P +N+ ++D  AAPG KTT+ ++ +        T  ++A
Sbjct: 329 YLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISALM------KNTGTVFA 382

Query: 279 FEKDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATPEKFRNVTGF---IVDPSCSGS 333
            + +  R K L   I   GC+NTI  N    +F K+        + GF   ++D  CSG+
Sbjct: 383 NDANKNRTKSLIANIHRLGCTNTIVCNYDAREFPKV--------IGGFDRILLDAPCSGT 434

Query: 334 GIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQV 393
           G+ G          K +S   +  + D   +P  Q++            LS + S     
Sbjct: 435 GVIG----------KDQSVKVSRTEKDFIQIPHLQKQLL----------LSAIDSVDCN- 473

Query: 394 VKHAMSFPKAKKIVYSTCSIHAEENEGVV 422
            KH         IVYSTCS+  EE+E VV
Sbjct: 474 SKH------GGIIVYSTCSVAVEEDEAVV 496

>NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {ON}
           Anc_8.171 YBL024W
          Length = 671

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 78/305 (25%), Positives = 116/305 (38%), Gaps = 68/305 (22%)

Query: 221 TGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFE 280
            G +  Q+  S  P  +L       V+D CAAPG+KT       L     + T  + A +
Sbjct: 144 VGNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIE-ALHKDTDEPTGFVVAND 202

Query: 281 KDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIAT---PEKFRNVTGF---IVDPSCSG 332
            D  R+ +L H +K    +N + VN     F +I      EK R++  F   + D  CSG
Sbjct: 203 ADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHDDAEKKRDMLKFDRILCDVPCSG 262

Query: 333 SGIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQ 392
            G   RK V+    K   + G  G                             L + Q+ 
Sbjct: 263 DGTM-RKNVNVW--KDWNAQGALG-----------------------------LHTVQWN 290

Query: 393 VVKHAMSFPKAK-KIVYSTCSIHAEENEGVVIDLLLDKKVQEWGWKV-----------AP 440
           ++   +   K   ++VYSTCS++  ENE VV   L     ++WG K+             
Sbjct: 291 ILNRGLHLLKPNGRLVYSTCSLNPIENEAVVAQAL-----RKWGNKIRLVNCDEKLPGLV 345

Query: 441 RSEVIPTWP---------RRGFQAEFSKVFRDEDEKCQEL-ADGCIRVLPKEDGGIGFFA 490
           RS+ I  WP          +  +      F   +E+      D CIRV P +    GFF 
Sbjct: 346 RSKGISQWPVLNRDLETKNKNDEGVLESWFPPSEEEASLFNLDACIRVYPHQQNTGGFFI 405

Query: 491 VCFER 495
             FE+
Sbjct: 406 TVFEK 410

>ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {ON}
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 683

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 77/305 (25%), Positives = 119/305 (39%), Gaps = 68/305 (22%)

Query: 221 TGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFE 280
            G +  Q+  S  P  +L+   +  V+D CAAPG+KT     Y L     + +  + A +
Sbjct: 141 VGNISRQEAVSMIPPTLLDVQPHHTVLDMCAAPGSKTAQMIEY-LHRDNDEPSGFVVAND 199

Query: 281 KDPERAKILQHMIKVAGCSNTIQVN--VGDFTKI-ATPEKF--RNVTGF---IVDPSCSG 332
            D +R+ +L H +K    +N I VN     F ++ A P+    +++  F   + D  CSG
Sbjct: 200 ADAKRSHMLVHQLKRLNSANLIVVNHDAQFFPRVKAHPDHTNKKDILRFDRVLCDVPCSG 259

Query: 333 SGIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQ 392
            G   RK V                               ++ RD        L + Q  
Sbjct: 260 DGTM-RKNV-------------------------------NVWRDWTTQNGLALHNVQLN 287

Query: 393 VVKHAMSFPKA-KKIVYSTCSIHAEENEGVVIDLLLDKKVQEWGWKV-----------AP 440
           ++   +   K+  ++VYSTCS++  ENE VV + L     ++WG KV             
Sbjct: 288 ILNRGLHLLKSGGRLVYSTCSMNPIENEAVVAEAL-----RKWGGKVRLVDCSDKLPGLV 342

Query: 441 RSEVIPTWP---------RRGFQAEFSKVFRDEDEKCQEL-ADGCIRVLPKEDGGIGFFA 490
           RS  I  WP          +G        F   DE+      D C+RV P +    GFF 
Sbjct: 343 RSNGINQWPVLNRNMETKEKGEDGTNDSWFPPTDEEAARFHLDYCVRVYPHQQNTGGFFI 402

Query: 491 VCFER 495
              E+
Sbjct: 403 TVLEK 407

>Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061W
           (REAL)
          Length = 619

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 93/209 (44%), Gaps = 46/209 (22%)

Query: 219 YKTGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYA 278
           Y  G  I+Q  +S  P   L+P +N+ ++D  AAPG KTT+ ++ +        T  ++A
Sbjct: 323 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM------KNTGCVFA 376

Query: 279 FEKDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATPEKFRNVTGF---IVDPSCSGS 333
            + +  R K L   I   GC+NTI  N    +F K+        + GF   ++D  CSG+
Sbjct: 377 NDANKSRTKSLIANIHRLGCTNTIVCNYDAREFPKV--------IGGFDRILLDAPCSGT 428

Query: 334 GIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQV 393
           G+ G          K +S   +  + D   +P  Q++            LS + S     
Sbjct: 429 GVIG----------KDQSVKVSRTEKDFIQIPHLQKQLL----------LSAIDSVDCN- 467

Query: 394 VKHAMSFPKAKKIVYSTCSIHAEENEGVV 422
            KH         IVYSTCS+  EE+E VV
Sbjct: 468 SKHGGV------IVYSTCSVAVEEDEAVV 490

>Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W
           (NOP2) - 90-kDa protein, located in nucleolus, that is
           homologous to a human proliferation-associated nucleolar
           protein, p120 [contig 5] FULL
          Length = 627

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 95/222 (42%), Gaps = 57/222 (25%)

Query: 219 YKTGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYA 278
           Y  G  I+Q  +S  P   L+P +N+ ++D  AAPG KTT+ ++ +        T  ++A
Sbjct: 331 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM------KNTGCVFA 384

Query: 279 FEKDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATPEKFRNVTGF---IVDPSCSGS 333
            + +  R K L   I   GC+NTI  N    +F K+        + GF   ++D  CSG+
Sbjct: 385 NDANKARTKSLIANIHRLGCTNTIVCNYDAREFPKV--------IGGFDRILLDAPCSGT 436

Query: 334 GIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQV 393
           G+  +                     D+       E++F            ++   Q Q+
Sbjct: 437 GVIAK---------------------DQSVKVSRTEKDF-----------IQIPHLQKQL 464

Query: 394 VKHAMSFPKAKK-----IVYSTCSIHAEENEGVVIDLLLDKK 430
           +  A+    A       IVYSTCS+  EENE  VID  L K+
Sbjct: 465 LLSAIDSVDANSKTGGVIVYSTCSVAVEENEA-VIDYALRKR 505

>Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii ADL254W
          Length = 606

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 57/214 (26%), Positives = 91/214 (42%), Gaps = 56/214 (26%)

Query: 219 YKTGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYA 278
           Y  G  I+Q  +S  P   L+P +N+ ++D  AAPG KTT+ ++ +        T  ++A
Sbjct: 311 YLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALM------KNTGCVFA 364

Query: 279 FEKDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATPEKFRNVTGF---IVDPSCSGS 333
            + +  R K L   I   GC+NTI  N    +F K+        + GF   ++D  CSG+
Sbjct: 365 NDANKARTKSLIANIHRLGCTNTIVCNYDAREFPKV--------IGGFDRILLDAPCSGT 416

Query: 334 GIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQV 393
           G+  +                     D+       E++F            ++   Q Q+
Sbjct: 417 GVIAK---------------------DQSVKVSRTEKDF-----------MQIPHLQKQL 444

Query: 394 VKHAMSFPKAKK-----IVYSTCSIHAEENEGVV 422
           +  A+    +       IVYSTCS+  EENE VV
Sbjct: 445 ILSAIDSVDSNSKTGGIIVYSTCSVAVEENEAVV 478

>ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 617

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 61/207 (29%), Positives = 93/207 (44%), Gaps = 42/207 (20%)

Query: 219 YKTGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYA 278
           Y  G  I+Q  +S  P   L+P +N+ ++D  AAPG KTT+ ++ +        T  ++A
Sbjct: 323 YLAGNYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALM------KNTGCVFA 376

Query: 279 FEKDPERAKILQHMIKVAGCSNTIQVNVGDFTKIATPEKFRNVTGF---IVDPSCSGSGI 335
            + +  R K L   I   GC+NTI  N          E  R + GF   ++D  CSG+G+
Sbjct: 377 NDANKSRTKSLVANIHRLGCTNTIVCNYD------AREFPRVIGGFDRILLDAPCSGTGV 430

Query: 336 FGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVK 395
            G          K +S   +  + D   +P  Q++            LS + S    V  
Sbjct: 431 IG----------KDQSVKVSRTEKDFMQIPHLQKQLL----------LSAIDS----VDS 466

Query: 396 HAMSFPKAKKIVYSTCSIHAEENEGVV 422
           H+ +      IVYSTCS+  EE+E VV
Sbjct: 467 HSKT---GGIIVYSTCSVAVEEDEQVV 490

>KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.171
           YBL024W
          Length = 682

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 78/305 (25%), Positives = 117/305 (38%), Gaps = 68/305 (22%)

Query: 221 TGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFE 280
            G +  Q+  S  P  +L       V+D CAAPG+KT       L     + T  + A +
Sbjct: 144 VGNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLLE-ALHRDTDEPTGFVVAND 202

Query: 281 KDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATP---EKFRNVTGF---IVDPSCSG 332
            D  R+ +L H +K    +N I VN     F +I T    EK  ++  F   + D  CSG
Sbjct: 203 ADNRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTSKNSEKKSDLLKFDRILCDVPCSG 262

Query: 333 SGIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQ 392
            G   RK V+                               + RD        L   Q  
Sbjct: 263 DGTM-RKNVN-------------------------------VWRDWNTQNALGLHQVQAN 290

Query: 393 VVKHAMSF-PKAKKIVYSTCSIHAEENEGVVIDLLLDKKVQEWGWKV-----------AP 440
           ++   +    K  ++VYSTCS++  ENE VV   L     ++WG KV             
Sbjct: 291 ILNRGLHLLKKGGRLVYSTCSMNPIENEAVVAQAL-----RKWGDKVRLVNCDDKLPGLV 345

Query: 441 RSEVIPTWP---------RRGFQAEFSKVFRDEDEKCQELA-DGCIRVLPKEDGGIGFFA 490
           R++ I  WP          +G +      F+  +E+ ++   + CIRV P +    GFF 
Sbjct: 346 RNKGISKWPTLNRNMEEMEKGQEGANDSWFQPTEEEAEKFQLENCIRVYPHQQNTGGFFI 405

Query: 491 VCFER 495
             FE+
Sbjct: 406 TVFEK 410

>TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {ON}
           Anc_2.247 YNL061W
          Length = 614

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 97/217 (44%), Gaps = 47/217 (21%)

Query: 219 YKTGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYA 278
           Y  G  I+Q  +S  P   L+P +N+ ++D  AAPG KTT+ ++ +        T  ++A
Sbjct: 319 YLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISALM------KNTGCVFA 372

Query: 279 FEKDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATPEKFRNVTGF---IVDPSCSGS 333
            + +  R K L   I   GC+NTI  N    +F K+        + GF   ++D  C+G+
Sbjct: 373 NDANKARTKSLIANIHRLGCTNTIVCNYDAREFPKV--------IGGFDRILLDAPCTGT 424

Query: 334 GIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQV 393
           G+ G          K +S   +  + D   VP  Q++      D + +  SK        
Sbjct: 425 GVIG----------KDQSVKVSRTEKDFIQVPHLQKQLLLSAIDSVDSN-SKTGGI---- 469

Query: 394 VKHAMSFPKAKKIVYSTCSIHAEENEGVVIDLLLDKK 430
                       IVYSTCS+  EE+E +V+D  L K+
Sbjct: 470 ------------IVYSTCSVAVEEDE-MVVDYALRKR 493

>KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 637

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 60/222 (27%), Positives = 95/222 (42%), Gaps = 57/222 (25%)

Query: 219 YKTGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYA 278
           Y  G  I+Q  +S  P   L+P +N+ ++D  AAPG KTT+ ++ +        T  ++A
Sbjct: 333 YLAGHYILQAASSFLPVVALDPHENERILDMAAAPGGKTTYISAMM------KNTGCVFA 386

Query: 279 FEKDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATPEKFRNVTGF---IVDPSCSGS 333
            + +  R K L   I   GC+NTI  N    +F K+        + GF   ++D  CSG+
Sbjct: 387 NDANKARTKSLIANIHRLGCTNTIVCNYDAREFPKV--------IGGFDRILLDAPCSGT 438

Query: 334 GIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQV 393
           G+  +                     D+       +++F            ++   Q Q+
Sbjct: 439 GVIAK---------------------DQSVKVSRTDKDF-----------MQIPHLQKQL 466

Query: 394 VKHAMSFPKAKK-----IVYSTCSIHAEENEGVVIDLLLDKK 430
           +  A+    A       IVYSTCS+  EENE VV D  L K+
Sbjct: 467 LLSAIDSVDANSKTGGVIVYSTCSVAVEENEAVV-DYALRKR 507

>KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {ON}
           Anc_8.171 YBL024W
          Length = 666

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 78/304 (25%), Positives = 113/304 (37%), Gaps = 68/304 (22%)

Query: 222 GKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFEK 281
           G +  Q+  S  P  +L    N  V+D CAAPG+KT       L     + T  I A + 
Sbjct: 159 GNISRQEAVSMIPPLLLRLESNHNVLDMCAAPGSKTAQLIEQ-LHKDTDEPTGIIVANDS 217

Query: 282 DPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATPEKFRNVTG----FIVDPSCSGSGI 335
           D  R+ +L H +K    SN + VN     F  I T     N+T      + D  CSG G 
Sbjct: 218 DMRRSYLLVHQLKRLNSSNILVVNHDAQFFPNIRTNSLNNNITMKFDRILCDVPCSGDGT 277

Query: 336 FGRKYVDSINKKK-QESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVV 394
             RK ++  N  + Q + G                                L   Q  ++
Sbjct: 278 L-RKNINIWNDWRFQNALG--------------------------------LHRLQNNIL 304

Query: 395 KHAMSFPK-AKKIVYSTCSIHAEENEGVVIDLLLDKKVQEWGWKVAP-----------RS 442
              +   +   ++VYSTCS++  ENE V+ + L     + W  +V+            RS
Sbjct: 305 NRGLQLLRNGGRLVYSTCSMNPIENEAVIANAL-----RNWAGEVSLVNFDDELPGLIRS 359

Query: 443 EVIPTWP---------RRGFQAEFSKVF-RDEDEKCQELADGCIRVLPKEDGGIGFFAVC 492
             I +WP          RG        F    DE+     + CIRV P +     FF   
Sbjct: 360 RGISSWPVIDRNGEMRERGDPETLDSWFPPTADEQKTFNLEKCIRVYPHQQDTGAFFIAV 419

Query: 493 FERN 496
           FE+N
Sbjct: 420 FEKN 423

>Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON}
           (272892..274904) [2013 nt, 671 aa]
          Length = 670

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 77/305 (25%), Positives = 120/305 (39%), Gaps = 68/305 (22%)

Query: 221 TGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFE 280
            G +  Q+  S  P  +L    +  V+D CAAPG+KT       L     + +  + A +
Sbjct: 144 VGNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIE-ALHMEDDEPSGFVVAND 202

Query: 281 KDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATPE---KFRNVTGF---IVDPSCSG 332
            D +R+ +L H +K    +N + VN     F +I   E   + ++V  F   + D  CSG
Sbjct: 203 ADAKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHEDATQKKDVLRFDRVLCDVPCSG 262

Query: 333 SGIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQ 392
            G   RK V+                               + RD        L + Q  
Sbjct: 263 DGTM-RKNVN-------------------------------VWRDWNTQSGLGLHTVQLN 290

Query: 393 VVKHAMSFPKAK-KIVYSTCSIHAEENEGVVIDLLLDKKVQEWGWKV-----------AP 440
           ++   +   K K ++VYSTCS++  ENE VV   L     ++WG K+             
Sbjct: 291 ILNRGLHLLKPKGRLVYSTCSMNPIENEAVVAAAL-----RKWGDKIRLVNCDDKLPGLV 345

Query: 441 RSEVIPTWP---------RRGFQAEFSKVFRDEDEKCQEL-ADGCIRVLPKEDGGIGFFA 490
           RS+ I TWP         ++G +      F    E+ ++     CIRV P +    GFF 
Sbjct: 346 RSKGISTWPVVDRNMEEKKKGDENTVESWFAPTPEEAEKFDLSSCIRVYPHQQNTGGFFI 405

Query: 491 VCFER 495
             FE+
Sbjct: 406 TVFEK 410

>KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 75/305 (24%), Positives = 118/305 (38%), Gaps = 68/305 (22%)

Query: 221 TGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFE 280
            G +  Q+  S  P  +L       V+D CAAPG+KT       L     + T  + A +
Sbjct: 145 VGNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIE-ALHMDTDEPTGFVVAND 203

Query: 281 KDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATP---EKFRNVTGF---IVDPSCSG 332
            D  R+ +L H +K    +N + VN     F +I      +K +++  F   + D  CSG
Sbjct: 204 ADSRRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKISNDSDKKKDLLKFDRILCDVPCSG 263

Query: 333 SGIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQ 392
            G   RK V+ + K     SG                                L + Q+ 
Sbjct: 264 DGTM-RKNVN-VWKDWNTQSGLG------------------------------LHTVQYN 291

Query: 393 VVKHAMSFPKAK-KIVYSTCSIHAEENEGVVIDLLLDKKVQEWGWKV-----------AP 440
           ++   ++  K+  ++VYSTCS++  ENE VV   L     + WG K+             
Sbjct: 292 ILNRGLNLLKSGGRLVYSTCSLNPIENEAVVAQAL-----RTWGDKIKLVNCGDKLPGLV 346

Query: 441 RSEVIPTWP---------RRGFQAEFSKVFRDEDEKCQEL-ADGCIRVLPKEDGGIGFFA 490
           RS+ I  WP          +G +      F   +E+ +    + CIRV P +    GFF 
Sbjct: 347 RSQGISQWPVIDRNMTEKNKGDEGTIESWFPPSEEEAKNFHLENCIRVYPHQQNTGGFFI 406

Query: 491 VCFER 495
              E+
Sbjct: 407 TVIEK 411

>Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W
           (REAL)
          Length = 670

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 73/305 (23%), Positives = 117/305 (38%), Gaps = 68/305 (22%)

Query: 221 TGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFE 280
            G +  Q+  S  P  +L    +  V+D CAAPG+KT       L     + +  + A +
Sbjct: 144 VGNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIE-ALHKDTDEPSGFVVAND 202

Query: 281 KDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATPE---KFRNVTGF---IVDPSCSG 332
            D  R+ +L H +K    +N + VN     F +I   E   K  +V  F   + D  CSG
Sbjct: 203 ADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHENSNKKNDVLKFDRILCDVPCSG 262

Query: 333 SGIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQ 392
            G   RK V+ + K     +G                                L + Q  
Sbjct: 263 DGTM-RKNVN-VWKDWNTQAG------------------------------LGLHTVQLN 290

Query: 393 VVKHAMSFPK-AKKIVYSTCSIHAEENEGVVIDLLLDKKVQEWGWKV-----------AP 440
           ++   +   K   ++VYSTCS++  ENE V+ + L     ++WG K+             
Sbjct: 291 ILNRGLHLLKDGGRLVYSTCSLNPIENEAVIAEAL-----RKWGDKIRLVNCDDKLSGLV 345

Query: 441 RSEVIPTWP---------RRGFQAEFSKVFRDEDEKCQEL-ADGCIRVLPKEDGGIGFFA 490
           RS+ +  WP          +G +      F   +E+  +     C+RV P +    GFF 
Sbjct: 346 RSKGVSKWPVYDRNLTEKTKGDEGTLESFFAPSEEEASKFNLQNCMRVYPHQQNTGGFFI 405

Query: 491 VCFER 495
             FE+
Sbjct: 406 TVFEK 410

>NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa]
           {ON} 
          Length = 659

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 73/307 (23%), Positives = 111/307 (36%), Gaps = 72/307 (23%)

Query: 221 TGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFE 280
            G +  Q+  S  P  +L    +  V+D CAAPG+KT       L     + T  + A +
Sbjct: 138 VGNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLLE-ALHRDSNEPTGFVVAND 196

Query: 281 KDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATPEKFRNVTGF------IVDPSCSG 332
            D  RA +L H +K    +N + VN     F KI       N +G       + D  CSG
Sbjct: 197 SDSRRAYMLVHQLKRLNSANLLVVNHDAQFFPKIKLRADATNKSGMLKYDRILCDVPCSG 256

Query: 333 SGIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQ 392
            G   +      +   Q + G                                L + Q  
Sbjct: 257 DGTMRKNVNVWKDWNTQNALG--------------------------------LHNVQLN 284

Query: 393 VVKHAMSFPKAK-KIVYSTCSIHAEENEGVVIDLLLDKKVQEWGWKV-----------AP 440
           ++   +   K   ++VYSTCS++  ENE VV   L     ++WG K+             
Sbjct: 285 ILNRGLQLLKDNGRLVYSTCSLNPIENEAVVAAAL-----RKWGNKIKLVDCQNKLQGLV 339

Query: 441 RSEVIPTWPRRGFQAEFSKVFRDED------------EKCQELADGCIRVLPKEDGGIGF 488
           RS  I  W    +  E + + +D +            EK     + C+RV P +    GF
Sbjct: 340 RSNGISHW--SVYDREMNAITKDSESTKSSWFEPTDAEKENFNLEHCMRVYPHQQNTGGF 397

Query: 489 FAVCFER 495
           F   FE+
Sbjct: 398 FIAVFEK 404

>TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 63.2 bits (152), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 74/309 (23%), Positives = 113/309 (36%), Gaps = 76/309 (24%)

Query: 221 TGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFE 280
            G +  Q+  S  P  +L    +  V+D CAAPG+KT       L     + T  + A +
Sbjct: 144 VGNISRQEAVSMIPPLVLEVKPHHTVLDMCAAPGSKTAQMIE-ALHMENAEPTGFVVAND 202

Query: 281 KDPERAKILQHMIKVAGCSNTIQVN------------VGDFTKIATPEKFRNVTGFIVDP 328
            D  R+ +L H +K    +N + VN            VGD  K     KF  +   + D 
Sbjct: 203 SDYRRSHMLVHQLKRLNSANMMVVNHDAQFFPRIKLSVGD-NKAKDALKFDRI---LCDV 258

Query: 329 SCSGSGIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLAS 388
            CSG G   RK V+ + K     +G                                L +
Sbjct: 259 PCSGDGTM-RKNVN-VWKDWNTQAGLG------------------------------LHT 286

Query: 389 FQFQVVKHAMSFPK-AKKIVYSTCSIHAEENEGVVIDLLLDKKVQEWGWKV--------- 438
            Q+ ++   +   K   ++VYSTCS++  ENE VV      + ++ WG K+         
Sbjct: 287 IQYNILNRGLHLLKTGGRLVYSTCSLNPIENEAVVA-----RALRTWGSKIKIINCDDKL 341

Query: 439 --APRSEVIPTWP---------RRGFQAEFSKVFRDEDEKCQEL-ADGCIRVLPKEDGGI 486
               RS  +  WP          +G +      F   DE+        C+RV P +    
Sbjct: 342 PGLIRSNGVTQWPVFDRNMESKNKGDEGTLESWFPPTDEEVTAFNLQNCMRVYPHQQNTG 401

Query: 487 GFFAVCFER 495
           GFF    E+
Sbjct: 402 GFFITVIEK 410

>Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W
           (REAL)
          Length = 681

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 71/305 (23%), Positives = 117/305 (38%), Gaps = 68/305 (22%)

Query: 221 TGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFE 280
            G +  Q+  S  P  +L    +  V+D CAAPG+KT       L     + +  + A +
Sbjct: 144 VGNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIE-ALHKDTDEPSGFVVAND 202

Query: 281 KDPERAKILQHMIKVAGCSNTIQVN--VGDFTKI---ATPEKFRNVTGF---IVDPSCSG 332
            D  R+ +L H +K    +N + VN     F +I       K  ++  F   + D  CSG
Sbjct: 203 ADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSNKKNDILKFDRILCDVPCSG 262

Query: 333 SGIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQ 392
            G   RK V+ + K     +G                                L + Q  
Sbjct: 263 DGTM-RKNVN-VWKDWNTQAG------------------------------LGLHTVQLN 290

Query: 393 VVKHAMSFPKAK-KIVYSTCSIHAEENEGVVIDLLLDKKVQEWGWKV-----------AP 440
           ++   +   K+  ++VYSTCS++  ENE V+ + L     ++WG K+             
Sbjct: 291 ILNRGLHLLKSNGRLVYSTCSLNPIENEAVIAEAL-----RKWGDKIRLVNCDDKLTGLI 345

Query: 441 RSEVIPTWP---------RRGFQAEFSKVFRDEDEKCQEL-ADGCIRVLPKEDGGIGFFA 490
           RS+ +  WP          +G +      F   +E+  +     C+RV P +    GFF 
Sbjct: 346 RSKGVSKWPVYDRNLTEKNKGDEGTLESFFPPSEEEASKFNLKNCMRVYPHQQNTGGFFI 405

Query: 491 VCFER 495
             FE+
Sbjct: 406 SVFEK 410

>Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W
           (REAL)
          Length = 674

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 73/305 (23%), Positives = 114/305 (37%), Gaps = 68/305 (22%)

Query: 221 TGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFE 280
            G +  Q+  S  P  +L    +  V+D CAAPG+KT       L     + +  + A +
Sbjct: 144 VGNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIE-ALHKDTDEPSGFVVAND 202

Query: 281 KDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATPEKFRN---VTGF---IVDPSCSG 332
            D  R+ +L H +K    +N + VN     F +I       N   V  F   + D  CSG
Sbjct: 203 ADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSSNKNDVLKFDRILCDVPCSG 262

Query: 333 SGIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQ 392
            G   RK V+ + K     +G                                L + Q  
Sbjct: 263 DGTM-RKNVN-VWKDWNTQAG------------------------------LGLHTVQLN 290

Query: 393 VVKHAMSFPKAK-KIVYSTCSIHAEENEGVVIDLLLDKKVQEWGWKV-----------AP 440
           ++   +   K   ++VYSTCS++  ENE VV + L     ++WG K+             
Sbjct: 291 ILNRGLHLLKNNGRLVYSTCSLNPIENEAVVAEAL-----RKWGDKIRLVNCDDKLPGLI 345

Query: 441 RSEVIPTWP---------RRGFQAEFSKVFRDEDEKCQEL-ADGCIRVLPKEDGGIGFFA 490
           RS+ +  WP          +G +      F   +E+        C+RV P +    GFF 
Sbjct: 346 RSKGVSKWPVYDRNLTEKTKGDEGTLESFFSPSEEEASRFNLQNCMRVYPHQQNTGGFFI 405

Query: 491 VCFER 495
             FE+
Sbjct: 406 TVFEK 410

>YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}
           NCL1S-adenosyl-L-methionine-dependent tRNA:
           m5C-methyltransferase, methylates cytosine to m5C at
           several positions in tRNAs and intron-containing
           pre-tRNAs; increases proportion of tRNALeu(CAA) with m5C
           at wobble position in response to hydrogen peroxide,
           causing selective translation of mRNA from genes
           enriched in TTG codon; loss of NCL1 confers
           hypersensitivity to oxidative stress; similar to Nop2p
           and human proliferation associated nucleolar protein
           p120
          Length = 684

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 73/305 (23%), Positives = 115/305 (37%), Gaps = 68/305 (22%)

Query: 221 TGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFE 280
            G +  Q+  S  P  +L    +  V+D CAAPG+KT       L     + +  + A +
Sbjct: 144 VGNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIE-ALHKDTDEPSGFVVAND 202

Query: 281 KDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATPEKFRN---VTGF---IVDPSCSG 332
            D  R+ +L H +K    +N + VN     F +I       N   V  F   + D  CSG
Sbjct: 203 ADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSNNKNDVLKFDRILCDVPCSG 262

Query: 333 SGIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQ 392
            G   RK V+ + K     +G                                L + Q  
Sbjct: 263 DGTM-RKNVN-VWKDWNTQAG------------------------------LGLHAVQLN 290

Query: 393 VVKHAMSFPKAK-KIVYSTCSIHAEENEGVVIDLLLDKKVQEWGWKV-----------AP 440
           ++   +   K   ++VYSTCS++  ENE VV + L     ++WG K+             
Sbjct: 291 ILNRGLHLLKNNGRLVYSTCSLNPIENEAVVAEAL-----RKWGDKIRLVNCDDKLPGLI 345

Query: 441 RSEVIPTWP---------RRGFQAEFSKVFRDEDEKCQEL-ADGCIRVLPKEDGGIGFFA 490
           RS+ +  WP          +G +      F   +E+  +     C+RV P +    GFF 
Sbjct: 346 RSKGVSKWPVYDRNLTEKTKGDEGTLDSFFSPSEEEASKFNLQNCMRVYPHQQNTGGFFI 405

Query: 491 VCFER 495
             FE+
Sbjct: 406 TVFEK 410

>CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024w NCL1 tRNA (cytosine-5-)-methyltransferase
          Length = 672

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 74/299 (24%), Positives = 115/299 (38%), Gaps = 68/299 (22%)

Query: 221 TGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFE 280
            G +  Q+  S  P  +L    +  V+D CAAPG+KTT      L     + T  + A +
Sbjct: 142 VGNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTTQMIE-ALHKDTDEPTGFVVAND 200

Query: 281 KDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIAT---PEKFRNVTGF---IVDPSCSG 332
            D  R+ +L H +K    +N + VN     F +I     P K +    F   + D  CSG
Sbjct: 201 ADSRRSHMLVHQLKRLNSANLMVVNHDAQFFPRIILSDEPSKKKAQLKFDRILCDVPCSG 260

Query: 333 SGIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQ 392
            G   RK V+    K   + G  G                             L + Q  
Sbjct: 261 DGTM-RKNVNVW--KDWNTQGALG-----------------------------LHTVQLN 288

Query: 393 VVKHAMSFPKAK-KIVYSTCSIHAEENEGVVIDLLLDKKVQEWGWKV-----------AP 440
           ++   +   +   ++VYSTCS++  ENE VV + L     + WG KV             
Sbjct: 289 ILDRGLHLLQNNGRLVYSTCSMNPIENEAVVAEAL-----RRWGDKVRLVDCSEKLPGLI 343

Query: 441 RSEVIPTWP---------RRGFQAEFSKVFRDEDEKCQEL-ADGCIRVLPKEDGGIGFF 489
           RS+ I  WP         ++  +   +  F   +E+  +   + C+RV P +    GFF
Sbjct: 344 RSQGITQWPVIDRNMEERKKEDEGMINSWFPPSEEEVSKFHLERCMRVYPHQQNTGGFF 402

>NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {ON} 
          Length = 679

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 67/310 (21%), Positives = 115/310 (37%), Gaps = 77/310 (24%)

Query: 221 TGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYI-LGGPKKDQTTQIYAF 279
            G +  Q+  S  P  +L+   +  V+D CAAPG+KT      + + GP  + +  + A 
Sbjct: 138 VGNISRQEAVSMIPPIVLDVKPHHTVLDMCAAPGSKTAQLIEALHMDGP--EPSGFVVAN 195

Query: 280 EKDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIATP-------EKFRNVTGFIVDPSC 330
           + D +R+ +L H +K    +N + VN     F KI          +++      + D  C
Sbjct: 196 DSDSKRSHMLVHQLKRLNSANLMVVNHDAQFFPKIQLDSNKGRHNKEYLKFDRILCDVPC 255

Query: 331 SGSGIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQ 390
           SG G   +      +   Q S G                                L + Q
Sbjct: 256 SGDGTIRKNVNIWKDWNTQNSLG--------------------------------LHNVQ 283

Query: 391 FQVVKHAMSFPKA-KKIVYSTCSIHAEENEGVVIDLLLDKKVQEWG-------------- 435
             ++   +   K+  ++VYSTCS+   ENE V+        +++WG              
Sbjct: 284 LNILNRGIQLLKSGGRLVYSTCSLSPIENEAVI-----SATLRKWGNKIKLVDCKEMLPG 338

Query: 436 ---------WKVAPRSEVIPTWPRRGFQAEFSKVFRDEDEKCQEL-ADGCIRVLPKEDGG 485
                    W+V  R+  I +   +G +      F+  +E+  +     CIRV P +   
Sbjct: 339 LISSPGISKWEVYDRTMSIVS---KGAEKSKDTWFQPTEEEANDFNLSHCIRVFPHQQNT 395

Query: 486 IGFFAVCFER 495
            GFF    E+
Sbjct: 396 GGFFIAVLEK 405

>KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 704

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 69/306 (22%), Positives = 115/306 (37%), Gaps = 69/306 (22%)

Query: 221 TGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFE 280
            G +  Q+  S  P  +L+   +  V+D CAAPG+KT       L     + +  + A +
Sbjct: 144 VGNISRQEAVSMIPPIVLDVKPHHYVLDMCAAPGSKTAQLIE-ALHAESDEPSGFVIAND 202

Query: 281 KDPERAKILQHMIKVAGCSNTIQVNVG---------DFTKIATPEKFRNVTGFIVDPSCS 331
            D +R+ +L H +K    +N + VN           D T+ +   +F      + D  CS
Sbjct: 203 ADYKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKVDSTEGSKGPQFLKFDRVLCDVPCS 262

Query: 332 GSGIFGRKYVDSINKKKQESSGDNGNQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQF 391
           G G   +    ++N  K  ++G                                L   Q 
Sbjct: 263 GDGTMRK----NVNVWKDWNTGSGLG----------------------------LHIVQL 290

Query: 392 QVVKHAMSFPK-AKKIVYSTCSIHAEENEGVVIDLLLDKKVQEWGWKV-----------A 439
            +++  ++  K   K+VYSTCS++  ENE V+   L     + WG KV            
Sbjct: 291 NILERGLNLLKEGGKLVYSTCSLNPIENEAVIAAAL-----RRWGDKVRLVNCDDQLPGL 345

Query: 440 PRSEVIPTWP---------RRGFQAEFSKVFRDEDEKCQEL-ADGCIRVLPKEDGGIGFF 489
            RS+ I  W           +G +      F    E+ ++   + C+RV   +    GFF
Sbjct: 346 VRSKGITEWKVYDKQFQVREKGHENCLDSWFPPTAEEVEKFHLENCMRVYQHQQNTGGFF 405

Query: 490 AVCFER 495
              FE+
Sbjct: 406 ITVFEK 411

>Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W
           (NCL1) - Probable proliferating-cell nucleolar antigen
           (human p120) [contig 230] PARTIAL
          Length = 272

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 55/127 (43%), Gaps = 7/127 (5%)

Query: 221 TGKVIIQDRASCFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFE 280
            G +  Q+  S  P  +L    +  V+D CAAPG+KT       L   + + T  + A +
Sbjct: 144 VGNISRQEAVSMIPPIVLEVEPHHAVLDMCAAPGSKTAQMIE-ALHATEDEPTGFVVAND 202

Query: 281 KDPERAKILQHMIKVAGCSNTIQVN--VGDFTKIAT---PEKFRNVTGFIVDPSCSGSGI 335
            D  R+ +L H +K    +N + VN     F ++       +F      + D  CSG G 
Sbjct: 203 ADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRVKLDNDSNQFLKFDRVLCDVPCSGDGT 262

Query: 336 FGRKYVD 342
             RK V+
Sbjct: 263 M-RKNVN 268

>Suva_5.305 Chr5 (494912..497245) [2334 bp, 777 aa] {ON} YER171W
           (REAL)
          Length = 777

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 49/103 (47%), Gaps = 6/103 (5%)

Query: 385 KLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEGVVIDL--LLDKKVQEWGWKVAPRS 442
           K  S     + + M +P+ +KI+Y  CS    E E  +++L  L+D + +E G++   R 
Sbjct: 48  KTVSLLSLTIAYQMHYPEHRKIIY--CSRTMSEIEKALVELENLMDYRTKELGYQEDFRG 105

Query: 443 EVIPTWPRRGFQAEFSKVFRDE--DEKCQELADGCIRVLPKED 483
             + +        E SK  +    DEKC+ + +G  R   +ED
Sbjct: 106 LGLTSRKNLCLHPEVSKERKGTVVDEKCRRMTNGQARRKAEED 148

>CAGL0L11924g Chr12 (1279776..1282103) [2328 bp, 775 aa] {ON} highly
           similar to uniprot|P06839 Saccharomyces cerevisiae
           YER171w DNA helicase/ATPase
          Length = 775

 Score = 35.0 bits (79), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 6/94 (6%)

Query: 385 KLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEGVVIDL--LLDKKVQEWGWKVAPRS 442
           K  S     + + M +P+ +KI+Y  CS    E E  +++L  L+D + +E G+K   R 
Sbjct: 48  KTVSLLSLTIAYQMHYPEHRKIIY--CSRTMSEIEKALVELENLMDYRAKELGFKEEFRG 105

Query: 443 EVIPTWPRRGFQAEFSKVFRDE--DEKCQELADG 474
             + +        E SK       DEKC+ + +G
Sbjct: 106 LGLTSRKNLCLHPEVSKERSGTIVDEKCRRMTNG 139

>YER171W Chr5 (527082..529418) [2337 bp, 778 aa] {ON}  RAD35' to 3'
           DNA helicase, involved in nucleotide excision repair and
           transcription; subunit of RNA polII initiation factor
           TFIIH and of Nucleotide Excision Repair Factor 3 (NEF3);
           homolog of human XPD protein; mutant has aneuploidy
           tolerance
          Length = 778

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 45/94 (47%), Gaps = 6/94 (6%)

Query: 385 KLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEGVVIDL--LLDKKVQEWGWKVAPRS 442
           K  S     + + M +P+ +KI+Y  CS    E E  +++L  L+D + +E G++   R 
Sbjct: 48  KTVSLLSLTIAYQMHYPEHRKIIY--CSRTMSEIEKALVELENLMDYRTKELGYQEDFRG 105

Query: 443 EVIPTWPRRGFQAEFSKVFRDE--DEKCQELADG 474
             + +        E SK  +    DEKC+ + +G
Sbjct: 106 LGLTSRKNLCLHPEVSKERKGTVVDEKCRRMTNG 139

>Smik_5.343 Chr5 (526697..529024) [2328 bp, 775 aa] {ON} YER171W
           (REAL)
          Length = 775

 Score = 35.0 bits (79), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 45/94 (47%), Gaps = 6/94 (6%)

Query: 385 KLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEGVVIDL--LLDKKVQEWGWKVAPRS 442
           K  S     + + M +P+ +KI+Y  CS    E E  +++L  L+D + +E G++   R 
Sbjct: 48  KTVSLLSLTIAYQMHYPEHRKIIY--CSRTMSEIEKALVELENLMDYRTKELGYQEDFRG 105

Query: 443 EVIPTWPRRGFQAEFSKVFRDE--DEKCQELADG 474
             + +        E SK  +    DEKC+ + +G
Sbjct: 106 LGLTSRKNLCLHPEVSKERKGTVVDEKCRRMTNG 139

>Skud_5.310 Chr5 (512188..514515) [2328 bp, 775 aa] {ON} YER171W
           (REAL)
          Length = 775

 Score = 34.7 bits (78), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 45/94 (47%), Gaps = 6/94 (6%)

Query: 385 KLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEGVVIDL--LLDKKVQEWGWKVAPRS 442
           K  S     + + M +P+ +KI+Y  CS    E E  +++L  L+D + +E G++   R 
Sbjct: 48  KTVSLLSLTIAYQMHYPEHRKIIY--CSRTMSEIEKALVELENLMDYRTKELGYQEDFRG 105

Query: 443 EVIPTWPRRGFQAEFSKVFRDE--DEKCQELADG 474
             + +        E SK  +    DEKC+ + +G
Sbjct: 106 LGLTSRKNLCLHPEVSKERKGTVVDEKCRRMTNG 139

>Kpol_1032.54 s1032 (122377..124707) [2331 bp, 776 aa] {ON}
           (122377..124707) [2331 nt, 777 aa]
          Length = 776

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 6/94 (6%)

Query: 385 KLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEGVVIDL--LLDKKVQEWGWKVAPRS 442
           K  S     V + M +P+ +KI+Y  CS    E E  +I+L  L+D + +E G+    R 
Sbjct: 48  KTVSLLSLTVAYQMHYPEHRKIIY--CSRTMSEIEKALIELENLMDYRSRELGYAEDFRG 105

Query: 443 EVIPTWPRRGFQAEFSKVFRDE--DEKCQELADG 474
             + +        + SK  +    DEKC+ + +G
Sbjct: 106 LGLTSRKNLCLHPQVSKERKGTVVDEKCRRMTNG 139

>ZYRO0B11836g Chr2 (940987..943299) [2313 bp, 770 aa] {ON} highly
           similar to uniprot|P06839 Saccharomyces cerevisiae
           YER171W RAD3 5' to 3' DNA helicase involved in
           nucleotide excision repair and transcription subunit of
           RNA polymerase II transcription initiation factor TFIIH
           subunit of Nucleotide Excision Repair Factor 3 (NEF3)
           homolog of human XPD protein
          Length = 770

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 44/94 (46%), Gaps = 6/94 (6%)

Query: 385 KLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEGVVIDL--LLDKKVQEWGWKVAPRS 442
           K  S     + + M +P+ +KI+Y  CS    E E  +++L  L+D + +E G++   R 
Sbjct: 48  KTVSLLSLTIAYQMHYPEHRKIIY--CSRTMSEIEKALVELENLMDYRTKELGYREDFRG 105

Query: 443 EVIPTWPRRGFQAEFSKVFRDE--DEKCQELADG 474
             + +        + SK       DEKC+ + +G
Sbjct: 106 LGLTSRKNLCLHPQVSKERNGTLVDEKCRRMTNG 139

>TBLA0E04230 Chr5 (1071883..1074222) [2340 bp, 779 aa] {ON}
           Anc_8.237 YER171W
          Length = 779

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 6/94 (6%)

Query: 385 KLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEGVVIDL--LLDKKVQEWGWKVAPRS 442
           K  S     + + M +P+ +KI+Y  CS    E E  +++L  L+D + +E G K   R 
Sbjct: 48  KTVSLLSLTIAYQMHYPEHRKIIY--CSRTMSEIEKALVELENLMDYREKELGVKEEFRG 105

Query: 443 EVIPTWPRRGFQAEFSKVFRDE--DEKCQELADG 474
             + +        + SK  +    DEKC+ L +G
Sbjct: 106 LGLTSRKNLCLHPQISKEKKGTVVDEKCRRLTNG 139

>TPHA0A01920 Chr1 complement(387645..389966) [2322 bp, 773 aa] {ON}
           Anc_8.237 YER171W
          Length = 773

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 44/94 (46%), Gaps = 6/94 (6%)

Query: 385 KLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEGVVIDL--LLDKKVQEWGWKVAPRS 442
           K  S     V + M +P+ +KI+Y  CS    E E  +++L  L+D + +E G+K   R 
Sbjct: 48  KTVSLLSLTVAYQMHYPEHRKIIY--CSRTMSEIEKALVELENLMDYRTKELGFKEEFRG 105

Query: 443 EVIPTWPRRGFQAEFSKVFRDE--DEKCQELADG 474
             + +          +K  +    DEKC+ + +G
Sbjct: 106 LGLSSRKNLCLHPVVNKERKGTVVDEKCRRMTNG 139

>NCAS0A05210 Chr1 (1031496..1032545) [1050 bp, 349 aa] {ON}
           Anc_4.126 YGL001C
          Length = 349

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 30/60 (50%), Gaps = 2/60 (3%)

Query: 360 DEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENE 419
           D   +P++   +F  K DD++  +  L S  F+ V+ A+    A  +V+S   +H +  E
Sbjct: 37  DVRPLPEKLSNQFTFKLDDIQVHIGDLTS--FEDVQKAIKVSGANVVVHSASPMHGQNKE 94

>KLLA0C17776g Chr3 (1577323..1579659) [2337 bp, 778 aa] {ON} highly
           similar to uniprot|P06839 Saccharomyces cerevisiae
           YER171W RAD3 5' to 3' DNA helicase involved in
           nucleotide excision repair and transcription subunit of
           RNA polymerase II transcription initiation factor TFIIH
           subunit of Nucleotide Excision Repair Factor 3 (NEF3)
           homolog of human XPD protein
          Length = 778

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 43/95 (45%), Gaps = 2/95 (2%)

Query: 385 KLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEGVVIDLLLDKKVQEWGWKVAPRSEV 444
           K  S     V + M +P+ +KI+Y + ++   E   V ++ L+D + +E G+    R   
Sbjct: 48  KTVSLLSLTVAYQMHYPEHRKIIYCSRTMSEIEKALVELESLMDYRSKELGFVEDFRGLG 107

Query: 445 IPTWPRRGFQAEFSKVFRDE--DEKCQELADGCIR 477
           + +          SK  +    DEKC+ + +G  R
Sbjct: 108 LTSRKNLCLHPRVSKERKGNVVDEKCRRMTNGQAR 142

>TPHA0K01430 Chr11 complement(300282..301283) [1002 bp, 333 aa] {ON}
           Anc_4.145 YGR007W
          Length = 333

 Score = 31.2 bits (69), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 165 YDKGLEPIMNELNKKFPTRVNHWSDIV 191
           Y+KG +P+MNE  +   TR N W D V
Sbjct: 54  YNKGTKPVMNENERYAHTRSNRWCDYV 80

>Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} similar
           to Ashbya gossypii ACR026W
          Length = 319

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 31/73 (42%), Gaps = 9/73 (12%)

Query: 243 NDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSNTI 302
           +DIV++     GN TT            ++  ++ A E DP  A  L   +        +
Sbjct: 57  SDIVLEVGPGTGNLTTRIL---------EKARKVVAVEFDPRMAAELTKRVHGTAAEKKL 107

Query: 303 QVNVGDFTKIATP 315
           ++ +GDFTK   P
Sbjct: 108 EIILGDFTKTELP 120

>Ecym_3517 Chr3 complement(972456..974726) [2271 bp, 756 aa] {ON}
           similar to Ashbya gossypii AGR114C
          Length = 756

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 42/92 (45%), Gaps = 2/92 (2%)

Query: 385 KLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENEGVVIDLLLDKKVQEWGWKVAPRSEV 444
           K  S     V + M +P+ +KIVY + ++   E   V ++ L+D + +E  ++   R   
Sbjct: 48  KTVSLLSLTVAYQMHYPEHRKIVYCSRTMSEIEKALVELESLMDYRAKELEYQEEFRGLG 107

Query: 445 IPTWPRRGFQAEFSKVFRDE--DEKCQELADG 474
           + +          SK  +    DEKC+ + +G
Sbjct: 108 LTSRKNLCLHPRVSKERKGSVVDEKCRRMTNG 139

>AGL161C Chr7 complement(394886..397198) [2313 bp, 770 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR144C
           (ACF2)
          Length = 770

 Score = 31.2 bits (69), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 52/133 (39%), Gaps = 10/133 (7%)

Query: 228 DRAS-CFPAHILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFEKDPERA 286
           DRA+ C+P      G  D         G+  T+T +Y   G     TT +YA     E A
Sbjct: 311 DRAAGCYPVDGSLTGSID---------GSNGTYTLTYSTRGSSNGGTTLMYALPHHVEYA 361

Query: 287 KILQHMIKVAGCSNTIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINK 346
                    +  ++T+  N+  +       K    +G   DP  +     G +Y DS+ +
Sbjct: 362 TGKTTGKINSTLASTVLGNMQGYLTNVIEAKVPIASGLSFDPFTTIPDKMGPQYSDSVKQ 421

Query: 347 KKQESSGDNGNQD 359
           K +E++    N D
Sbjct: 422 KIREAADKEVNND 434

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,094,865
Number of extensions: 2584664
Number of successful extensions: 15036
Number of sequences better than 10.0: 141
Number of HSP's gapped: 15204
Number of HSP's successfully gapped: 167
Length of query: 496
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 382
Effective length of database: 40,409,475
Effective search space: 15436419450
Effective search space used: 15436419450
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)