Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1003.372.285ON57857830040.0
YNL021W (HDA1)2.285ON70629813221e-175
Suva_14.3262.285ON70629813211e-175
Skud_14.3082.285ON70629813201e-174
Smik_14.3102.285ON70629813161e-174
NDAI0G006502.285ON68932413091e-173
KAFR0H033202.285ON70230013011e-172
CAGL0J03454g2.285ON69329812911e-170
TPHA0C033902.285ON70130012831e-169
NCAS0G038002.285ON72630712811e-168
ZYRO0A01870g2.285ON70729812751e-168
KLTH0G10340g2.285ON70829812631e-166
TBLA0B069502.285ON79532612681e-166
KNAG0H020102.285ON69329812581e-165
TDEL0G021602.285ON71429712561e-165
Kwal_27.115372.285ON70831912471e-164
KLLA0E08383g2.285ON70431612441e-163
Ecym_33242.285ON70629812431e-163
SAKL0E07700g2.285ON71229512391e-162
ADL216C2.285ON70529812051e-157
Kpol_1039.322.285ON65928611831e-154
KAFR0C029208.153ON4532943054e-29
AFR172C8.153ON4492953029e-29
ZYRO0G19316g8.153ON4482962992e-28
TDEL0B045808.153ON4462842984e-28
Kpol_246.58.153ON4532932974e-28
TPHA0H003208.153ON4502942959e-28
NDAI0B027108.153ON4532912931e-27
NCAS0B054808.153ON4513052922e-27
TBLA0D021408.153ON4563052887e-27
SAKL0H25124g8.153ON4482992887e-27
KLLA0F09119g8.153ON4522932861e-26
YGL194C (HOS2)8.153ON4522902852e-26
Smik_7.798.153ON4523042842e-26
Ecym_23468.153ON4852982852e-26
Skud_7.798.153ON4522902842e-26
KLTH0E06446g8.153ON4492932823e-26
Suva_7.718.153ON4522902824e-26
Kwal_55.207908.153ON4492962753e-25
CAGL0A03322g8.153ON4503002744e-25
KNAG0G013508.153ON4512962736e-25
KNAG0A011603.8ON4332762682e-24
NDAI0G037403.8ON4332762655e-24
Suva_14.113.8ON4332762656e-24
KAFR0A086303.8ON4332762639e-24
TPHA0A003003.8ON4332762631e-23
Kpol_1038.113.8ON4332762621e-23
CAGL0B01441g3.8ON4332762621e-23
TBLA0I005603.8ON4332762602e-23
Kwal_55.221423.8ON4322912603e-23
NCAS0C043203.8ON4342762593e-23
Ecym_20103.8ON4332762593e-23
AGR395W3.8ON4332762584e-23
KLTH0F19668g3.8ON4322762585e-23
ZYRO0C03498g3.8ON4332762575e-23
Skud_14.113.8ON4332762567e-23
SAKL0C13706g3.8ON4332762567e-23
Smik_14.23.8ON4332762567e-23
KLLA0E01981g3.8ON4322762568e-23
YNL330C (RPD3)3.8ON4332762559e-23
TDEL0A002703.8ON4332762541e-22
TDEL0C050403.362ON4541321689e-12
Kwal_23.37243.362ON4731651689e-12
TBLA0B023903.362ON5791321644e-11
Skud_16.3533.362ON4711331609e-11
CAGL0D01430g3.362ON4451671591e-10
KLTH0F10582g3.362ON4741331572e-10
Suva_16.3963.362ON4771331562e-10
KLLA0B09394g3.362ON4411431562e-10
SAKL0B07854g3.362ON4891331554e-10
KAFR0H008903.362ON4741061554e-10
Smik_16.3093.362ON4701331545e-10
ADL339W3.362ON4371331535e-10
YPR068C (HOS1)3.362ON4701331483e-09
Ecym_82908.607ON709821465e-09
Kpol_376.153.362ON5181331465e-09
KNAG0H006303.362ON4561351447e-09
NCAS0A111803.362ON4901591421e-08
Suva_16.1948.607ON699581422e-08
KLLA0F00858g8.607ON715651422e-08
Smik_6.3158.607ON697581412e-08
KLTH0D09592g8.607ON705651403e-08
YPL116W (HOS3)8.607ON697581403e-08
ZYRO0C16390g3.362ON4361331383e-08
NDAI0A051203.362ON5081321384e-08
SAKL0H08338g8.607ON690821394e-08
NCAS0C017608.607ON700581385e-08
TDEL0A055208.607ON674821378e-08
Kwal_26.85058.607ON708581368e-08
KAFR0H027908.607ON717581369e-08
KNAG0J013008.607ON677571361e-07
TPHA0A011208.607ON698581361e-07
Skud_16.1648.607ON697581342e-07
Kpol_479.68.607ON688581342e-07
TPHA0M015903.362ON4941361313e-07
NDAI0E024808.607ON684821313e-07
ADL265W8.607ON694581314e-07
CAGL0J06974g8.607ON678541271e-06
Ecym_34653.362ON4451371251e-06
TBLA0E040808.607ON694581261e-06
ZYRO0F10780g8.607ON668821252e-06
TBLA0A090304.107ON780124810.37
TPHA0F007204.129ON1283121800.53
ZYRO0G10076g4.107ON782119752.0
AFL203C5.397ON385106705.5
YMR208W (ERG12)8.719ON443129697.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1003.37
         (578 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1003.37 s1003 complement(91621..92301,92861..92869,92912..9...  1161   0.0  
YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putat...   513   e-175
Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021...   513   e-175
Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021...   513   e-174
Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021...   511   e-174
NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {O...   508   e-173
KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.2...   505   e-172
CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa] ...   501   e-170
TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {O...   498   e-169
NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON}              498   e-168
ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {...   495   e-168
KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {...   491   e-166
TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa] ...   493   e-166
KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.2...   489   e-165
TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {O...   488   e-165
Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021...   484   e-164
KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly...   483   e-163
Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}...   483   e-163
SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly...   481   e-162
ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON} S...   468   e-157
Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON} (99859...   460   e-154
KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {O...   122   4e-29
AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON} S...   120   9e-29
ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} high...   119   2e-28
TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {O...   119   4e-28
Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON} (11759..13...   119   4e-28
TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}...   118   9e-28
NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153    117   1e-27
NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa] ...   117   2e-27
TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {O...   115   7e-27
SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} high...   115   7e-27
KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly...   114   1e-26
YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}  ...   114   2e-26
Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}...   114   2e-26
Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}...   114   2e-26
Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}...   114   2e-26
KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {...   113   3e-26
Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}...   113   4e-26
Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {...   110   3e-25
CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly...   110   4e-25
KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.1...   109   6e-25
KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON} A...   107   2e-24
NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {O...   106   5e-24
Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}...   106   6e-24
KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3...   105   9e-24
TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}...   105   1e-23
Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {O...   105   1e-23
CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {...   105   1e-23
TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8...   104   2e-23
Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL3...   104   3e-23
NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8      104   3e-23
Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON} s...   104   3e-23
AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic ...   103   4e-23
KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} high...   103   5e-23
ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly...   103   5e-23
Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}...   103   7e-23
SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} high...   103   7e-23
Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON} YN...   103   7e-23
KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {...   103   8e-23
YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}  R...   102   9e-23
TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}...   102   1e-22
TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {O...    69   9e-12
Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C...    69   9e-12
TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.3...    68   4e-11
Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {...    66   9e-11
CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} simila...    66   1e-10
KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} simila...    65   2e-10
Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {...    65   2e-10
KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} simila...    65   2e-10
SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {...    64   4e-10
KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.3...    64   4e-10
Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {...    64   5e-10
ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic ho...    64   5e-10
YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON} ...    62   3e-09
Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}...    61   5e-09
Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}...    61   5e-09
KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.3...    60   7e-09
NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa] ...    59   1e-08
Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116...    59   2e-08
KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON...    59   2e-08
Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON...    59   2e-08
KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {...    59   3e-08
YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}  HOS3Trich...    59   3e-08
ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]...    58   3e-08
NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON} Anc_3...    58   4e-08
SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} simila...    58   4e-08
NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.6...    58   5e-08
TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {O...    57   8e-08
Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {O...    57   8e-08
KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {O...    57   9e-08
KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8....    57   1e-07
TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.6...    57   1e-07
Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116...    56   2e-07
Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON} ...    56   2e-07
TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {...    55   3e-07
NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.6...    55   3e-07
ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic ho...    55   4e-07
CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highl...    54   1e-06
Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar t...    53   1e-06
TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa] ...    53   1e-06
ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {...    53   2e-06
TBLA0A09030 Chr1 (2222340..2224682) [2343 bp, 780 aa] {ON} Anc_4...    36   0.37 
TPHA0F00720 Chr6 (162768..166619) [3852 bp, 1283 aa] {ON} Anc_4....    35   0.53 
ZYRO0G10076g Chr7 (805645..807993) [2349 bp, 782 aa] {ON} highly...    33   2.0  
AFL203C Chr6 complement(53876..55033) [1158 bp, 385 aa] {ON} Syn...    32   5.5  
YMR208W Chr13 (684467..685798) [1332 bp, 443 aa] {ON}  ERG12Meva...    31   7.6  

>Kpol_1003.37 s1003
           complement(91621..92301,92861..92869,92912..93958) [1737
           bp, 578 aa] {ON}
           complement(91621..92301,92861..92869,92912..93958) [1737
           nt, 579 aa]
          Length = 578

 Score = 1161 bits (3004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 566/578 (97%), Positives = 566/578 (97%)

Query: 1   MSFNGGAHSLKRILHDTVTEDVKPEMATGVNGGKETIMNGNSKNDHFKKMPKRQVIVPIR 60
           MSFNGGAHSLKRILHDTVTEDVKPEMATGVNGGKETIMNGNSKNDHFKKMPKRQVIVPIR
Sbjct: 1   MSFNGGAHSLKRILHDTVTEDVKPEMATGVNGGKETIMNGNSKNDHFKKMPKRQVIVPIR 60

Query: 61  QPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDEN 120
           QPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDEN
Sbjct: 61  QPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDEN 120

Query: 121 LSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLTEKAXXXXXX 180
           LSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLTEKA      
Sbjct: 121 LSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLTEKADSVYYN 180

Query: 181 XXXXXXAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAGGFCLFSNVSVAARS 240
                 AKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAGGFCLFSNVSVAARS
Sbjct: 181 NDSYYSAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAGGFCLFSNVSVAARS 240

Query: 241 ILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQV 300
           ILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQV
Sbjct: 241 ILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQV 300

Query: 301 GEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSGXXXMKPHEKLV 360
           GEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG   MKPHEKLV
Sbjct: 301 GEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSGXXXMKPHEKLV 360

Query: 361 LASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAADRNYSILD 420
           LASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAADRNYSILD
Sbjct: 361 LASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAADRNYSILD 420

Query: 421 INIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGIVHLIGERD 480
           INIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGIVHLIGERD
Sbjct: 421 INIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGIVHLIGERD 480

Query: 481 LRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWKESEEKRPRKKFG 540
           LRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWKESEEKRPRKKFG
Sbjct: 481 LRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWKESEEKRPRKKFG 540

Query: 541 RVLKSDSDGIISIINERFDEATDFILDAFEEWSDEESD 578
           RVLKSDSDGIISIINERFDEATDFILDAFEEWSDEESD
Sbjct: 541 RVLKSDSDGIISIINERFDEATDFILDAFEEWSDEESD 578

>YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putative
           catalytic subunit of a class II histone deacetylase
           complex that also contains Hda2p and Hda3p; Hda1p
           interacts with the Hda2p-Hda3p subcomplex to form an
           active tetramer; deletion increases histone H2B, H3 and
           H4 acetylation
          Length = 706

 Score =  513 bits (1322), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 232/298 (77%), Positives = 262/298 (87%)

Query: 52  KRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILA 111
           KRQVIVP+  PK+HY+PLKTGLCYDVRMRYHAKIFTS FEYIDPHPEDPRR+YRIYKILA
Sbjct: 39  KRQVIVPVCMPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 98

Query: 112 ENGLIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLT 171
           ENGLI D  LSG+DD+GD+MLKIPVR AT EEIL VHT+EHL+FIE+ E  SREEL+K T
Sbjct: 99  ENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREELLKET 158

Query: 172 EKAXXXXXXXXXXXXAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAGGFCLF 231
           EK             A+L CGG IEAC+AVVEGRVKNSLA+VRPPGHHAEPQAAGGFCLF
Sbjct: 159 EKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLF 218

Query: 232 SNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPG 291
           SNV+VAA++IL+ YPESVR+I+ILDWDIHHGNGTQK+FY+D+ VLY+SLHR+E   +YPG
Sbjct: 219 SNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPG 278

Query: 292 TIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
           TI G+YDQ GEGKGEGFNCNITWPVGGVGDAEYMWAFE VVMP+GREF+PDLVI+SSG
Sbjct: 279 TIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSG 336

 Score =  272 bits (695), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 119/220 (54%), Positives = 169/220 (76%)

Query: 357 EKLVLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAADRNY 416
           +  VL +  I ++ T++I+VHDT ++W  R++I+G +D S+SV+ID S+ FIKW  DR Y
Sbjct: 487 DNTVLCTPNISESNTIIIVVHDTSDIWAKRNVISGTIDLSSSVIIDNSLDFIKWGLDRKY 546

Query: 417 SILDINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGIVHLI 476
            I+D+NIP +  E + +S    + E+++ LWDN+++Y  ++ KI FIGIG+SY GIVHL+
Sbjct: 547 GIIDVNIPLTLFEPDNYSGMITSQEVLIYLWDNYIKYFPSVAKIAFIGIGDSYSGIVHLL 606

Query: 477 GERDLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWKESEEKRPR 536
           G RD R ++K VINF+G+  LK L    DET+ +WYFKNSL+F+N+SH CWKE+E ++PR
Sbjct: 607 GHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKENESRKPR 666

Query: 537 KKFGRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEE 576
           KKFGRVL+ D+DG+ +II ERF+EATDFILD+FEEWSDEE
Sbjct: 667 KKFGRVLRCDTDGLNNIIEERFEEATDFILDSFEEWSDEE 706

>Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score =  513 bits (1321), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 233/298 (78%), Positives = 261/298 (87%)

Query: 52  KRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILA 111
           KRQVIVP   PKLHYTPL+TGLCYDVRMRYHAKIFTS FEYIDPHPEDPRR+YRIYKILA
Sbjct: 39  KRQVIVPACTPKLHYTPLRTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 98

Query: 112 ENGLIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLT 171
           ENGLI D  LSG+DD+GD+MLKIPVR AT EEIL VHT+EHL+FIE+ E  SRE+L+K T
Sbjct: 99  ENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKET 158

Query: 172 EKAXXXXXXXXXXXXAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAGGFCLF 231
           EK             A+L CGG IEAC+AVVEGRVKNSLA+VRPPGHHAEPQAAGGFCLF
Sbjct: 159 EKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLF 218

Query: 232 SNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPG 291
           SNV+VAA++IL+ YPESVR+I+ILDWDIHHGNGTQK+FY+D+ VLYISLHR+E   +YPG
Sbjct: 219 SNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPG 278

Query: 292 TIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
           TI G+YDQ GEGKGEGFNCNITWPVGGVGDAEYMWAFE VVMP+GREF+PDLVI+SSG
Sbjct: 279 TIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSG 336

 Score =  270 bits (690), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 117/224 (52%), Positives = 169/224 (75%)

Query: 353 MKPHEKLVLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAA 412
           M+  + +VL +  + ++ TL+++VHDT ++W  R++I+G +D S+SV+ID  + FIKW  
Sbjct: 483 MELPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNVISGTIDLSSSVVIDNCLDFIKWGL 542

Query: 413 DRNYSILDINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGI 472
           DR Y I+D+NIP +  E + +S    + E+++ LWDN+++Y   + KI +IGIG+SY GI
Sbjct: 543 DRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPAVAKIAYIGIGDSYSGI 602

Query: 473 VHLIGERDLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWKESEE 532
           VHL+G RD R ++K VINF+G+  LK L    DET+ +WYFKNSLVFTN+SH CWKE+E 
Sbjct: 603 VHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLTEWYFKNSLVFTNNSHQCWKENES 662

Query: 533 KRPRKKFGRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEE 576
           ++PRKKFGRVL+ D+DG+ + + ERF+EATDFILD+FEEWSDEE
Sbjct: 663 RKPRKKFGRVLRCDTDGLSNTVEERFEEATDFILDSFEEWSDEE 706

>Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score =  513 bits (1320), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 232/298 (77%), Positives = 261/298 (87%)

Query: 52  KRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILA 111
           KRQVIVP   PK+HY+PLKTGLCYDVRMRYHAKIFTS FEYIDPHPEDPRR+YRIYKILA
Sbjct: 39  KRQVIVPACTPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 98

Query: 112 ENGLIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLT 171
           ENGLI D  LSG+DDIGD+MLKIPVR AT EEIL VHT+EHL+FIE+ E  SRE+L+K T
Sbjct: 99  ENGLINDPTLSGVDDIGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKET 158

Query: 172 EKAXXXXXXXXXXXXAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAGGFCLF 231
           EK             A+L CGG IEAC+AVVEGRVKNSLA+VRPPGHHAEPQAAGGFCLF
Sbjct: 159 EKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLF 218

Query: 232 SNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPG 291
           SNV+VAA++IL+ YPESVR+I+ILDWDIHHGNGTQK+FY+D+ VLY+SLHR+E   +YPG
Sbjct: 219 SNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPG 278

Query: 292 TIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
           TI G+YDQ GEGKGEGFNCNITWPVGGVGDAEYMWAFE VVMP+GREF+PDLVI+SSG
Sbjct: 279 TIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSG 336

 Score =  264 bits (674), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 165/220 (75%)

Query: 357 EKLVLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAADRNY 416
           +   L +  +F++  L+++VHDT ++W  R++I+G +D S+SV+ID  + FIKW  DR Y
Sbjct: 487 DNTALCTPNVFESNALLVVVHDTSDVWAKRNVISGTIDLSSSVIIDNCIDFIKWGLDRKY 546

Query: 417 SILDINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGIVHLI 476
            I+D+NIP +  E + +S    + E+++ LWDN+++Y   + KI FIGIG+S+ GIVHL+
Sbjct: 547 GIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPNVAKIAFIGIGDSHSGIVHLL 606

Query: 477 GERDLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWKESEEKRPR 536
           G RD R ++K VINF+G+  LK L    DET+ +WYFKNSL+F+N+SH CWKE+E ++PR
Sbjct: 607 GHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKENESRKPR 666

Query: 537 KKFGRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEE 576
           KKFGRVL+ D+DG+ + I ERF+EATDFILD+FEEWSD+E
Sbjct: 667 KKFGRVLRCDTDGLSNTIEERFEEATDFILDSFEEWSDDE 706

>Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score =  511 bits (1316), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 231/298 (77%), Positives = 261/298 (87%)

Query: 52  KRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILA 111
           KRQVIVP   PK+HY+PLKTGLCYDVRMRYHAKIFTS FEYIDPHPEDPRR+YRIYKILA
Sbjct: 39  KRQVIVPACTPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 98

Query: 112 ENGLIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLT 171
           ENGLI D  LSG+DD+GD+MLKIPVR AT EEIL VHT+EHL+FIE+ E  SRE+L+K T
Sbjct: 99  ENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKET 158

Query: 172 EKAXXXXXXXXXXXXAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAGGFCLF 231
           EK             A+L CGG IEAC+AVVEGRVKNSLA+VRPPGHHAEPQAAGGFCLF
Sbjct: 159 EKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLF 218

Query: 232 SNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPG 291
           SNV+VAA++IL+ YPESVR+I+ILDWDIHHGNGTQK+FY+D+ VLY+SLHR+E   +YPG
Sbjct: 219 SNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPG 278

Query: 292 TIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
           TI G+YDQ GEGKGEGFNCNITWPVGGVGDAEYMWAFE VVMP+GREF+PDLVI+SSG
Sbjct: 279 TIQGQYDQAGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSG 336

 Score =  270 bits (690), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 116/220 (52%), Positives = 167/220 (75%)

Query: 357 EKLVLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAADRNY 416
           +  VL +  ++++ TL+++VHDT ++W  R++I+G +D S+SV+ID  + FIKW  DR Y
Sbjct: 487 DNTVLCTPNVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKWGLDRKY 546

Query: 417 SILDINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGIVHLI 476
            I+D+NIP S  E + +S    + E+++ LWDN+++Y   + KI F+GIG+SY GIVHL+
Sbjct: 547 GIIDVNIPLSLFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDSYSGIVHLL 606

Query: 477 GERDLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWKESEEKRPR 536
           G RD R ++K VINF+G+  LK L    DET+ +WYFKNSL+F+N+SH CWKE+E ++PR
Sbjct: 607 GHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKENESRKPR 666

Query: 537 KKFGRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEE 576
           KKFGRVL+ D+DG+ + I ERF+EATDFILD+FEEWSDEE
Sbjct: 667 KKFGRVLRCDTDGLNNTIEERFEEATDFILDSFEEWSDEE 706

>NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {ON}
           Anc_2.285 YNL021W
          Length = 689

 Score =  508 bits (1309), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 235/324 (72%), Positives = 270/324 (83%), Gaps = 9/324 (2%)

Query: 30  VNGGKETIMNGNSKNDHFKKMP----KRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKI 85
           +NGG+ T     S ND  KK       RQ+IVP R  ++HYTPLKTGLCYDVRMRYHAKI
Sbjct: 1   MNGGETT-----SNNDTIKKRKIDPESRQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKI 55

Query: 86  FTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIMLKIPVRTATEEEIL 145
           FTS FEYIDPHPEDPRR+YRIYKILAENGLIKD  LSG+DDIGD+MLKIPVR AT EEIL
Sbjct: 56  FTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVREATSEEIL 115

Query: 146 AVHTREHLDFIENIESQSREELIKLTEKAXXXXXXXXXXXXAKLSCGGVIEACRAVVEGR 205
            VH++EHLDFIE+    +RE+L+K TE              AKL  GG IEAC+AVVEGR
Sbjct: 116 EVHSKEHLDFIESTSKMNREQLLKATESGDSVYFNSDSYASAKLPVGGAIEACKAVVEGR 175

Query: 206 VKNSLAIVRPPGHHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGT 265
           VKN+LA+VRPPGHHAEP+AAGGFCLFSNV++AA++IL+ YPESVRKILILDWDIHHGNGT
Sbjct: 176 VKNALAVVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGT 235

Query: 266 QKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYM 325
           QKAFY+D+ +LY+SLHR++   +YPGTIHGRYDQ GEGKGEGFNCNITWPVGGVGDAEYM
Sbjct: 236 QKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYM 295

Query: 326 WAFEHVVMPLGREFRPDLVIVSSG 349
           WAFE +VMP+GREF+PDLVI+S+G
Sbjct: 296 WAFEQIVMPMGREFQPDLVIISAG 319

 Score =  270 bits (691), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 120/220 (54%), Positives = 167/220 (75%)

Query: 357 EKLVLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAADRNY 416
           E  +L S  I+++ T++I VHDTPE+W  RD I G +DPS+S+++D+S+  IKWA +R Y
Sbjct: 470 EDTILCSSNIYESNTIIICVHDTPEIWAKRDAIQGTIDPSSSIIVDSSLDMIKWAIERKY 529

Query: 417 SILDINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGIVHLI 476
            ++DINIP++ LE+E + S   A E++++LWDN+L+Y   + KI F+GIG++Y GIVHL+
Sbjct: 530 GVIDINIPQNLLEQENYYSIITAQEVLINLWDNYLKYFPNVNKIAFVGIGDAYSGIVHLL 589

Query: 477 GERDLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWKESEEKRPR 536
           G RD R + KAVINFVG   LK L    DE++ +WYFKNSLVF+N +H  W + E K+PR
Sbjct: 590 GHRDTRSVVKAVINFVGQKQLKPLVPLVDESLGEWYFKNSLVFSNKNHIYWGDKENKKPR 649

Query: 537 KKFGRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEE 576
           KK+GRVL+ D+DGI +I+ ERF+EATDFILD+FEEWSD E
Sbjct: 650 KKYGRVLRCDTDGISNIMEERFEEATDFILDSFEEWSDSE 689

>KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.285
           YNL021W
          Length = 702

 Score =  505 bits (1301), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 225/300 (75%), Positives = 264/300 (88%)

Query: 50  MPKRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKI 109
           +PKRQVIVP ++P++HY PLKTGLCYDVRMRYHAKIFTS FEYIDPHPEDPRR+YRIYKI
Sbjct: 29  VPKRQVIVPTKKPQVHYIPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKI 88

Query: 110 LAENGLIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIK 169
           LAENGLI D  LSG+DDIGDIMLKIPVR AT +EIL VH+REHL+F+E+  + +RE L+K
Sbjct: 89  LAENGLINDTMLSGVDDIGDIMLKIPVREATADEILEVHSREHLEFLESTTTMNREVLLK 148

Query: 170 LTEKAXXXXXXXXXXXXAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAGGFC 229
            TEK             AKLSCGG IEAC+AVVEG+VKN+LA+VRPPGHH+EP+++GGFC
Sbjct: 149 ETEKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKNALAVVRPPGHHSEPESSGGFC 208

Query: 230 LFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFY 289
           LFSNV+VAA++IL+ YPESVRKI+ILDWDIHHGNGTQKAFY+DE VLY+SLHR+E+  +Y
Sbjct: 209 LFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYY 268

Query: 290 PGTIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
           PGT+ G+YDQ GEGKGEGFNCNITWP GGVGDAEYMWAFE +VMP+GREF+PDLVI+SSG
Sbjct: 269 PGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSG 328

 Score =  262 bits (669), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 119/228 (52%), Positives = 170/228 (74%), Gaps = 4/228 (1%)

Query: 353 MKPHEKLVLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAA 412
           +K  + L+L S  I  AET++I+VHDTP++W ++DII+  +DP +S++ID+++ F+KWA 
Sbjct: 475 LKLPDDLILCSPNIHTAETVIIIVHDTPQIWLEKDIISNTVDPCSSIIIDSTLDFLKWAH 534

Query: 413 DRNYSILDINIPKSNL----EKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGES 468
           +R Y I+D+NIP+S +      + +SS   A EI+L LWDNH+++++ + KI FIG+G+S
Sbjct: 535 NRKYGIIDVNIPQSLIYGDENPDNYSSLINAQEILLFLWDNHIKFLNEVNKIAFIGVGDS 594

Query: 469 YQGIVHLIGERDLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWK 528
             G+VHL+G RD +   KAVINF+ +  LK L    DE++ DWYFKNSLVF+N +H CW 
Sbjct: 595 VSGVVHLLGHRDTKERVKAVINFMADKQLKPLVPLVDESLSDWYFKNSLVFSNRTHPCWG 654

Query: 529 ESEEKRPRKKFGRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEE 576
           + E K+PRKK+GRVL+ D+DG+ S I ERFDEATDFILD+FEEWSD E
Sbjct: 655 DKENKKPRKKYGRVLRCDTDGLNSTIEERFDEATDFILDSFEEWSDSE 702

>CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa]
           {ON} highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021w HDA1 histone deacetylase A
          Length = 693

 Score =  501 bits (1291), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 226/298 (75%), Positives = 261/298 (87%)

Query: 52  KRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILA 111
           KR VIVP R+ ++HYTPLKTG+CYDVRMRYHAKIFTS FEYIDPHPEDPRR+YRIYKILA
Sbjct: 26  KRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 85

Query: 112 ENGLIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLT 171
           ENGLI D  LSG++DIGD+MLKIP+R AT EEIL VH++EHL+FIE  E  +REEL+K T
Sbjct: 86  ENGLINDPTLSGVNDIGDLMLKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREELLKET 145

Query: 172 EKAXXXXXXXXXXXXAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAGGFCLF 231
           EK             ++L CGG IEAC+AVVEGRVKNSLA+VRPPGHHAEP+AAGGFCLF
Sbjct: 146 EKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPEAAGGFCLF 205

Query: 232 SNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPG 291
           SNV+VAA++IL+ YPESVR+ILILDWD+HHGNGTQKAFY+D+ VLYISLHR+E   +YPG
Sbjct: 206 SNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPG 265

Query: 292 TIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
           TI G+YDQ+GEGKG+GFNCNITWPVGGVGDAEYMWAFE VVMP+GREF+PDLVI+SSG
Sbjct: 266 TIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSG 323

 Score =  264 bits (674), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 115/239 (48%), Positives = 175/239 (73%)

Query: 338 EFRPDLVIVSSGXXXMKPHEKLVLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPST 397
           +   D   V+     M+  +  V+ S  +F   T++++VHDTPE+W  R++ITG +DPST
Sbjct: 455 QLSEDFGFVTLPLLNMEVPQDSVICSPNLFNETTILVVVHDTPEIWAKRNVITGTIDPST 514

Query: 398 SVLIDTSMKFIKWAADRNYSILDINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTL 457
           S+++D+  +FIKW  +R Y I+DINIP+S  E+E +++   + EI++ +WDN+L++  +L
Sbjct: 515 SLVVDSGAEFIKWGLERKYGIMDINIPQSLFEQENYTAVLTSQEILIYIWDNYLKFFPSL 574

Query: 458 TKICFIGIGESYQGIVHLIGERDLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSL 517
           TK+ FIGIG++  GIVHL+G RD R + K+V++F+G   LK L    +E++ DWYFKNSL
Sbjct: 575 TKVAFIGIGDASAGIVHLLGHRDTRSVVKSVVSFIGKKSLKPLVPLVNESLGDWYFKNSL 634

Query: 518 VFTNDSHNCWKESEEKRPRKKFGRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEE 576
           VFT+ SH+CW ++E ++PRKKFGRVL+ D++G+ +II ER +E+TDFILD+FEEWSD E
Sbjct: 635 VFTDHSHSCWGDNENRKPRKKFGRVLRCDAEGMNNIIEERLEESTDFILDSFEEWSDSE 693

>TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {ON}
           Anc_2.285 YNL021W
          Length = 701

 Score =  498 bits (1283), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 229/300 (76%), Positives = 259/300 (86%)

Query: 50  MPKRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKI 109
           +PKR VIVP ++P LHYTPLKTG+CYDVRMRYHAKIFTS FEYIDPHPEDPRR+YRIYKI
Sbjct: 32  LPKRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKI 91

Query: 110 LAENGLIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIK 169
           LAENGLI D +L+G+ DIGD+MLKIPVR AT+EEIL VHT EH+ F+E+ E  +REEL+ 
Sbjct: 92  LAENGLINDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLS 151

Query: 170 LTEKAXXXXXXXXXXXXAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAGGFC 229
            TEK             A+LSCGG IEAC+AVVEGRVKN+LAIVRPPGHHAEPQAAGGFC
Sbjct: 152 KTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFC 211

Query: 230 LFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFY 289
           LFSNVSVAA+SIL+TYPESVRKILI+DWDIHHGNGTQKAFYED+NVLYISLHR+E   FY
Sbjct: 212 LFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFY 271

Query: 290 PGTIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
           PG   G YD+VG+GKG+GFNCNITWPV GVGD EY+WAFE +V+P+ REFRPDLVIVSSG
Sbjct: 272 PGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSG 331

 Score =  289 bits (740), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 129/237 (54%), Positives = 183/237 (77%), Gaps = 1/237 (0%)

Query: 342 DLVIVSSGXXXMKPHEKLVLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLI 401
           D  ++S     +   +  ++ S   FKA++L +L+HDTPE+WG+RDIITG++DPSTS++ 
Sbjct: 466 DFGMISLSLPNLNLPKNSIICSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIF 525

Query: 402 DTSMKFIKWAADRNYSILDINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKIC 461
           D+S+KFI WA +R  +++DINIP+S  E + +SS+  + ++M+SLWDNH +YI +L K+C
Sbjct: 526 DSSLKFINWAIERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLC 585

Query: 462 FIGIGESYQGIVHLIGERDLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTN 521
           FIGIGE+  GIVHL+G+RD R ++KA INFVG+  LK +  + DE++ DWYFKNSLVFT+
Sbjct: 586 FIGIGEATSGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTD 645

Query: 522 DSHNCWKESEEKRPRKKFGRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEESD 578
             H CW E+ +K+PRKK+GRVL+ D+DGI +II ERF+EATDFILDAF+EWSD E +
Sbjct: 646 HFHGCWSEN-DKKPRKKYGRVLRCDTDGIHNIIEERFEEATDFILDAFDEWSDTEDE 701

>NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON} 
          Length = 726

 Score =  498 bits (1281), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 229/307 (74%), Positives = 260/307 (84%)

Query: 43  KNDHFKKMPKRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRR 102
           K      + +R VIVP R  +L YTPLKTGLCYDVRMRYHAKIFTS FEYIDPHPEDPRR
Sbjct: 50  KKQKITDVSERPVIVPPRDAELSYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRR 109

Query: 103 VYRIYKILAENGLIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQ 162
           +YRIYKILAENGLIKD  LSG++DIGD+MLKIPVR ATEEEIL VH++EH DFIE   + 
Sbjct: 110 IYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTM 169

Query: 163 SREELIKLTEKAXXXXXXXXXXXXAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEP 222
           +REEL+K TEK             AKL  GG IEAC+AVVEGRVKNSLA+VRPPGHHAEP
Sbjct: 170 NREELLKATEKGDSVYFNNDSFASAKLPVGGSIEACKAVVEGRVKNSLAVVRPPGHHAEP 229

Query: 223 QAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHR 282
           QAAGGFCLFSNV++AA++IL+ YPESVR+I+ILDWDIHHGNGTQKAFY+D+ VLYISLHR
Sbjct: 230 QAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHR 289

Query: 283 YESTAFYPGTIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPD 342
           +E   +YPGTI+G+YDQ GEGKGEGFNCNITWPVGGVGDAEY+WAFE VVMP+ REF+PD
Sbjct: 290 FELGKYYPGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPD 349

Query: 343 LVIVSSG 349
           LVI+SSG
Sbjct: 350 LVIISSG 356

 Score =  261 bits (668), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 109/217 (50%), Positives = 166/217 (76%)

Query: 360 VLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAADRNYSIL 419
           VL S  +++++T++I  HDTPE+W  RD+I G +DPS+S+++D+++ FIKWA ++ Y ++
Sbjct: 510 VLCSPNVYQSKTVIICAHDTPEIWAKRDVIQGTIDPSSSIIVDSTLDFIKWANEKKYGVI 569

Query: 420 DINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGIVHLIGER 479
           DINIP++  E+E +S+   + E++  +WDN+L+Y   + K+ FIGIG++Y GIVHL+G R
Sbjct: 570 DINIPQNLFEQENYSAIVTSQEVLTYIWDNYLKYFPNVEKVAFIGIGDAYSGIVHLLGHR 629

Query: 480 DLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWKESEEKRPRKKF 539
           D R + K+VINF+    L++L    DE++ DWYFKNSLVF++ SH  W + E K+PRKK+
Sbjct: 630 DTRSVVKSVINFIAQKQLRALVPLVDESLSDWYFKNSLVFSDKSHTYWGDKENKKPRKKY 689

Query: 540 GRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEE 576
           GR+L+ ++DGI +I+ ERF+EATDFILD+FEEWSD E
Sbjct: 690 GRLLRCETDGINNIVEERFEEATDFILDSFEEWSDSE 726

>ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 707

 Score =  495 bits (1275), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 226/298 (75%), Positives = 255/298 (85%)

Query: 52  KRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILA 111
           KRQ+IVP  +PK+HYTPLKTGLCYDVRMRYHAKIFTS FEYIDPHPEDPRR+YRIYKILA
Sbjct: 41  KRQIIVPACEPKIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 100

Query: 112 ENGLIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLT 171
           ENGLI D  LSG DDIG++MLKIPVR AT EE+L VHT+EHL+FIE     +REEL+K T
Sbjct: 101 ENGLINDPTLSGEDDIGELMLKIPVREATVEELLQVHTKEHLEFIEKTSQMNREELLKET 160

Query: 172 EKAXXXXXXXXXXXXAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAGGFCLF 231
           E              AKL CGG IEAC+AVVEGRVKN+LA++RPPGHHAEP+ AGGFCLF
Sbjct: 161 ETGDSVYFNSDSYSAAKLPCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEMAGGFCLF 220

Query: 232 SNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPG 291
           SNV+VAA++IL+ YPESVR+ILILDWDIHHGNGTQKAFY D+ VLYISLHR+E   +YPG
Sbjct: 221 SNVAVAAQNILKNYPESVRRILILDWDIHHGNGTQKAFYNDDRVLYISLHRFELGKYYPG 280

Query: 292 TIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
           TIHG+YDQ GEGKGEGFNCNITWPVGGVGDAEYM AFE +VMP+ RE+RPDLVI+SSG
Sbjct: 281 TIHGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREYRPDLVIISSG 338

 Score =  270 bits (691), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 168/220 (76%)

Query: 357 EKLVLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAADRNY 416
           E  VL S  +F+  T++I VHDTPE+W  RD+ITG++DPSTS+ +D+ + FIKW+  R Y
Sbjct: 488 EDTVLCSPDVFQESTVIIFVHDTPEIWAKRDVITGMIDPSTSITVDSPLDFIKWSLARKY 547

Query: 417 SILDINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGIVHLI 476
            ++D+NIP+S  E++ +S+   + E+++ LWDN ++Y  +L+K+ F+G+G++Y GIVHL+
Sbjct: 548 GVIDVNIPQSLFEQDNYSAMITSQEVLIYLWDNFVKYFPSLSKVAFVGVGDAYSGIVHLL 607

Query: 477 GERDLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWKESEEKRPR 536
           G RD R + KAVINFVG   LK L    DE++ DWYFKNSLVF++ ++ CW ++E K+PR
Sbjct: 608 GHRDTRSVVKAVINFVGRKQLKPLVPLVDESLGDWYFKNSLVFSDRNNPCWVDNENKKPR 667

Query: 537 KKFGRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEE 576
           +KFGRVL+ +SDGI + + ERFDEATDFILD+FEEWSD E
Sbjct: 668 RKFGRVLRCESDGINNNMEERFDEATDFILDSFEEWSDSE 707

>KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 708

 Score =  491 bits (1263), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 223/298 (74%), Positives = 255/298 (85%)

Query: 52  KRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILA 111
           KR  IVP  +PKLHYTPLKTGLCYDVRMRYHAKIFTS FEYIDPHPEDPRR+YRIYKILA
Sbjct: 40  KRPTIVPACRPKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 99

Query: 112 ENGLIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLT 171
           ENGLI D  LSG+D IGD+MLKIPVR AT+EEIL VHT+EHL+FI    S +R++L+K T
Sbjct: 100 ENGLIDDPTLSGVDSIGDLMLKIPVREATDEEILQVHTKEHLEFISKTTSMTRDQLLKET 159

Query: 172 EKAXXXXXXXXXXXXAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAGGFCLF 231
           EK             AKLSCGG IEAC+AVVEGRVKN+LA+VRPPGHHAEP+ AGGFCLF
Sbjct: 160 EKGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLF 219

Query: 232 SNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPG 291
           SNV+VAA++IL+ YPESVRKI++LDWD+HHGNGTQKAFY+D+ VLYISLHR+E   +YPG
Sbjct: 220 SNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPG 279

Query: 292 TIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
           TIHG  D+VGEGKGEGFNCNI WP  GVGD+EY+WAFE V+MP+GREFRPDLVI+SSG
Sbjct: 280 TIHGNSDRVGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSG 337

 Score =  258 bits (658), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 117/251 (46%), Positives = 167/251 (66%), Gaps = 17/251 (6%)

Query: 328 FEHVVMPLGREFRPDLVIVSSGXXXMKPHEKLVLASQKIFKAETLVILVHDTPELWGDRD 387
           F  V +PL ++  PD                  + S  I+ A  +++ VHDTP +W  R 
Sbjct: 473 FRFVTLPLFKKELPD---------------DTAICSPNIYDASAIIVCVHDTPSIWAQRS 517

Query: 388 IITGVLDPSTSVLIDTSMKFIKWAADRNYSILDINIPKSNLEKETFSSSKAANEIMLSLW 447
             TG +DPSTS+++DT++  IKWA+ RNY ++DINIP+S  E++ +S+   A E+++ +W
Sbjct: 518 RATGTIDPSTSIIVDTTLDVIKWASSRNYGVIDINIPQSLHEQDNYSAVITAQEVLVHIW 577

Query: 448 DNHLQYISTLTKICFIGIGESYQGIVHLIGERDLRVLSKAVINFVGNFPLKSLSSNFDET 507
           DN+L+Y  +L ++ F+ IG+++ G+VHL+G RD R + K+ ++FV   PL+ L    DET
Sbjct: 578 DNYLKYFPSLNRVAFVAIGDAHSGVVHLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDET 637

Query: 508 MVDWYFKNSLVFTNDSHNCWKE--SEEKRPRKKFGRVLKSDSDGIISIINERFDEATDFI 565
           + DWYFKNSLVF +  H CW    +E K+PRKKFGRVLK DSDGI +I+ ERF+EATDFI
Sbjct: 638 LADWYFKNSLVFASAEHTCWGNDGNENKKPRKKFGRVLKCDSDGINNILEERFEEATDFI 697

Query: 566 LDAFEEWSDEE 576
           LD FEEWSD E
Sbjct: 698 LDTFEEWSDSE 708

>TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa]
           {ON} Anc_2.285 YNL021W
          Length = 795

 Score =  493 bits (1268), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 224/326 (68%), Positives = 264/326 (80%), Gaps = 7/326 (2%)

Query: 25  EMATGV-NGGKETIMNGNSKNDHFKKMPKRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHA 83
           E+ TG  N     I+N N  N       K+Q+IVP++ PK+HY PLKTGLCYDVRMRYHA
Sbjct: 18  ELETGTKNVSTNNILNKNPPN------YKKQIIVPVQAPKIHYVPLKTGLCYDVRMRYHA 71

Query: 84  KIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIMLKIPVRTATEEE 143
           KIFTS FEYIDPHPEDPRR+YRIYKILAENGLI D  LSG+D+IGD+MLK+P+R AT  E
Sbjct: 72  KIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIREATMNE 131

Query: 144 ILAVHTREHLDFIENIESQSREELIKLTEKAXXXXXXXXXXXXAKLSCGGVIEACRAVVE 203
           IL VH+ EH  ++E   + +RE+L+K TE              AKLSCGG IEAC+AVVE
Sbjct: 132 ILEVHSIEHFKYLEKTSNDNREQLLKETENGDSVYFNNDSFQSAKLSCGGAIEACKAVVE 191

Query: 204 GRVKNSLAIVRPPGHHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGN 263
           GRVKN++A+VRPPGHH+EP++AGGFCLFSNV+VA ++IL+ YPESVRK+LILDWDIHHGN
Sbjct: 192 GRVKNAMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGN 251

Query: 264 GTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNITWPVGGVGDAE 323
           GTQKAFY D+NVLYISLHR+E   +YPGTI G+YDQ GEGKGEGFNCNITWP+G VGDAE
Sbjct: 252 GTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITWPIGAVGDAE 311

Query: 324 YMWAFEHVVMPLGREFRPDLVIVSSG 349
           YMWAFE VVMP+ REF+PDLVI+SSG
Sbjct: 312 YMWAFEQVVMPMSREFQPDLVIISSG 337

 Score =  280 bits (715), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 173/221 (78%)

Query: 356 HEKLVLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAADRN 415
           +E  +L S  I +++TLV+LVHD+P+LW  RD+ TGV+D S++++ID+++ FIKW+ DRN
Sbjct: 575 NENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDRN 634

Query: 416 YSILDINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGIVHL 475
           Y ++DINIP++  E++ +SS  AA E +LS WDN+L+Y   + KI FIG G+++ GIVHL
Sbjct: 635 YGVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVHL 694

Query: 476 IGERDLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWKESEEKRP 535
           +G RD R + K+VINF+G  PLK+L    DET+ DWYFKNSLVFT+ +H  W ++E K+P
Sbjct: 695 LGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWADNENKKP 754

Query: 536 RKKFGRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEE 576
           RKKFGRVL+S  DGI ++I ERFDEATDFILD+FEEWSDEE
Sbjct: 755 RKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795

>KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.285
           YNL021W
          Length = 693

 Score =  489 bits (1258), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 221/298 (74%), Positives = 254/298 (85%)

Query: 52  KRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILA 111
           KRQ+IV    PKL YTPLKTGLCYDVRMRYHAKIFTS FEYIDPHPEDPRR+YRIYKILA
Sbjct: 24  KRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 83

Query: 112 ENGLIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLT 171
           ENGLI D  LSG+DDIGD+MLKIPVR AT +E+L VH++EHL+FIE++   S +EL+K T
Sbjct: 84  ENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDELLKST 143

Query: 172 EKAXXXXXXXXXXXXAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAGGFCLF 231
           E              AKLSCGG IEAC+AVVEGRVKN+ A+VRPPGHH+EP++AGGFCLF
Sbjct: 144 ETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPGHHSEPESAGGFCLF 203

Query: 232 SNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPG 291
           SNV+VA+++ILR YPESVR+I+ILDWDIHHGNGTQKAFY+D+ VLYISLHR+E   +YPG
Sbjct: 204 SNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPG 263

Query: 292 TIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
           T  G YD+ GEGKGEGFNCNITWPVGGVGDAEYMWAFE VVMP+ REFRPDLVI+S+G
Sbjct: 264 TAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAG 321

 Score =  259 bits (663), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 167/226 (73%), Gaps = 2/226 (0%)

Query: 353 MKPHEKLVLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAA 412
           MK  +  V+ S +++  +T++ILV DTPE+W  RD+I G +DPS S++ D ++ FIKWA 
Sbjct: 468 MKLSDDTVICSPEVYNKDTIIILVRDTPEIWAKRDVIQGTIDPSASIITDAALAFIKWAM 527

Query: 413 DRNYSILDINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGI 472
           +RNY ++D+NIP+S  E++ +S+   A E+M  +WDN++++  + +KI F+G+G++  GI
Sbjct: 528 ERNYGVIDVNIPQSLFEQDNYSAMITAQEVMSFMWDNYIRFFGSASKIAFVGVGDACSGI 587

Query: 473 VHLIGERDLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCW--KES 530
           VHL+G RD R   K+VINF+    LK L    DET+ DWYFKNSLVF++ +H CW   E+
Sbjct: 588 VHLLGHRDTRSKVKSVINFIAQKTLKPLIPLVDETLGDWYFKNSLVFSDKNHACWGDNEN 647

Query: 531 EEKRPRKKFGRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEE 576
           E K+PRKKFGRVL+ +SDG+ +II ERF+EATDF+LD+FEEWS+ +
Sbjct: 648 ENKKPRKKFGRVLRCNSDGLTNIIEERFEEATDFMLDSFEEWSESD 693

>TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {ON}
           Anc_2.285 YNL021W
          Length = 714

 Score =  488 bits (1256), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 223/297 (75%), Positives = 254/297 (85%)

Query: 53  RQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAE 112
           ++VIVP   P LHYTPLKT LCYDVRMRYHAKIFTS FEYIDPHPEDPRR+YR+YKILAE
Sbjct: 48  KRVIVPACAPNLHYTPLKTALCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAE 107

Query: 113 NGLIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLTE 172
           NGLI D  LSG+D+IGD+MLKIPVR AT+EEIL VH++E+L+F+E      REEL+K TE
Sbjct: 108 NGLINDPTLSGIDEIGDLMLKIPVREATDEEILEVHSKENLEFVERSSRMKREELLKETE 167

Query: 173 KAXXXXXXXXXXXXAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAGGFCLFS 232
           K             AKLSCGGVI+AC+AVVEGRVKN+LA+VRPPGHHAEP+A GGFCLFS
Sbjct: 168 KGDSVYFNNDSYVSAKLSCGGVIDACKAVVEGRVKNALAVVRPPGHHAEPEAPGGFCLFS 227

Query: 233 NVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGT 292
           NV+VAA++IL+ YPESVR+ILILDWDIHHGNGTQKAFY D  VLYISLHR+E   +YPGT
Sbjct: 228 NVAVAAQNILKQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGT 287

Query: 293 IHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
           I+GRYDQ GEGKGEGFNCNITWPVGGVGDAEYM AFE +VMP+ REF+PDLVI+SSG
Sbjct: 288 INGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSG 344

 Score =  274 bits (700), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 115/217 (52%), Positives = 166/217 (76%)

Query: 360 VLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAADRNYSIL 419
           VL S ++F+  T+VI+VHDTPE+W  RD+ITGV+DPSTS+++D+ + F KW  +R Y ++
Sbjct: 498 VLCSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSPLDFTKWCMNRKYGVI 557

Query: 420 DINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGIVHLIGER 479
           D+NIP+S  E++ +S+   + E++L +WDN+++Y  +L K+ F+G G++Y GIVHL+G R
Sbjct: 558 DVNIPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVGFGDAYAGIVHLLGHR 617

Query: 480 DLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWKESEEKRPRKKF 539
           D R   KAV++F+G   LK L    DE++ DWYFKNSL+FT+ +H CW ++E K+PRKKF
Sbjct: 618 DTRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNHPCWADNESKKPRKKF 677

Query: 540 GRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEE 576
           GRVL+ D+DG+ S + ERF+EATDFILD FEEWSD E
Sbjct: 678 GRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE 714

>Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021W
           (HDA1) - histone deacetylase, shares sequence similarity
           with Rpd3p, Hos1p, Hos2p, and Hos3p [contig 27] FULL
          Length = 708

 Score =  484 bits (1247), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 228/319 (71%), Positives = 258/319 (80%), Gaps = 13/319 (4%)

Query: 31  NGGKETIMNGNSKNDHFKKMPKRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNF 90
           NGG ET +             KR VIVP  + KLHYTPLKTGLCYDVRMRYHAKIFTS F
Sbjct: 32  NGGSETKV-------------KRPVIVPACRAKLHYTPLKTGLCYDVRMRYHAKIFTSYF 78

Query: 91  EYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTR 150
           EYIDPHPEDPRR+YRIYKILAENGLI D  LSG+DDIGD+MLKIP R AT+EEIL VHT 
Sbjct: 79  EYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPAREATDEEILQVHTP 138

Query: 151 EHLDFIENIESQSREELIKLTEKAXXXXXXXXXXXXAKLSCGGVIEACRAVVEGRVKNSL 210
           EHL+F+    S +RE+L+K TEK             AKLSCGG IEACRAVVEGRVKN+L
Sbjct: 139 EHLEFLSKTTSMTREQLLKETEKGDSVYFNNDSYLSAKLSCGGAIEACRAVVEGRVKNAL 198

Query: 211 AIVRPPGHHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFY 270
           A+VRPPGHHAEP  AGGFCLFSNV+VAA++IL+ YPESV+KI+ILDWD+HHGNGTQKAFY
Sbjct: 199 AVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFY 258

Query: 271 EDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEH 330
            D+ VLY+SLHR+E   +YPGTIHG  D+VGEGKGEGFNCNI WP  GVGDAEY+WAFE 
Sbjct: 259 NDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQ 318

Query: 331 VVMPLGREFRPDLVIVSSG 349
           VV+P+GREF+PDLVI+SSG
Sbjct: 319 VVLPMGREFQPDLVIISSG 337

 Score =  259 bits (661), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 111/219 (50%), Positives = 163/219 (74%), Gaps = 2/219 (0%)

Query: 360 VLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAADRNYSIL 419
            L S  I+ ++++++ VHDTPE+W  R   TG +DPSTS+++DT++  IKWA+ RNY ++
Sbjct: 490 ALCSPNIYDSQSIIVCVHDTPEIWAQRSRATGTIDPSTSIIVDTTLDVIKWASKRNYGVI 549

Query: 420 DINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGIVHLIGER 479
           DINIP+S  E++ +S+   A E+++ +WD++L+Y ++L+K+ F+ IG++Y G+VHL+G R
Sbjct: 550 DINIPQSLHEQDNYSAVLTAQEVLVYIWDSYLKYFTSLSKVAFVSIGDAYSGVVHLLGHR 609

Query: 480 DLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWKE--SEEKRPRK 537
           D R + KA I+F+   PL+ L    DE++ DWYFKNSLVF +  H CW    +E K+PRK
Sbjct: 610 DTRNVVKAAISFIDQRPLRPLVPLVDESLADWYFKNSLVFASAGHTCWGNDGAENKKPRK 669

Query: 538 KFGRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEE 576
           KFGRVLK +SDG+ +I+ ERF+EATDFILD FEEWSD E
Sbjct: 670 KFGRVLKCNSDGLNNILEERFEEATDFILDTFEEWSDSE 708

>KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 704

 Score =  483 bits (1244), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 221/316 (69%), Positives = 256/316 (81%)

Query: 34  KETIMNGNSKNDHFKKMPKRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYI 93
           KE    G +     K   +R VIVP  +PK+ Y+ LKTG+CYDVRMRYHAKIFTS FEYI
Sbjct: 17  KEIKNEGTAYTLPSKDESQRPVIVPPTKPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYI 76

Query: 94  DPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTREHL 153
           DPHPEDPRR+YR+YKILAENGLI+D  LSG D IGD+M+K+PVR A EEEIL VH+R+HL
Sbjct: 77  DPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVREAEEEEILQVHSRQHL 136

Query: 154 DFIENIESQSREELIKLTEKAXXXXXXXXXXXXAKLSCGGVIEACRAVVEGRVKNSLAIV 213
           DFI   E   RE L+K TE              AKLSCGG IEAC+AVVEGRVKNS+A+V
Sbjct: 137 DFISQTEQLERESLLKETEGGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVV 196

Query: 214 RPPGHHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDE 273
           RPPGHHAEP+ AGGFCLFSNV+VAA ++L++YPESVRKI+I+DWDIHHGNGTQKAFY+D+
Sbjct: 197 RPPGHHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDD 256

Query: 274 NVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVM 333
            VLY+SLHRY+   +YPGTIHG YDQ GEGKGEGFNCNITWP GGVGDAEYMWAFE V+M
Sbjct: 257 RVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIM 316

Query: 334 PLGREFRPDLVIVSSG 349
           P+GREF PDLV++SSG
Sbjct: 317 PMGREFEPDLVLISSG 332

 Score =  257 bits (657), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 162/219 (73%), Gaps = 2/219 (0%)

Query: 360 VLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAADRNYSIL 419
           +L +  I  +ETLV++VHDTPE+W +RD  TG++DPS+S+++D ++K I WA DR Y I+
Sbjct: 486 MLCTSGIQDSETLVVIVHDTPEIWSERDTQTGIIDPSSSIIVDNALKMINWAMDRRYGII 545

Query: 420 DINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGIVHLIGER 479
           DINIP++  E   +    ++ EI++ LWDN+L++   L K+ FIGIG++Y GIVHL+G R
Sbjct: 546 DINIPQTLFEHANYPGVASSQEILIYLWDNYLKFFQNLQKVAFIGIGDAYGGIVHLLGHR 605

Query: 480 DLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWKES--EEKRPRK 537
           D R + K  I+F+   PLK +    DET+ DWYFKNSLVFT+ +H+CW  +  E K+ RK
Sbjct: 606 DTRSVVKCAISFLDKKPLKVMVPLIDETLGDWYFKNSLVFTSSTHSCWGSTANENKKLRK 665

Query: 538 KFGRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEE 576
           K+GRVLK+D DG+ +I +ERF+EATDFILD+FEEWS+ E
Sbjct: 666 KYGRVLKADCDGMTNIFDERFEEATDFILDSFEEWSESE 704

>Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}
           similar to Ashbya gossypii ADL216C
          Length = 706

 Score =  483 bits (1243), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 216/298 (72%), Positives = 255/298 (85%)

Query: 52  KRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILA 111
           KR +IVP+ +PK+HY PLKTGLCYDVRMRYHAKIFTS FEYIDPHPEDPRR+YRIYKILA
Sbjct: 37  KRPIIVPVVKPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 96

Query: 112 ENGLIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLT 171
           ENGLI+D  LSG+DDIG++MLKIP+R ATE+EIL VH++EH++F++   + SRE+L+K T
Sbjct: 97  ENGLIEDPTLSGVDDIGNLMLKIPIREATEDEILLVHSKEHVEFLKTTNTMSREQLLKET 156

Query: 172 EKAXXXXXXXXXXXXAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAGGFCLF 231
           E              AKLSCGG IEAC+AVVEGRVKN+LA+VRPPGHHAEP+ AGGFCLF
Sbjct: 157 EAGDSVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLF 216

Query: 232 SNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPG 291
           SNV+VAAR+IL+ YPESVRK++ILDWDIHHGNGTQ+AFY D  VLY+SLHRYE   +YPG
Sbjct: 217 SNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPG 276

Query: 292 TIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
           T +G Y+Q GEGKGEGFNCNI W  GGVGDAEYMWAFE +V+P+GREF+PDLVI+SSG
Sbjct: 277 TEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSG 334

 Score =  245 bits (625), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 160/219 (73%), Gaps = 2/219 (0%)

Query: 360 VLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAADRNYSIL 419
           ++ S  I + +TL+I VHDTPE+W  R+ +TG +DPSTS+++DT++    WA  R+Y I+
Sbjct: 488 IICSPNIHETDTLIICVHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITNWALGRSYGII 547

Query: 420 DINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGIVHLIGER 479
           DINIP+S  E + +S+   + E++  LWD++L++ + LT++ F+GIG++Y G VHL+G R
Sbjct: 548 DINIPQSLFELDNYSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDAYSGFVHLLGHR 607

Query: 480 DLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCW--KESEEKRPRK 537
           D R + K  I+F     L+ L    DE++ DWYFKNSL+FT+  H+CW  + ++ K+PRK
Sbjct: 608 DTRSIVKCAISFTDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWGTEGNDSKKPRK 667

Query: 538 KFGRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEE 576
           KFGRVLK +SDG+ +I+ ERF+EATDFILD+FEEWSD E
Sbjct: 668 KFGRVLKCNSDGMNNILEERFEEATDFILDSFEEWSDSE 706

>SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 712

 Score =  481 bits (1239), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 216/295 (73%), Positives = 250/295 (84%)

Query: 55  VIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENG 114
           VIVP   P++HYT LKTGLCYDVRMRYHAKI+TS FEYIDPHPEDPRR+YRIYKILAENG
Sbjct: 46  VIVPEVPPRIHYTQLKTGLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENG 105

Query: 115 LIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLTEKA 174
           LI+D  LSG+D+IG++MLKIPVR AT EEIL VHT+EHL F+E     +RE+L+K TE  
Sbjct: 106 LIRDPTLSGVDEIGELMLKIPVREATAEEILQVHTKEHLAFLEKTPKMTREQLLKETETG 165

Query: 175 XXXXXXXXXXXXAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAGGFCLFSNV 234
                       AKLSCGG IEAC+AVVEGRVKN+LA++RPPGHHAEP+ AGGFCLFSNV
Sbjct: 166 DSVYFNNDSLLSAKLSCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEIAGGFCLFSNV 225

Query: 235 SVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIH 294
           +VAA++IL+ YPESVR+I+ILDWDIHHGNGTQKAFY D  VLY+SLHRYE   +YPGT+H
Sbjct: 226 AVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVH 285

Query: 295 GRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
           G Y+Q GEGKGEGFNCNI WP GG+GDAEYMWAF+ VVMP+GREF+PDLVI+SSG
Sbjct: 286 GNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSG 340

 Score =  268 bits (684), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 117/226 (51%), Positives = 170/226 (75%), Gaps = 2/226 (0%)

Query: 353 MKPHEKLVLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAA 412
           M+  +  V+ S  I+ AET+V+ VHDTPE+W  R+ ITG +DPSTS+++DT++  IKW+ 
Sbjct: 487 MEVPQDTVICSPNIYDAETVVVCVHDTPEIWAQRNPITGTIDPSTSIIVDTTLDIIKWSL 546

Query: 413 DRNYSILDINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGI 472
            R YS++D+NIP+S  E++ +S+   + E+++ +WDN+L+Y  +L K+ FIG+G++Y GI
Sbjct: 547 QRKYSVIDVNIPQSLFEQDNYSAMITSQEVLVYIWDNYLKYFPSLAKVAFIGVGDAYSGI 606

Query: 473 VHLIGERDLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWKE--S 530
           VHL+G RD R + KA ++FV   PLKSL    DE++ +WYFKNSLVFT+ +H+CW    +
Sbjct: 607 VHLLGHRDTRSVVKAAVSFVDTKPLKSLVPLVDESLGNWYFKNSLVFTSKNHSCWGTDGN 666

Query: 531 EEKRPRKKFGRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEE 576
           E K+PRK+FGRVLK D+ G+ +I+ ERF EATDFILD+FEEWSD E
Sbjct: 667 ENKKPRKRFGRVLKCDTTGMNNIVEERFQEATDFILDSFEEWSDSE 712

>ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL021W
           (HDA1)
          Length = 705

 Score =  468 bits (1205), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 212/298 (71%), Positives = 249/298 (83%)

Query: 52  KRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILA 111
           KR VIVP  +PK+ Y PLKTGLCYDVRMRYHAKIFTS FEYIDPHPEDPRR+YRIYKILA
Sbjct: 33  KRPVIVPPVRPKISYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 92

Query: 112 ENGLIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLT 171
           ENGLI+D  LSG+D+IG++M KIPVR ATEEEIL VH++EH++F++   +  RE+L+K T
Sbjct: 93  ENGLIEDPTLSGIDEIGELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQLLKET 152

Query: 172 EKAXXXXXXXXXXXXAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAGGFCLF 231
           E              A+LSCGG IEAC+AVVEGRVKN++A+VRPPGHHAEP  AGGFCLF
Sbjct: 153 EAGDSVYYNNDSLISARLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLF 212

Query: 232 SNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPG 291
           SNV+VAA++IL+ YPESVR+++ILDWDIHHGNGTQKAFY D  VLY+SLHRYE   +YPG
Sbjct: 213 SNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPG 272

Query: 292 TIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
           T +G YDQ G+GKGEGFNCNI W   GVGDAEYMWAFE VV+P+GREF+PDLVI+SSG
Sbjct: 273 TSYGNYDQCGDGKGEGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSG 330

 Score =  236 bits (603), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 116/279 (41%), Positives = 170/279 (60%), Gaps = 6/279 (2%)

Query: 304 KGEGFNCNITWPVGGVGDA--EYMWAFEHVVMPLG--REFRPDLVIVSSGXXXMKPHEKL 359
           KG   N  I W  G V D+     +  +    P    R    +   V+     M+     
Sbjct: 427 KGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRLAKEYKFVTLPLLNMELPSDT 486

Query: 360 VLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAADRNYSIL 419
           ++ S  I   + ++I VHDTPE+W  RD +TG +DPSTS+++DT++  I WA  RNY ++
Sbjct: 487 IICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSIIVDTTVSVINWALGRNYGVI 546

Query: 420 DINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGIVHLIGER 479
           DINIP+S  E++ +S+  ++ E++  LWD++L+    L ++ F+GIG++Y G VHL+G R
Sbjct: 547 DINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLARVAFVGIGDAYSGFVHLLGHR 606

Query: 480 DLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWKE--SEEKRPRK 537
           D R + K  I F     L+ L    DE++ DWYFKNSLVFT+  H CW    ++ K+PRK
Sbjct: 607 DTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVFTSTYHPCWGTDGNDSKKPRK 666

Query: 538 KFGRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEE 576
           KFGRVL+   DG+ +I+ ER +EATDFILD+FEEWS+ E
Sbjct: 667 KFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705

>Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON}
           (99859..101838) [1980 nt, 660 aa]
          Length = 659

 Score =  460 bits (1183), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 205/286 (71%), Positives = 243/286 (84%)

Query: 64  LHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSG 123
           L YTPLKTGLCYDVRMRYHAKI+TS +EYIDPHPEDPRR+YRIYKILAENGLI+D  LSG
Sbjct: 5   LSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSG 64

Query: 124 LDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLTEKAXXXXXXXXX 183
           +DDIGD+M KIPVR AT EEIL VH +E L+++E  +  +R+EL+  TE           
Sbjct: 65  IDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNNDS 124

Query: 184 XXXAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAGGFCLFSNVSVAARSILR 243
              AKLSCGG IEAC+A+V+G+VKNSLAIVRPPGHH+EP+ AGGFCLFSNV+VA ++IL+
Sbjct: 125 YFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILK 184

Query: 244 TYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEG 303
            YP+ V+K++I+DWDIHHGNGTQKAFY D+ VLY+SLHR+E   +YPGTIHG+YDQVGEG
Sbjct: 185 NYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEG 244

Query: 304 KGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
           KGEGFNCNI W VGG+GDAEY+WAFE +VMP+GREFRPDLVIVSSG
Sbjct: 245 KGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSG 290

 Score =  259 bits (663), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 162/219 (73%)

Query: 357 EKLVLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAADRNY 416
           E  V+ S  I ++   +I VHDTPE+W  RD I GV+D S S+ +D S++F  WA DR Y
Sbjct: 441 EDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSASLYMDASLQFYDWALDRGY 500

Query: 417 SILDINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGIVHLI 476
            I+D+NIP++  E++ +S+S  A E+++ LWDN+L+Y   + KI +IG+GE+Y G+VHL+
Sbjct: 501 GIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVNKIAYIGVGEAYSGLVHLL 560

Query: 477 GERDLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWKESEEKRPR 536
           G RD R + K+VI FVG  PLK+L    +E++ DWYFK SL+F + +H+CW E++ K+PR
Sbjct: 561 GHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLLFADKNHSCWGENDSKKPR 620

Query: 537 KKFGRVLKSDSDGIISIINERFDEATDFILDAFEEWSDE 575
           K++GRVL+ DSDGI S+I ERF+EATDFI+D+ +EW++E
Sbjct: 621 KRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTEE 659

>KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {ON}
           Anc_8.153 YGL194C
          Length = 453

 Score =  122 bits (305), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 87/294 (29%), Positives = 146/294 (49%), Gaps = 30/294 (10%)

Query: 72  GLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIM 131
           G  Y  R+ YH     SN+ Y   HP  P R+     +++  GL K            IM
Sbjct: 23  GSSYTPRVSYHFNPKVSNYHYGVNHPMKPFRLMLTDHLVSSYGLHK------------IM 70

Query: 132 LKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLT-EK---AXXXXXXXXXXXXA 187
                R AT+EE+   H+ ++LDF+E I   +  ++ + T EK                +
Sbjct: 71  DLYETREATKEEMSQFHSSDYLDFLEKISPDTLNKIPRGTLEKFNIGSDCPIFENIYDYS 130

Query: 188 KLSCGGVIEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYP 246
            L  G  ++A R ++ G  ++ +AI    G HHA+     GFC  +++ ++  ++LR +P
Sbjct: 131 TLYTGASLDASRKLING--QSEIAINWSGGLHHAKKNNPSGFCYINDIVLSILNLLRYHP 188

Query: 247 ESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGE 306
               ++L +D D+HHG+G Q+AFY  + V  IS H+Y    F+PGT  G YD++G   G+
Sbjct: 189 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYNG-EFFPGT--GNYDEIGCSGGK 241

Query: 307 GFNCNITWPVG-GVGDAEYMWAFEHVVMPLGREFRPDLVIVSSGXXXMKPHEKL 359
            F  N+  P+  G+ D  Y+  F+ ++ PL   ++P ++I   G   +  H++L
Sbjct: 242 HFAMNV--PLNDGIDDDSYIKLFKSIIDPLITSYQPTVIIQQCGADSLG-HDRL 292

>AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL194C
           (HOS2)
          Length = 449

 Score =  120 bits (302), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 85/295 (28%), Positives = 145/295 (49%), Gaps = 32/295 (10%)

Query: 72  GLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIM 131
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL K            +M
Sbjct: 21  GASYTPRVSYHYNSRVSQYHYGVRHPMKPFRLMLTDHLVSRYGLHK------------VM 68

Query: 132 LKIPVRTATEEEILAVHTREHLDFI-----ENIESQSREELIKLTEKAXXXXXXXXXXXX 186
                R AT+EE+LA H ++++DF+     EN+    R  L K                 
Sbjct: 69  DLYETRAATKEEVLAFHAQDYVDFLSHVAPENLNKLPRGSLEKFN-IGDDCPIFQGLFEY 127

Query: 187 AKLSCGGVIEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTY 245
           + L  G  ++A R ++ G  ++ +AI    G HHA+     GFC  +++ +A  ++LR +
Sbjct: 128 SMLYAGASLDASRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLRYH 185

Query: 246 PESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKG 305
           P    ++L +D D+HHG+G Q+AFY  + V  +S H+Y    F+PGT  G  D++G  +G
Sbjct: 186 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYNG-EFFPGT--GDLDEIGCSRG 238

Query: 306 EGFNCNITWPVG-GVGDAEYMWAFEHVVMPLGREFRPDLVIVSSGXXXMKPHEKL 359
           + F+ N+  P+  G+ D  Y+  F+ ++ PL   ++P ++I   G   +  H++L
Sbjct: 239 KHFSLNV--PLNDGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLG-HDRL 290

>ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  119 bits (299), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 84/296 (28%), Positives = 146/296 (49%), Gaps = 28/296 (9%)

Query: 69  LKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIG 128
            + G  Y  R+ YH     SN+ Y   HP  P R+     +++  GL K           
Sbjct: 17  FQFGSSYCPRVSYHFNPKVSNYHYGTKHPMKPFRLMLTDHLVSSYGLHK----------- 65

Query: 129 DIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLT-EK---AXXXXXXXXXX 184
            IM     R AT EE+ A H+ E++DF++ +  ++  +L + T EK              
Sbjct: 66  -IMDLYETRVATWEEMTAFHSEEYVDFMKRVTPENLNKLPRGTLEKFNIGDDCPIFPNLY 124

Query: 185 XXAKLSCGGVIEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILR 243
             + L  G  ++A R ++    ++ +AI    G HHA+     GFC  +++ +A  ++LR
Sbjct: 125 DYSSLYAGASLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLLR 182

Query: 244 TYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEG 303
            +P    ++L +D D+HHG+G Q+AFY  + V  +S H+Y    F+PGT  G +D+VG  
Sbjct: 183 YHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYNG-EFFPGT--GNHDEVGCA 235

Query: 304 KGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSGXXXMKPHEKL 359
           +G+ F  N+     G+ D  Y+  F+ ++ PL   ++P +++   G   +  H++L
Sbjct: 236 RGKHFALNVPLQ-DGIDDDSYINLFKSIIDPLITSYKPTVIVQQCGADSLG-HDRL 289

>TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {ON}
           Anc_8.153 YGL194C
          Length = 446

 Score =  119 bits (298), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 85/284 (29%), Positives = 135/284 (47%), Gaps = 29/284 (10%)

Query: 72  GLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIM 131
           G  Y  R+ YH     SN+ Y   HP  P R+     +++  GL K            IM
Sbjct: 21  GSAYCPRVSYHFNPKVSNYHYGVRHPMKPFRLLLTDHLVSSYGLHK------------IM 68

Query: 132 LKIPVRTATEEEILAVHTREHLDFI-----ENIESQSREELIKLTEKAXXXXXXXXXXXX 186
                R AT EEI   HT++++DF+     EN+    R  L K                 
Sbjct: 69  DLYETRVATSEEIAEFHTQDYIDFLHKVTPENLSKMPRGTLEKFN-IGDDCPIFQNLFNY 127

Query: 187 AKLSCGGVIEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTY 245
            KL  G  ++A R ++    ++ +AI    G HHA+     GFC  +++ +A  ++LR +
Sbjct: 128 CKLYAGASLDAARKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLRYH 185

Query: 246 PESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKG 305
           P    ++L +D D+HHG+G Q+AFY  + V  +S H+Y    F+PGT  G +D+VG   G
Sbjct: 186 P----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYNG-EFFPGT--GNHDEVGCANG 238

Query: 306 EGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
           + F  N+     G+ D  Y+  F+ ++ PL   ++P ++I   G
Sbjct: 239 KHFAMNVPLE-DGIDDDSYINLFKSIMDPLITSYKPTVIIQQCG 281

>Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON}
           (11759..13120) [1362 nt, 454 aa]
          Length = 453

 Score =  119 bits (297), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 82/293 (27%), Positives = 146/293 (49%), Gaps = 28/293 (9%)

Query: 72  GLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIM 131
           G  Y  R+ YH     SN+ Y   HP  P R+     +++  GL K            IM
Sbjct: 25  GSAYCPRVSYHFNPKVSNYHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IM 72

Query: 132 LKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLT-EK---AXXXXXXXXXXXXA 187
                R+AT++E+L  H+ +++ F++ +  ++  ++ + T EK                +
Sbjct: 73  DLYETRSATKDELLDFHSDDYVSFLQKVTPENLSKMPRGTLEKYNIGDDCPIFQNLYDYS 132

Query: 188 KLSCGGVIEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYP 246
            L  G  ++A R ++    ++ +AI    G HHA+     GFC  +++ +A  ++LR +P
Sbjct: 133 ALYAGASLDASRKLINN--QSDIAINWSGGLHHAKKTNPSGFCYVNDIVLAILNLLRYHP 190

Query: 247 ESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGE 306
               ++L +D D+HHG+G Q+AFY  + V  IS H+Y    F+PGT  G YD++G  +G+
Sbjct: 191 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYNG-EFFPGT--GNYDEIGCAQGK 243

Query: 307 GFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSGXXXMKPHEKL 359
            F  N+     G+ D  Y+  F+ ++ PL   ++P ++I   G   +  H++L
Sbjct: 244 HFAMNVPLE-DGIDDDSYINLFKSIIDPLITSYKPTVIIQQCGADSLG-HDRL 294

>TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}
           Anc_8.153 YGL194C
          Length = 450

 Score =  118 bits (295), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 82/294 (27%), Positives = 142/294 (48%), Gaps = 30/294 (10%)

Query: 72  GLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIM 131
           G  Y  R+ YH     SN+ Y   HP  P R      +++  GL             +IM
Sbjct: 22  GSTYSPRVSYHYNPKVSNYHYGVKHPMKPFRFMLTDHLVSSYGL------------HNIM 69

Query: 132 LKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLT----EKAXXXXXXXXXXXXA 187
                R AT+EE+L  H+ ++++F+  +   +  ++ + T                    
Sbjct: 70  DLYETREATKEELLQFHSEDYVEFLSKVSPDNISKMPRGTFDKYNIGDDCPIFQNIYEYC 129

Query: 188 KLSCGGVIEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYP 246
           KL  G  ++A R ++    ++ +AI    G HHA+     GFC  +++ +A  ++LR +P
Sbjct: 130 KLYAGASLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLLRYHP 187

Query: 247 ESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGE 306
               ++L +D D+HHG+G Q+AFY  + V  +S H+Y    F+PGT  G YD++G  +G+
Sbjct: 188 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYNG-EFFPGT--GNYDEIGCAEGK 240

Query: 307 GFNCNITWPVG-GVGDAEYMWAFEHVVMPLGREFRPDLVIVSSGXXXMKPHEKL 359
            F  N+  P+  G+ D  Y+  F+ V+ P+   F+P  +I   G   +  H++L
Sbjct: 241 HFAMNV--PLNDGIDDDSYINLFKSVMEPIITSFKPTAIIQQCGADSLG-HDRL 291

>NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153
          Length = 453

 Score =  117 bits (293), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 83/291 (28%), Positives = 139/291 (47%), Gaps = 30/291 (10%)

Query: 75  YDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIMLKI 134
           Y  R+ YH     SN+ Y   HP  P R+     +++  GL K            IM   
Sbjct: 28  YTPRVSYHFNPKVSNYHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IMDLY 75

Query: 135 PVRTATEEEILAVHTREHLDFI-----ENIESQSREELIKLTEKAXXXXXXXXXXXXAKL 189
             R AT EE++  H+ ++LDF+     EN+    R  L K                 + L
Sbjct: 76  ETRPATNEEMVQFHSEDYLDFLSKVTPENLSKMPRGTLEKFN-IGDDCPIFQNLYDYSTL 134

Query: 190 SCGGVIEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYPES 248
             G  ++A R ++    ++ +AI    G HHA+     GFC  +++ ++  ++LR +P  
Sbjct: 135 YTGASLDATRKLIND--QSDIAINWSGGLHHAKKNNPSGFCYINDIVLSIVNLLRYHP-- 190

Query: 249 VRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGF 308
             ++L +D D+HHG+G Q+AFY  + V  IS H++    F+PGT  G YD+ G  KG+ F
Sbjct: 191 --RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFNG-EFFPGT--GDYDETGCAKGKHF 245

Query: 309 NCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSGXXXMKPHEKL 359
             N+     G+ D  Y+  F+ ++ PL   ++P +++   G   +  H++L
Sbjct: 246 AMNVPLE-DGIDDDSYINLFKSIMDPLITSYKPTVIVQQCGADSLG-HDRL 294

>NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa]
           {ON} Anc_8.153
          Length = 451

 Score =  117 bits (292), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 85/305 (27%), Positives = 146/305 (47%), Gaps = 33/305 (10%)

Query: 61  QPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDEN 120
           QP+  Y   + G  Y  R+ YH     SN+ Y   HP  P R+     +++  GL K   
Sbjct: 15  QPQFEY---EFGSSYTPRVSYHFNPKVSNYHYGVRHPMKPFRLMLTDHLVSSYGLHK--- 68

Query: 121 LSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFI-----ENIESQSREELIKLTEKAX 175
                    IM     R AT EE+   H++++++F+     EN+    R  L K      
Sbjct: 69  ---------IMDLYETREATREEMSQFHSQDYIEFLSKVTPENLSKMPRGTLEKFN-IGD 118

Query: 176 XXXXXXXXXXXAKLSCGGVIEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNV 234
                      + L  G  ++A R ++    ++ +AI    G HHA+     GFC  +++
Sbjct: 119 DCPIFQNIYDYSTLYTGASLDASRKLIND--QSDIAINWSGGLHHAKKNNPSGFCYVNDI 176

Query: 235 SVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIH 294
            ++  ++LR +P    ++L +D D+HHG+G Q+AFY  + V  IS H++    F+PGT  
Sbjct: 177 VLSILNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFNG-EFFPGT-- 229

Query: 295 GRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSGXXXMK 354
           G +D++G  KG+ F  N+     G+ D  Y+  F+ ++ PL   ++P ++I   G   + 
Sbjct: 230 GDFDEIGCAKGKHFAMNVPLE-DGIDDDSYINLFKSIIDPLITAYKPTVIIQQCGADSLG 288

Query: 355 PHEKL 359
            H++L
Sbjct: 289 -HDRL 292

>TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {ON}
           Anc_8.153 YGL194C
          Length = 456

 Score =  115 bits (288), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 83/305 (27%), Positives = 147/305 (48%), Gaps = 33/305 (10%)

Query: 61  QPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDEN 120
           QP+ +Y   + G  Y  R+ YH     S++ +   HP  P R+     +++  GL K   
Sbjct: 15  QPQFNY---EFGSTYAPRVSYHFNPKVSSYHFGVRHPMKPFRLMLTDHLVSGYGLHK--- 68

Query: 121 LSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFI-----ENIESQSREELIKLTEKAX 175
                    IM     R A+++E+L  HT ++++F+     +N+    R  L K      
Sbjct: 69  ---------IMDLYETRKASDDELLEFHTDDYINFLKKVNPDNVNKMPRGTLDKFN-IGD 118

Query: 176 XXXXXXXXXXXAKLSCGGVIEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNV 234
                      + L  G  ++A R ++ G  ++ +AI    G HHA+  +  GFC  +++
Sbjct: 119 DCPIFHNLYEYSSLYTGASLDASRKLLNG--QSDIAINWSGGLHHAKKTSPSGFCYINDI 176

Query: 235 SVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIH 294
            ++  ++LR +P    ++L +D D+HHG+G Q+AFY  + V  +S H+Y    F+PGT  
Sbjct: 177 VLSILNLLRFHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYNG-EFFPGT-- 229

Query: 295 GRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSGXXXMK 354
           G YD+ G   G+ F  N+     G+ D  Y+  F+ ++ PL   + P ++I   G   + 
Sbjct: 230 GNYDETGCSNGKHFALNVPLK-DGIDDDSYINLFKSIIDPLITSYNPTVIIQQCGADSLG 288

Query: 355 PHEKL 359
            H++L
Sbjct: 289 -HDRL 292

>SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  115 bits (288), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 80/299 (26%), Positives = 145/299 (48%), Gaps = 28/299 (9%)

Query: 66  YTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLD 125
           Y P + G  Y   + YH     S + Y   HP  P R+     +++  GL K        
Sbjct: 14  YLPYEFGSTYSPHVSYHFNSDVSQYHYGVRHPMKPFRLMLTDHLVSSYGLHK-------- 65

Query: 126 DIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLT-EK---AXXXXXXX 181
               IM     R AT +E+L  H+ ++++F+  +   +  ++ + + EK           
Sbjct: 66  ----IMDLYETREATRDELLEFHSADYIEFLSKVSPDTLSKMPRGSLEKFNIGDDCPIFQ 121

Query: 182 XXXXXAKLSCGGVIEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARS 240
                + L  G  ++A R ++ G  ++ +AI    G HHA+     GFC  +++ +A  +
Sbjct: 122 GIFEYSSLYAGASLDASRKLIAG--QSEIAINWSGGLHHAKKAKPSGFCYVNDIVLAILN 179

Query: 241 ILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQV 300
           +LR +P    ++L +D D+HHG+G Q+AFY  + V  +S H+Y    F+PGT  G +D++
Sbjct: 180 LLRFHP----RVLYVDIDLHHGDGVQEAFYTTDRVFTVSFHKYNG-EFFPGT--GDFDEI 232

Query: 301 GEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSGXXXMKPHEKL 359
           G  +G+ F  N+     G+ D  Y+  F+ ++ PL   ++P ++I   G   +  H++L
Sbjct: 233 GCSRGKHFALNVPLD-DGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLG-HDRL 289

>KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 452

 Score =  114 bits (286), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 80/293 (27%), Positives = 143/293 (48%), Gaps = 28/293 (9%)

Query: 72  GLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIM 131
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL K            +M
Sbjct: 24  GTSYSPRVSYHFNSKVSQYHYGVKHPMKPFRLMLTDHLVSAYGLHK------------VM 71

Query: 132 LKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLT-EK---AXXXXXXXXXXXXA 187
                R+AT++E+   H+ ++++F+  +   +  +L + + EK                A
Sbjct: 72  DLYETRSATKDELTKFHSEDYVNFLAKVTPDTLNKLPRGSLEKFNIGDDCPIFQGMFDYA 131

Query: 188 KLSCGGVIEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYP 246
            L  G  ++A R ++ G  ++ +AI    G HHA+     GFC  +++ +A  ++LR +P
Sbjct: 132 ALYAGASLDASRKLLNG--QSEIAINWSGGLHHAKKNNPSGFCYVNDIVLAIVNLLRYHP 189

Query: 247 ESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGE 306
               ++L +D D+HHG+G Q+AFY  + V  +S H+Y    F+PGT  G  D++G  +G+
Sbjct: 190 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYNG-EFFPGT--GDLDEIGCSRGK 242

Query: 307 GFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSGXXXMKPHEKL 359
            F  N+     G+ D  Y+  F+ ++ P+   FRP ++I   G   +  H++L
Sbjct: 243 HFALNVPLQ-DGIEDDSYINLFKSIIDPVITSFRPSVIIQQCGADSLG-HDRL 293

>YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}
           HOS2Histone deacetylase required for gene activation via
           specific deacetylation of lysines in H3 and H4 histone
           tails; subunit of the Set3 complex, a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity
          Length = 452

 Score =  114 bits (285), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 79/290 (27%), Positives = 141/290 (48%), Gaps = 28/290 (9%)

Query: 75  YDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIMLKI 134
           Y  R+ YH     S++ Y   HP  P R+     +++  GL K            IM   
Sbjct: 24  YSPRVSYHFNSKVSHYHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IMDLY 71

Query: 135 PVRTATEEEILAVHTREHLDFIENIESQSREELIKLTEK----AXXXXXXXXXXXXAKLS 190
             R+AT +E+L  H+ ++++F+  +  ++  +L + T +                   L 
Sbjct: 72  ETRSATRDELLQFHSEDYVNFLSKVSPENANKLPRGTLENFNIGDDCPIFQNLYDYTTLY 131

Query: 191 CGGVIEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYPESV 249
            G  ++A R ++    ++ +AI    G HHA+  +  GFC  +++ ++  ++LR +P   
Sbjct: 132 TGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP--- 186

Query: 250 RKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFN 309
            +IL +D D+HHG+G Q+AFY  + V  +S H+Y    F+PGT  G   ++G  KG+ F 
Sbjct: 187 -RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYNG-EFFPGT--GDLTEIGCDKGKHFA 242

Query: 310 CNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSGXXXMKPHEKL 359
            N+     G+ D  Y+  F+ +V PL   F+P L++   G   +  H++L
Sbjct: 243 LNVPLE-DGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLG-HDRL 290

>Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  114 bits (284), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 82/304 (26%), Positives = 143/304 (47%), Gaps = 33/304 (10%)

Query: 61  QPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDEN 120
           QP   Y        Y  R+ YH     S++ Y   HP  P R+     +++  GL K   
Sbjct: 15  QPSFEYNS-----AYSPRVSYHFNSKVSHYHYGVKHPMKPFRLMLTDHLVSSYGLHK--- 66

Query: 121 LSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLTEK----AXX 176
                    IM     R+AT +E+L  H+ ++++F+  +   +  +L + T +       
Sbjct: 67  ---------IMDLYETRSATRDELLQFHSEDYVNFLSKVSPDNANKLPRGTLENFNIGDD 117

Query: 177 XXXXXXXXXXAKLSCGGVIEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVS 235
                       L  G  ++A R ++    ++ +AI    G HHA+  +  GFC  +++ 
Sbjct: 118 CPIFQNLYDYTTLYTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIV 175

Query: 236 VAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHG 295
           ++  ++LR +P    +IL +D D+HHG+G Q+AFY  + V  +S H+Y    F+PGT  G
Sbjct: 176 LSILNLLRYHP----RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYNG-EFFPGT--G 228

Query: 296 RYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSGXXXMKP 355
              ++G  KG+ F  N+     G+ D  Y+  F+ +V PL   F+P L++   G   +  
Sbjct: 229 DLTEIGCDKGKHFALNVPLE-DGIDDDSYINLFKSIVDPLIITFKPTLIVQQCGADSLG- 286

Query: 356 HEKL 359
           H++L
Sbjct: 287 HDRL 290

>Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}
           similar to Ashbya gossypii AFR172C
          Length = 485

 Score =  114 bits (285), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 84/298 (28%), Positives = 142/298 (47%), Gaps = 30/298 (10%)

Query: 68  PLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDI 127
           P + G  Y  ++ YH     S + Y   HP  P R+     +++  GL K          
Sbjct: 53  PFEFGSSYSPQVSYHFNPKVSQYHYGVRHPMKPFRLMLTDHLVSCYGLHK---------- 102

Query: 128 GDIMLKIPVRTATEEEILAVHTREHLDFI-----ENIESQSREELIKLTEKAXXXXXXXX 182
             IM     R AT+EE+L  H  ++++F+     EN+    R  L K             
Sbjct: 103 --IMDLYETREATKEELLEFHAPDYIEFLSHVTPENLNKLPRGSLEKFN-IGDDCPIFQG 159

Query: 183 XXXXAKLSCGGVIEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSI 241
               + L  G  ++A R ++    ++ +AI    G HHA+     GFC  +++ +A  S+
Sbjct: 160 MFDYSILYAGASLDAARKLINN--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAIISL 217

Query: 242 LRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVG 301
           LR +P    ++L +D D+HHG+G Q+AFY  + V  +S H+Y    F+PGT  G  D++G
Sbjct: 218 LRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYNG-EFFPGT--GDLDEIG 270

Query: 302 EGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSGXXXMKPHEKL 359
             KG+ F+ N+     G+ D  Y+  F+ ++ PL   ++P ++I   G   +  H++L
Sbjct: 271 CSKGKKFSLNVPLQ-DGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLG-HDRL 326

>Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  114 bits (284), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 79/290 (27%), Positives = 140/290 (48%), Gaps = 28/290 (9%)

Query: 75  YDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIMLKI 134
           Y  R+ YH     S++ Y   HP  P R+     +++  GL K            IM   
Sbjct: 24  YSPRVSYHFNPKVSHYHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IMDLY 71

Query: 135 PVRTATEEEILAVHTREHLDFIENIESQSREELIKLTEK----AXXXXXXXXXXXXAKLS 190
             R+AT +E+L  H+ ++++F+  +   +  +L + T +                   L 
Sbjct: 72  ETRSATRDELLEFHSEDYINFLSKVSPDNSNKLPRGTLENFNIGDDCPIFQNLYDYTTLY 131

Query: 191 CGGVIEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYPESV 249
            G  ++A R ++    ++ +AI    G HHA+  +  GFC  +++ ++  ++LR +P   
Sbjct: 132 TGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP--- 186

Query: 250 RKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFN 309
            +IL +D D+HHG+G Q+AFY  + V  +S H+Y    F+PGT  G   ++G  KG+ F 
Sbjct: 187 -RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYNG-EFFPGT--GDLTEIGCDKGKHFA 242

Query: 310 CNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSGXXXMKPHEKL 359
            N+     G+ D  Y+  F+ +V PL   F+P L++   G   +  H++L
Sbjct: 243 LNVPLE-DGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLG-HDRL 290

>KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {ON}
           highly similar to uniprot|P53096 Saccharomyces
           cerevisiae YGL194C HOS2 Histone deacetylase required for
           gene activation via specific deacetylation of lysines in
           H3 and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 449

 Score =  113 bits (282), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 81/293 (27%), Positives = 140/293 (47%), Gaps = 28/293 (9%)

Query: 72  GLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIM 131
           G  Y+  + YH     S F Y   HP  P R+     +++  GL K            IM
Sbjct: 21  GAPYEPNVSYHFNSDVSQFHYGVRHPMKPFRLMLTDHLVSSYGLHK------------IM 68

Query: 132 LKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLT-EK---AXXXXXXXXXXXXA 187
                R AT EE+   H  ++++F+  +   +  +L + T EK                +
Sbjct: 69  DLYETRPATREELCEFHADDYVEFLAKVSPDNLSKLPRGTLEKFNIGDDCPIFQGLYQYS 128

Query: 188 KLSCGGVIEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYP 246
            L  G  ++A R ++ G  ++ +AI    G HHA+  +  GFC  +++ ++  ++LR +P
Sbjct: 129 TLYAGASLDATRKLING--QSEIAINWSGGLHHAKKSSPSGFCYVNDIVLSVLNLLRYHP 186

Query: 247 ESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGE 306
               ++L +D D+HHG+G Q+AFY  + V  +S H+Y    F+PGT  G  D+ G  +G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYNG-EFFPGT--GNLDETGCSRGK 239

Query: 307 GFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSGXXXMKPHEKL 359
            F  N+     G+ D  Y+  F+ ++ PL   F+P ++I   G   +  H++L
Sbjct: 240 HFALNVPLE-DGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLG-HDRL 290

>Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  113 bits (282), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 77/290 (26%), Positives = 141/290 (48%), Gaps = 28/290 (9%)

Query: 75  YDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIMLKI 134
           Y  R+ YH     S++ Y   HP  P R+     +++  GL K            IM   
Sbjct: 24  YSPRVSYHFNPKASHYHYGVKHPMKPIRLMLTDHLVSSYGLHK------------IMDLY 71

Query: 135 PVRTATEEEILAVHTREHLDFIENIESQSREELIKLTEK----AXXXXXXXXXXXXAKLS 190
             R+AT++E+   HT ++++F+  +  ++  +L + T +                   L 
Sbjct: 72  ETRSATKDELFEFHTEDYVNFLSKVSPENVNKLPRGTLENFNIGDDCPIFQNLYDYTTLY 131

Query: 191 CGGVIEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYPESV 249
            G  ++A R ++    ++ +AI    G HHA+  +  GFC  +++ ++  ++LR +P   
Sbjct: 132 TGATLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP--- 186

Query: 250 RKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFN 309
            ++L +D D+HHG+G Q+AFY  + V  +S H+Y    F+PGT  G   ++G  KG+ F 
Sbjct: 187 -RVLYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYNG-EFFPGT--GDLTEIGCDKGKHFA 242

Query: 310 CNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSGXXXMKPHEKL 359
            N+     G+ D  Y+  F+ +V PL   F+P +++   G   +  H++L
Sbjct: 243 LNVPLE-DGIDDDSYINLFKSIVDPLITTFKPTVIVQQCGADSLG-HDRL 290

>Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {ON}
           YGL194C (HOS2) - (putative) histone deacetylase [contig
           139] FULL
          Length = 449

 Score =  110 bits (275), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 80/296 (27%), Positives = 139/296 (46%), Gaps = 34/296 (11%)

Query: 72  GLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIM 131
           G  +   + YH     S F Y   HP  P R+     +++  GL K            IM
Sbjct: 21  GASHQPAVSYHFNDDVSQFHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IM 68

Query: 132 LKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLTEKAXXXXXX-------XXXX 184
                R AT EE+   H+ ++++F+  +   S + L KL   +                 
Sbjct: 69  DLYETRPATREELCEFHSEDYVEFLARV---SPDNLAKLPRGSLEKFNIGDDCPIFQGLY 125

Query: 185 XXAKLSCGGVIEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILR 243
             + L  G  ++A R ++ G  ++ +AI    G HHA+     GFC  +++ ++  ++LR
Sbjct: 126 QYSTLYAGASLDATRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLSVLNLLR 183

Query: 244 TYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEG 303
            +P    ++L +D D+HHG+G Q+AFY  + V  +S H+Y    F+PGT  G  D++G  
Sbjct: 184 YHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYNG-EFFPGT--GNLDEIGCS 236

Query: 304 KGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSGXXXMKPHEKL 359
           +G+ F  N+     G+ D  Y+  F+ ++ PL   F+P ++I   G   +  H++L
Sbjct: 237 RGKHFALNVPLD-DGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLG-HDRL 290

>CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194c HOS2 or uniprot|P32561 Saccharomyces cerevisiae
           YNL330c RPD3
          Length = 450

 Score =  110 bits (274), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 83/300 (27%), Positives = 146/300 (48%), Gaps = 29/300 (9%)

Query: 66  YTPL-KTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGL 124
           + PL + G  Y  R+ YH     S++ Y   HP  P R+     +++  GL K       
Sbjct: 14  FQPLYEFGSNYAPRVSYHINPEVSHYHYGVRHPMKPFRLMLTDHLVSGYGLHK------- 66

Query: 125 DDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLT-EK---AXXXXXX 180
                IM     R AT EE+   H+ ++++F+  +  ++  +L + T EK          
Sbjct: 67  -----IMDLYKTRKATAEEMEEFHSEDYVNFLSKVTPENLSKLPRGTLEKFNIGDDCPIF 121

Query: 181 XXXXXXAKLSCGGVIEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAAR 239
                 + L  G  ++A R ++    ++ +AI    G HHA+  +  GFC  +++ +A  
Sbjct: 122 PNIFQYSSLYTGASLDASRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYINDIVLAIL 179

Query: 240 SILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQ 299
           ++LR +P    ++L +D D+HHG+G Q+AFY  + V  IS H+Y    F+PGT  G+ D+
Sbjct: 180 NLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYNG-EFFPGT--GKNDE 232

Query: 300 VGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSGXXXMKPHEKL 359
            G   G+ F  N+     G+ D  Y+  F+ ++ PL   F+P +++   G   +  H++L
Sbjct: 233 TGCADGKHFAMNVPLE-DGIDDDSYINLFKSIIDPLITTFKPTVILQQCGADSLG-HDRL 290

>KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.153
           YGL194C
          Length = 451

 Score =  109 bits (273), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 81/296 (27%), Positives = 141/296 (47%), Gaps = 28/296 (9%)

Query: 69  LKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIG 128
            + G    +R+ YH     S++ Y   HP  P R+     +++  G+ K           
Sbjct: 19  FELGAARPLRVSYHFNPKVSHYHYGVKHPMKPFRLMLTDHLVSGYGMHK----------- 67

Query: 129 DIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLT-EK---AXXXXXXXXXX 184
            +M     R AT +E+   HT +++ F++ +   +  +L + T EK              
Sbjct: 68  -VMDLYETRAATNDELTEFHTEDYVHFLQKVSPDNLGKLPRGTLEKFNIGDDCPIFQNLY 126

Query: 185 XXAKLSCGGVIEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILR 243
             A L  G  ++A R ++ G  ++ +AI    G HHA+  +  GFC  +++ ++  ++LR
Sbjct: 127 DYATLYTGASLDATRKLING--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSIVNLLR 184

Query: 244 TYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEG 303
            +P    ++L +D D+HHG+G Q+AFY  + V  IS H+Y    F+PGT  G  D+ G  
Sbjct: 185 YHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYNGD-FFPGT--GDIDETGCD 237

Query: 304 KGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSGXXXMKPHEKL 359
            GE F  N+     G+ D  Y+  F+ V+ PL   + P ++I   G   +  H++L
Sbjct: 238 AGERFALNVPLE-DGIDDDSYINLFKSVIGPLITAYNPTVIIQQCGADSLG-HDRL 291

>KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  107 bits (268), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 78/276 (28%), Positives = 126/276 (45%), Gaps = 27/276 (9%)

Query: 78  RMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIMLKIPVR 137
           R+ Y       N+ Y   HP  P R+   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 138 TATEEEILAVHTREHLDFIENIESQSREELIKLTEK---AXXXXXXXXXXXXAKLSCGGV 194
            AT++E+   HT E++DF+  +   + E   K + K                  +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 195 IEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKIL 253
           +E+  A    R K  +AI    G HHA+   A GFC  +++ +    +LR +P    ++L
Sbjct: 128 MES--AARLNRGKCDIAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 254 ILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNIT 313
            +D D+HHG+G ++AFY  + V+  S H+Y    F+PGT  G    +G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGQNYAVNVP 237

Query: 314 WPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
               G+ DA Y   FE VV  +   ++P  V++  G
Sbjct: 238 L-RDGIDDATYRSVFEPVVGKIMEWYQPSAVVLQCG 272

>NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {ON}
           Anc_3.8
          Length = 433

 Score =  106 bits (265), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 79/276 (28%), Positives = 125/276 (45%), Gaps = 27/276 (9%)

Query: 78  RMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIMLKIPVR 137
           R+ Y       N+ Y   HP  P R+   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 138 TATEEEILAVHTREHLDFIENIESQSREELIKLTEK---AXXXXXXXXXXXXAKLSCGGV 194
            AT++E+   HT E++DF+  +   + E   K + K                  +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 195 IEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKIL 253
           +E   A    R K  +AI    G HHA+   A GFC  +++ +    +LR +P    ++L
Sbjct: 128 MEG--AARLNRGKCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 254 ILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNIT 313
            +D D+HHG+G ++AFY  + V+  S H+Y    F+PGT  G    VG GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKYYAVNVP 237

Query: 314 WPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
               G+ DA Y   FE VV  +   ++P  V++  G
Sbjct: 238 LR-DGIDDATYRNVFEPVVKRIMEWYQPSAVVLQCG 272

>Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  106 bits (265), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 77/276 (27%), Positives = 127/276 (46%), Gaps = 27/276 (9%)

Query: 78  RMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIMLKIPVR 137
           R+ Y       N+ Y   HP  P R+   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 138 TATEEEILAVHTREHLDFIENIESQSREELIKLTEK---AXXXXXXXXXXXXAKLSCGGV 194
            AT++E+   HT E++DF+  +   + E   + + K                  +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 195 IEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKIL 253
           +E   A    R K  +A+    G HHA+   A GFC  +++ +    +LR +P    ++L
Sbjct: 128 MEG--AARLNRGKCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 254 ILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNIT 313
            +D D+HHG+G ++AFY  + V+  S H+Y    F+PGT  G    VG GKG+ ++ N+ 
Sbjct: 182 YVDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKNYSVNVP 237

Query: 314 WPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
               G+ DA Y   FE VV  +   ++P  V++ +G
Sbjct: 238 LR-DGIDDATYRAVFEPVVKRIMDWYQPSAVVLQTG 272

>KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  105 bits (263), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 76/276 (27%), Positives = 125/276 (45%), Gaps = 27/276 (9%)

Query: 78  RMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIMLKIPVR 137
           R+ Y       N+ Y   HP  P R+   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 138 TATEEEILAVHTREHLDFIENIESQSREELIKLTEK---AXXXXXXXXXXXXAKLSCGGV 194
            AT++E+   HT E++DF+  +   + +   K + K                  +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 195 IEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKIL 253
           +E   A    R K  +AI    G HHA+   A GFC  +++ +    +LR +P    ++L
Sbjct: 128 MEG--AARLNRGKCDIAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 254 ILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNIT 313
            +D D+HHG+G ++AFY  + V+  S H+Y    F+PGT  G    +G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKNYAVNVP 237

Query: 314 WPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
               G+ DA Y   FE V+  +   ++P  V++  G
Sbjct: 238 L-RDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCG 272

>TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  105 bits (263), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 77/276 (27%), Positives = 125/276 (45%), Gaps = 27/276 (9%)

Query: 78  RMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIMLKIPVR 137
           R+ Y       N+ Y   HP  P R+   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 67

Query: 138 TATEEEILAVHTREHLDFIENIESQSREELIKLTEK---AXXXXXXXXXXXXAKLSCGGV 194
            AT++E+   HT E++DF+  +   + +   K + K                  +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLFEYCSISGGGS 127

Query: 195 IEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKIL 253
           +E   A    R K  +AI    G HHA+   A GFC  +++ +    +LR +P    ++L
Sbjct: 128 MEG--AARLNRGKCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 254 ILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNIT 313
            +D D+HHG+G ++AFY  + V+  S H+Y    F+PGT  G    VG GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGIGKGKNYAVNVP 237

Query: 314 WPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
               G+ DA Y   FE V+  +   ++P  V++  G
Sbjct: 238 LR-DGMDDATYRSVFESVISKIMEWYQPSAVVLQCG 272

>Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {ON}
           complement(25267..26568) [1302 nt, 434 aa]
          Length = 433

 Score =  105 bits (262), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 76/276 (27%), Positives = 124/276 (44%), Gaps = 27/276 (9%)

Query: 78  RMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIMLKIPVR 137
           R+ Y       N+ Y   HP  P R+   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 67

Query: 138 TATEEEILAVHTREHLDFIENIESQSREELIKLTEK---AXXXXXXXXXXXXAKLSCGGV 194
            AT++E+   HT E++DF+  +   + +   K + K                  +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 195 IEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKIL 253
           +E   A    R K  +AI    G HHA+   A GFC  +++ +    +LR +P    ++L
Sbjct: 128 MEG--AARLNRGKCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 254 ILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNIT 313
            +D D+HHG+G ++AFY  + V+  S H+Y    F+PGT  G     G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKNYAVNVP 237

Query: 314 WPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
               G+ DA Y   FE V+  +   ++P  V++  G
Sbjct: 238 LR-DGIDDATYRAVFESVISKIMEWYQPSAVVLQCG 272

>CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330c RPD3 histone deacetylase B or
           uniprot|P53096 Saccharomyces cerevisiae YGL194c HOS2
          Length = 433

 Score =  105 bits (262), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 77/276 (27%), Positives = 125/276 (45%), Gaps = 27/276 (9%)

Query: 78  RMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIMLKIPVR 137
           R+ Y       N+ Y   HP  P R+   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 138 TATEEEILAVHTREHLDFIENIESQSREELIKLTEK---AXXXXXXXXXXXXAKLSCGGV 194
            AT++E+   HT E++DF+  +   + E   K + K                  +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 195 IEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKIL 253
           +E   A    R K  +AI    G HHA+   A GFC  +++ +    +LR +P    ++L
Sbjct: 128 MEG--AARLNRGKCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 254 ILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNIT 313
            +D D+HHG+G ++AFY  + V+  S H+Y    F+PGT  G    +G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKYYAVNVP 237

Query: 314 WPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
               G+ DA Y   FE V+  +   ++P  V++  G
Sbjct: 238 L-RDGIDDATYRSVFEPVIGKIMEWYQPSAVVLQCG 272

>TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  104 bits (260), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 76/276 (27%), Positives = 123/276 (44%), Gaps = 27/276 (9%)

Query: 78  RMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIMLKIPVR 137
           R+ Y       N+ Y   HP  P R+   + ++   GL K+            M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKN------------MEIYRAK 67

Query: 138 TATEEEILAVHTREHLDFIENIESQSREELIKLTEK---AXXXXXXXXXXXXAKLSCGGV 194
            AT++E+   HT E++DF+  +   + +   K + K                  +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 195 IEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKIL 253
           +E   A    R K  +AI    G HHA+   A GFC  +++ +    +LR +P    ++L
Sbjct: 128 MEG--AARLNRGKCDVAINYAGGLHHAKKSEASGFCFLNDIVLGIIELLRYHP----RVL 181

Query: 254 ILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNIT 313
            +D D+HHG+G ++AFY  + V+  S H+Y    F+PGT   R   VG GK    N  + 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGTGELRDTGVGNGKNYAVNVPLR 239

Query: 314 WPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
               G+ DA Y   FE V+  +   ++P  V++  G
Sbjct: 240 ---DGIDDATYRSVFEPVISKIMEWYQPSAVVLQCG 272

>Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL330C
           (RPD3) - histone deacetylase [contig 124] FULL
          Length = 432

 Score =  104 bits (260), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 80/291 (27%), Positives = 130/291 (44%), Gaps = 27/291 (9%)

Query: 63  KLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLS 122
           +L +  LK       R+ Y      SN+ Y   HP  P R+   + ++   GL K     
Sbjct: 5   QLPFDELKVKSTNKERVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK---- 60

Query: 123 GLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLTEK---AXXXXX 179
                   M     + AT++E+   HT E++DF+  +   + E   K + K         
Sbjct: 61  --------MEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPV 112

Query: 180 XXXXXXXAKLSCGGVIEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAA 238
                    +S GG +E   A    R K  +AI    G HHA+   A GFC  +++ +  
Sbjct: 113 FDGLYEYCSISGGGSMEG--AARLNRGKCDVAINYAGGLHHAKKSEASGFCYLNDIVLGI 170

Query: 239 RSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYD 298
             +LR +P    ++L +D D+HHG+G ++AFY  + V+  S H+Y    F+PGT  G   
Sbjct: 171 IELLRYHP----RVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELR 222

Query: 299 QVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
             G GKG+ +  N+     G+ D+ Y   FE V+  +   ++P  V++  G
Sbjct: 223 DTGVGKGKYYAVNVPLR-DGIDDSTYKSVFEPVIGKIMEWYQPSAVVLQCG 272

>NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8
          Length = 434

 Score =  104 bits (259), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 77/276 (27%), Positives = 124/276 (44%), Gaps = 27/276 (9%)

Query: 78  RMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIMLKIPVR 137
           R+ Y       N+ Y   HP  P R+   + ++   GL K             M     +
Sbjct: 21  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 68

Query: 138 TATEEEILAVHTREHLDFIENIESQSREELIKLTEK---AXXXXXXXXXXXXAKLSCGGV 194
            AT++E+   HT E++DF+  +   + E   K + K                  +S GG 
Sbjct: 69  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 128

Query: 195 IEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKIL 253
           +E   A    R K  +AI    G HHA+   A GFC  +++ +    +LR +P    ++L
Sbjct: 129 MEG--AARLNRGKCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRFHP----RVL 182

Query: 254 ILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNIT 313
            +D D+HHG+G ++AFY  + V+  S H+Y    F+PGT  G     G GKG+ +  N+ 
Sbjct: 183 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 238

Query: 314 WPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
               G+ DA Y   FE V+  +   ++P  V++  G
Sbjct: 239 L-RDGIDDATYRNVFEPVIKRIMEWYQPSAVVLQCG 273

>Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON}
           similar to Ashbya gossypii AGR395W
          Length = 433

 Score =  104 bits (259), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 76/276 (27%), Positives = 125/276 (45%), Gaps = 27/276 (9%)

Query: 78  RMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIMLKIPVR 137
           R+ Y       N+ Y   HP  P R+   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 138 TATEEEILAVHTREHLDFIENIESQSREELIKLTEK---AXXXXXXXXXXXXAKLSCGGV 194
            AT++E+   HT E++DF+  +   + +   K + K                  +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 195 IEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKIL 253
           +E   A    R K  +AI    G HHA+   A GFC  +++ +    +LR +P    ++L
Sbjct: 128 MEG--AARLNRGKCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 254 ILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNIT 313
            +D D+HHG+G ++AFY  + V+  S H+Y    F+PGT  G     G GKG+ ++ N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 314 WPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
               G+ DA Y   FE V+  +   ++P  V++  G
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCG 272

>AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL330C (RPD3)
          Length = 433

 Score =  103 bits (258), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 76/276 (27%), Positives = 125/276 (45%), Gaps = 27/276 (9%)

Query: 78  RMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIMLKIPVR 137
           R+ Y       N+ Y   HP  P R+   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 138 TATEEEILAVHTREHLDFIENIESQSREELIKLTEK---AXXXXXXXXXXXXAKLSCGGV 194
            AT++E+   HT E++DF+  +   + +   K + K                  +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 195 IEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKIL 253
           +E   A    R K  +AI    G HHA+   A GFC  +++ +    +LR +P    ++L
Sbjct: 128 MEG--AARLNRGKCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 254 ILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNIT 313
            +D D+HHG+G ++AFY  + V+  S H+Y    F+PGT  G     G GKG+ ++ N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 314 WPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
               G+ DA Y   FE V+  +   ++P  V++  G
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCG 272

>KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 432

 Score =  103 bits (258), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 76/276 (27%), Positives = 125/276 (45%), Gaps = 27/276 (9%)

Query: 78  RMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIMLKIPVR 137
           R+ Y      SN+ Y   HP  P R+   + ++   GL K             M     +
Sbjct: 20  RVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK------------MEIYRAK 67

Query: 138 TATEEEILAVHTREHLDFIENIESQSREELIKLTEK---AXXXXXXXXXXXXAKLSCGGV 194
            AT++E+   H+ E++DF+  +   + E   K + K                  +S GG 
Sbjct: 68  PATKQEMCQFHSDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 195 IEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKIL 253
           +E   A    R K  +AI    G HHA+   A GFC  +++ +    +LR +P    ++L
Sbjct: 128 MEG--AARLNRGKCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 254 ILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNIT 313
            +D D+HHG+G ++AFY  + V+  S H+Y    F+PGT  G     G GKG+ ++ N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 314 WPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
               G+ D  Y   FE V+  +   ++P  V++  G
Sbjct: 238 LR-DGIDDTTYKSVFEPVIGKIMEWYQPSAVVLQCG 272

>ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  103 bits (257), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 77/276 (27%), Positives = 124/276 (44%), Gaps = 27/276 (9%)

Query: 78  RMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIMLKIPVR 137
           R+ Y       N+ Y   HP  P R+   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYNYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 138 TATEEEILAVHTREHLDFIENIESQSREELIKLTEK---AXXXXXXXXXXXXAKLSCGGV 194
            AT++E+   HT E++DF+  +   + +   K + K                  +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 195 IEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKIL 253
           +E   A    R K  +AI    G HHA+   A GFC  +++ +    +LR +P    ++L
Sbjct: 128 MEG--AARLNRGKCDVAINYAGGLHHAKKTEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 254 ILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNIT 313
            +D D+HHG+G ++AFY  + V+  S H+Y    F+PGT  G     G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 314 WPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
               G+ DA Y   FE VV  +   ++P  V++  G
Sbjct: 238 L-RDGIDDATYKSVFEPVVSRIMEWYQPSAVVLQCG 272

>Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  103 bits (256), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 74/276 (26%), Positives = 124/276 (44%), Gaps = 27/276 (9%)

Query: 78  RMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIMLKIPVR 137
           R+ Y       N+ Y   HP  P R+   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 138 TATEEEILAVHTREHLDFIENIESQSREELIKLTEK---AXXXXXXXXXXXXAKLSCGGV 194
            AT++E+   HT E++DF+  +   + E   + + K                  +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 195 IEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKIL 253
           +E   A    R K  +A+    G HHA+   A GFC  +++ +    +LR +P    ++L
Sbjct: 128 MEG--AARLNRGKCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 254 ILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNIT 313
            +D D+HHG+G ++AFY  + V+  S H+Y    F+PGT  G    +G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNVP 237

Query: 314 WPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
               G+ DA Y   FE V+  +   ++P  V++  G
Sbjct: 238 LR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCG 272

>SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  103 bits (256), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 76/276 (27%), Positives = 124/276 (44%), Gaps = 27/276 (9%)

Query: 78  RMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIMLKIPVR 137
           R+ Y       N+ Y   HP  P R+   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 138 TATEEEILAVHTREHLDFIENIESQSREELIKLTEK---AXXXXXXXXXXXXAKLSCGGV 194
            AT++E+   HT E++DF+  +   +     K + K                  +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLNMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 195 IEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKIL 253
           +E   A    R K  +AI    G HHA+   A GFC  +++ +    +LR +P    ++L
Sbjct: 128 MEG--AARLNRGKCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 254 ILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNIT 313
            +D D+HHG+G ++AFY  + V+  S H+Y    F+PGT  G     G GKG+ ++ N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 314 WPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
               G+ DA Y   FE V+  +   ++P  V++  G
Sbjct: 238 L-RDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCG 272

>Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  103 bits (256), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 74/276 (26%), Positives = 124/276 (44%), Gaps = 27/276 (9%)

Query: 78  RMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIMLKIPVR 137
           R+ Y       N+ Y   HP  P R+   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 138 TATEEEILAVHTREHLDFIENIESQSREELIKLTEK---AXXXXXXXXXXXXAKLSCGGV 194
            AT++E+   HT E++DF+  +   + E   + + K                  +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 195 IEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKIL 253
           +E   A    R K  +A+    G HHA+   A GFC  +++ +    +LR +P    ++L
Sbjct: 128 MEG--AARLNRGKCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 254 ILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNIT 313
            +D D+HHG+G ++AFY  + V+  S H+Y    F+PGT  G    +G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNVP 237

Query: 314 WPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
               G+ DA Y   FE V+  +   ++P  V++  G
Sbjct: 238 LR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCG 272

>KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330C RPD3 Histone deacetylase regulates
           transcription and silencing
          Length = 432

 Score =  103 bits (256), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 76/276 (27%), Positives = 124/276 (44%), Gaps = 27/276 (9%)

Query: 78  RMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIMLKIPVR 137
           R+ Y       N+ Y   HP  P R+   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 138 TATEEEILAVHTREHLDFIENIESQSREELIKLTEK---AXXXXXXXXXXXXAKLSCGGV 194
            AT++E+   HT E++DF+  +   + +   K + K                  +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 195 IEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKIL 253
           +E   A    R K  +AI    G HHA+   A GFC  +++ +    +LR +P    ++L
Sbjct: 128 MEG--AARLNRGKCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 254 ILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNIT 313
            +D D+HHG+G ++AFY  + V+  S H+Y    F+PGT  G     G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGE--FFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 314 WPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
               G+ DA Y   FE V+  +   ++P  V++  G
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCG 272

>YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}
           RPD3Histone deacetylase; regulates transcription,
           silencing, and other processes by influencing chromatin
           remodeling; forms at least two different complexes which
           have distinct functions and members
          Length = 433

 Score =  102 bits (255), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 74/276 (26%), Positives = 124/276 (44%), Gaps = 27/276 (9%)

Query: 78  RMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIMLKIPVR 137
           R+ Y       N+ Y   HP  P R+   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 138 TATEEEILAVHTREHLDFIENIESQSREELIKLTEK---AXXXXXXXXXXXXAKLSCGGV 194
            AT++E+   HT E++DF+  +   + E   + + K                  +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 195 IEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKIL 253
           +E   A    R K  +A+    G HHA+   A GFC  +++ +    +LR +P    ++L
Sbjct: 128 MEG--AARLNRGKCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 254 ILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNIT 313
            +D D+HHG+G ++AFY  + V+  S H+Y    F+PGT  G    +G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGAGKNYAVNVP 237

Query: 314 WPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
               G+ DA Y   FE V+  +   ++P  V++  G
Sbjct: 238 LR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCG 272

>TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  102 bits (254), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 77/276 (27%), Positives = 124/276 (44%), Gaps = 27/276 (9%)

Query: 78  RMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIMLKIPVR 137
           R+ Y       NF Y   HP  P R+   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNFSYGQYHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 138 TATEEEILAVHTREHLDFIENIESQSREELIKLTEK---AXXXXXXXXXXXXAKLSCGGV 194
            AT++E+   HT E++DF+  +   + E   K + K                  +S GG 
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 195 IEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKIL 253
           +E   A    R K  +AI    G HHA+   A GFC  +++ +    +LR +P    ++L
Sbjct: 128 MEG--AARLNRGKCDVAINYAGGLHHAKKAEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 254 ILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNIT 313
            +D D+HHG+G ++AFY  + V+  S H+Y    F+PGT  G    +G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGSGKYYAVNVP 237

Query: 314 WPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
               G+ DA +   FE VV  +   ++P  V++  G
Sbjct: 238 L-RDGIDDATFRNVFEPVVGKIMEWYQPAAVVLQCG 272

>TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {ON}
           Anc_3.362 YPR068C
          Length = 454

 Score = 69.3 bits (168), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 66/132 (50%), Gaps = 10/132 (7%)

Query: 218 HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLY 277
           HHA  Q A GFC  +++ +  + + R   +  +KI  +D+D+HHG+G +KAF    NV  
Sbjct: 206 HHAFKQKASGFCYVNDIVLLIQKLRR---KGFQKISYIDFDLHHGDGVEKAFQFSSNVQT 262

Query: 278 ISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGR 337
           ISLH +E   F+PGT       + E        NI   + G+ D       E +V P+  
Sbjct: 263 ISLHLFE-VGFFPGT-----GNLSESDKRRNVVNIPL-LHGLDDTSLEQLIEQIVKPVIE 315

Query: 338 EFRPDLVIVSSG 349
              PD++++  G
Sbjct: 316 RHEPDVLVIQCG 327

>Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C
           (HOS1) - Similar to Hda1p, Rpd3p, Hos2p, and Hos3p
           [contig 254] FULL
          Length = 473

 Score = 69.3 bits (168), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 78/165 (47%), Gaps = 14/165 (8%)

Query: 187 AKLSCGGVIEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTY 245
            ++  G  I+  R     R + ++++    G HHA    A GFC  +++++  + + R  
Sbjct: 193 CQVVTGATIKLAR-YASSRQQRTISVNWDGGRHHAFKSKASGFCYVNDIAILIQKLRR-- 249

Query: 246 PESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKG 305
              + KI  LD+D+HHG+G ++AF    NV  IS+H YE   F+PGT  G       G+ 
Sbjct: 250 -RGIHKISYLDFDLHHGDGVERAFQHSANVQTISIHMYEE-GFFPGT--GTLKDASSGRN 305

Query: 306 EGFNCNITWPV-GGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349
                 +  PV  G+ D         VV+P      P++VI+  G
Sbjct: 306 I-----VNIPVLHGMDDTFLNEVVNRVVIPCLHNHNPEVVIIQCG 345

>TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.362
           YPR068C
          Length = 579

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 70/132 (53%), Gaps = 10/132 (7%)

Query: 218 HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLY 277
           HH+  + A GFC  +++ +    I +   +  RKI  LD+D+HHG+G +K+F   +++  
Sbjct: 299 HHSRKKKASGFCYVNDIVLC---IQKLGEKGFRKITYLDFDLHHGDGVEKSFQYSKHIQT 355

Query: 278 ISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGR 337
           IS+H +E   F+P T  G  ++       GFN      + G+ D    +    V++PL +
Sbjct: 356 ISVHLFEP-GFFPCT--GSLEET----KHGFNIVNIPTLHGLDDNYLTYLLNRVIIPLIK 408

Query: 338 EFRPDLVIVSSG 349
           + +P+ ++V  G
Sbjct: 409 KHKPECLVVQCG 420

>Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {ON}
           YPR068C (REAL)
          Length = 471

 Score = 66.2 bits (160), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 67/133 (50%), Gaps = 12/133 (9%)

Query: 218 HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLY 277
           HHA  Q A GFC  ++V +    I R     + KI  +D+D+HHG+G ++AF   + +  
Sbjct: 212 HHAFKQKANGFCYINDVVLL---IQRLRKMKLNKITYVDFDLHHGDGVERAFQYSKQIQT 268

Query: 278 ISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYM-WAFEHVVMPLG 336
           IS+H YE   F+PGT  G  +   +GK       +  P+    D  Y+      ++ PL 
Sbjct: 269 ISIHLYEP-GFFPGT--GSLNDARKGKSV-----VNIPLKHGCDDSYLDLVASKIISPLI 320

Query: 337 REFRPDLVIVSSG 349
           +   PD++I+  G
Sbjct: 321 KRHDPDVLIIECG 333

>CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068c HOS1
          Length = 445

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 87/167 (52%), Gaps = 12/167 (7%)

Query: 189 LSCGGVIEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYPE 247
           +S G  +   + ++EG  + ++AI    G HH+    A GFC  +++++   ++ R    
Sbjct: 174 VSTGATLSLAQYILEGS-ERTIAINWDGGRHHSMKTKASGFCYINDIALLIMTLRRG--- 229

Query: 248 SVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEG 307
            V +I  +D+D+HHG+G +KAF   + V  ISLH YE T F+P +  G  +    GK   
Sbjct: 230 GVDRISYVDFDLHHGDGVEKAFKYSKQVQTISLHMYE-TGFFPCS--GSLEDNSSGKSI- 285

Query: 308 FNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSGXXXMK 354
              NI   + G+ D+      + +++P   + +P+++++  G   +K
Sbjct: 286 --VNIPL-LHGLDDSTLQDIAKRIIVPSISKHQPNVIVIQCGGDGLK 329

>KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C
          Length = 474

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 69/133 (51%), Gaps = 12/133 (9%)

Query: 218 HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLY 277
           HHA    A GFC  +++++  + + R     +R+I  +D+D+HH +G ++AF   ++V  
Sbjct: 221 HHASRSRASGFCYINDIALLIQKLRR---RGIRRISYIDFDLHHCDGVERAFQHSQSVQT 277

Query: 278 ISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNITWPVG-GVGDAEYMWAFEHVVMPLG 336
           IS+H +E   F+PGT  G   +   GK       +  PV  G+ D       + V+MP  
Sbjct: 278 ISVHLHE-PGFFPGT--GSLKEASVGKNV-----VNIPVQHGMDDTFLNQIVQRVIMPCI 329

Query: 337 REFRPDLVIVSSG 349
           R   P+++++  G
Sbjct: 330 RSHNPEVLVIQCG 342

>Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {ON}
           YPR068C (REAL)
          Length = 477

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 65/133 (48%), Gaps = 12/133 (9%)

Query: 218 HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLY 277
           HHA  Q A GFC  ++V +    I R     + K+  LD+D+HHG+G +KAF     +  
Sbjct: 212 HHAFKQKANGFCYINDVVLL---IQRLRKLKLSKVTYLDFDLHHGDGVEKAFQYSRQIQT 268

Query: 278 ISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYM-WAFEHVVMPLG 336
           IS+H YE   F+PGT  G  +    GK       +  P+    D  Y+      ++ PL 
Sbjct: 269 ISVHLYEP-GFFPGT--GSLNDSQNGKNI-----VNIPLKHGCDDNYLNLVASKIIHPLI 320

Query: 337 REFRPDLVIVSSG 349
           +   P+++I+  G
Sbjct: 321 KRHDPEVIIMECG 333

>KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C HOS1
           Putative class I histone deacetylase (HDAC) with
           sequence similarity to Hda1p, Rpd3p, Hos2p, and Hos3p;
           deletion results in increased histone acetylation at
           rDNA repeats; interacts with the Tup1p-Ssn6p complex
          Length = 441

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 72/143 (50%), Gaps = 13/143 (9%)

Query: 209 SLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQK 267
           S+AI    G HHA    A GFC  +++ +  +S+ R   +  +++  +D+D+H+G+G  K
Sbjct: 183 SIAINWDGGRHHALKHYASGFCYVNDIVLLIQSLRR---KGWKRVTYIDFDLHYGDGVAK 239

Query: 268 AFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNITWPV-GGVGDAEYMW 326
           AF   ENV  IS+H YE   F+PGT  G  ++    K       +  PV  G+ D   + 
Sbjct: 240 AFRFSENVQTISVHLYEP-GFFPGT--GSLEETRNSKQM-----VNLPVLHGMDDKYLLE 291

Query: 327 AFEHVVMPLGREFRPDLVIVSSG 349
               V+ PL   F  + +++  G
Sbjct: 292 LISSVITPLIETFNAECIVIQCG 314

>SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 489

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 66/133 (49%), Gaps = 13/133 (9%)

Query: 218 HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLY 277
           HH+    A GFC  +++ +A + + R +      I  +D+D+HHG+G ++AF   +NV  
Sbjct: 242 HHSFKSRASGFCYINDIVLAIQRLRRNFS----NISYVDFDLHHGDGVERAFQYSKNVQT 297

Query: 278 ISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNITWPV-GGVGDAEYMWAFEHVVMPLG 336
           ISLH +E   F+PGT      Q G          I  P+  G  D   M   E VV+P  
Sbjct: 298 ISLHNHE-PGFFPGTGSMESSQDGHSI-------INIPLRHGADDDCLMKITESVVIPCI 349

Query: 337 REFRPDLVIVSSG 349
           ++  P ++++  G
Sbjct: 350 QKHGPQVIVIQCG 362

>KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.362
           YPR068C
          Length = 474

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 58/106 (54%), Gaps = 5/106 (4%)

Query: 188 KLSCGGVIEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYP 246
           +++ G  +   + +V      ++ I    G HHA  + A GFC  +++ +    I R   
Sbjct: 188 QVTTGATLSLSKFLVPNSKDRTICINWDGGRHHASKKKASGFCYINDIVLL---IQRMRK 244

Query: 247 ESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGT 292
              +KI  LD+D+HHG+G +KAF   +++  ISLH +E T F+PGT
Sbjct: 245 NGFKKITYLDFDLHHGDGVEKAFQFSKSIQTISLHLFE-TGFFPGT 289

>Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {ON}
           YPR068C (REAL)
          Length = 470

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 67/133 (50%), Gaps = 12/133 (9%)

Query: 218 HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLY 277
           HHA  Q A GFC  ++V +  + + +     + KI  LD+D+HHG+G +KAF   + +  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRKI---KLNKITYLDFDLHHGDGVEKAFQYSKQIQT 266

Query: 278 ISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNITWPVG-GVGDAEYMWAFEHVVMPLG 336
           IS+H YE   F+PGT  G  D    GK       +  P+  G  D+        ++ PL 
Sbjct: 267 ISVHIYEP-GFFPGT--GSLDDSRGGKNV-----VNIPLKHGCDDSYLNLIASKIINPLI 318

Query: 337 REFRPDLVIVSSG 349
            +  P+++I+  G
Sbjct: 319 DKHDPEVLIIECG 331

>ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR068C (HOS1)
          Length = 437

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 68/133 (51%), Gaps = 13/133 (9%)

Query: 218 HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLY 277
           HHA    A GFC  +++++  +++ R   +   ++  +D+D+HHG+G + AF   +NV  
Sbjct: 193 HHALKARASGFCYVNDIALLIQTLRR---QGFLRVSYVDFDLHHGDGVENAFRYSKNVQT 249

Query: 278 ISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNITWP-VGGVGDAEYMWAFEHVVMPLG 336
            SLH +E   F+PGT        G  K    N  +  P + GV D+      +H+V P  
Sbjct: 250 CSLHLFEP-GFFPGT--------GACKNCTDNSVLNVPLLHGVDDSTLDHVVDHIVTPAV 300

Query: 337 REFRPDLVIVSSG 349
           +   P+++I+  G
Sbjct: 301 QRHDPEVLIIQCG 313

>YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON}
           HOS1Class I histone deacetylase (HDAC) family member
           that deacetylates Smc3p on lysine residues at anaphase
           onset; has sequence similarity to Hda1p, Rpd3p, Hos2p,
           and Hos3p; interacts with the Tup1p-Ssn6p corepressor
           complex
          Length = 470

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 65/133 (48%), Gaps = 12/133 (9%)

Query: 218 HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLY 277
           HHA  Q A GFC  ++V +    I R     + KI  +D+D+HHG+G +KAF   + +  
Sbjct: 210 HHAFKQRASGFCYINDVVLL---IQRLRKAKLNKITYVDFDLHHGDGVEKAFQYSKQIQT 266

Query: 278 ISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAF-EHVVMPLG 336
           IS+H YE   F+PGT       + + + +    NI  P+    D  Y+      +V PL 
Sbjct: 267 ISVHLYEP-GFFPGT-----GSLSDSRKDKNVVNI--PLKHGCDDNYLELIASKIVNPLI 318

Query: 337 REFRPDLVIVSSG 349
               P+ +I+  G
Sbjct: 319 ERHEPEALIIECG 331

>Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}
           similar to Ashbya gossypii ADL265W
          Length = 709

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 42/82 (51%), Gaps = 7/82 (8%)

Query: 190 SCGGVIEACRAVVEGRVKNSLA-----IVRPPGHHAEPQAAGGFCLFSNVSVAARSILRT 244
           S G V     ++ +G V    A      +RPPGHH+      GFCL +N  +A      T
Sbjct: 160 SIGAVEYGVDSIFKGEVNKDTANRAFVAIRPPGHHSHAATPSGFCLLNNAHIAVEYAADT 219

Query: 245 YPESVRKILILDWDIHHGNGTQ 266
           Y   V   +ILD+D+HHG+GTQ
Sbjct: 220 Y--GVTHAVILDFDLHHGDGTQ 239

>Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}
           complement(25558..27114) [1557 nt, 519 aa]
          Length = 518

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 65/133 (48%), Gaps = 12/133 (9%)

Query: 218 HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLY 277
           HHA    A GFC  +++ +  + + +   + + K+  +D+D+HHG+G +KAF    N+  
Sbjct: 223 HHAIKNKASGFCYINDIVILIQKLRK---KGISKVSYIDFDLHHGDGVEKAFRYSSNIQT 279

Query: 278 ISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNITWPV-GGVGDAEYMWAFEHVVMPLG 336
           IS+H YE   F+P T  G  +    GK       +  P+  GV D         ++ PL 
Sbjct: 280 ISMHMYE-PGFFPCT--GSLEDTLNGKNI-----VNVPLYHGVDDNYMTEIVNELIKPLI 331

Query: 337 REFRPDLVIVSSG 349
               P+++++  G
Sbjct: 332 ERHSPEVLVIQCG 344

>KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.362
           YPR068C
          Length = 456

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 69/135 (51%), Gaps = 17/135 (12%)

Query: 218 HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLY 277
           HHA    A GFC  +++ +  + + +   +   K+  LD+D+HHG+G ++AF   + V  
Sbjct: 206 HHASKGKASGFCYVNDIVLLIQKLRK---QGTGKVTYLDFDLHHGDGVERAFKFTKKVQT 262

Query: 278 ISLHRYESTAFYP--GTIHGRYDQVGEGKGEGFNCNITWPVG-GVGDAEYMWAFEHVVMP 334
           ISLH YE   F+P  G++ G           GF+  +  P+  G+ D+      + VV P
Sbjct: 263 ISLHLYEP-GFFPCTGSLEG---------SSGFD-TVNLPLQHGLTDSFLQGLVDQVVNP 311

Query: 335 LGREFRPDLVIVSSG 349
           L +   P+++++  G
Sbjct: 312 LIQRHGPEVIVIQCG 326

>NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa]
           {ON} Anc_3.362 YPR068C
          Length = 490

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 77/159 (48%), Gaps = 13/159 (8%)

Query: 193 GVIEACRAVVEGRVKNSLAIVRPPG-HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRK 251
           G   +    ++   + S+AI    G HHA    A GFC  +++ +  + I +      + 
Sbjct: 189 GATLSLSKFLQPNSERSIAINWDGGRHHAFKNKASGFCYVNDIVLLIQKIRKN---GFKN 245

Query: 252 ILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCN 311
           I  +D+D+HHG+G QKAF   +NV  +SLH +E   F+P T       + E K      N
Sbjct: 246 ISYVDFDLHHGDGVQKAFQFSKNVQTVSLHMFEP-GFFPCT-----GSLQEAKAGSSIVN 299

Query: 312 ITWPVGGVGDAEYMWAF-EHVVMPLGREFRPDLVIVSSG 349
           I  P+    D  ++    + +++P+  +  P+++++  G
Sbjct: 300 I--PLLHGLDGTFLKQLTKDIIIPVVEQHEPEVLVIQCG 336

>Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116W
           (REAL)
          Length = 699

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 209 SLAIVRPPGHHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQ 266
           +   +RPPGHH       GFCL +N  VA      TY   V  +++LD+D+HHG+GTQ
Sbjct: 186 AFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAFDTY--DVTHVVVLDFDLHHGDGTQ 241

>KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 715

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 202 VEGRVKNSLAIVRPPGHHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHH 261
           VE     +   +RPPGHH+      GFCL +N  +A       Y   V   +ILD+D+HH
Sbjct: 176 VEQTANRAFIAIRPPGHHSHASTPSGFCLLNNAHIAIEYAFEKY--DVTHAVILDFDLHH 233

Query: 262 GNGTQ 266
           G+GTQ
Sbjct: 234 GDGTQ 238

>Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON}
           YPL116W (REAL)
          Length = 697

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 209 SLAIVRPPGHHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQ 266
           +   +RPPGHH       GFCL +N  VA      TY  +V  +++LD+D+HHG+GTQ
Sbjct: 186 AFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAYDTY--NVTHVVVLDFDLHHGDGTQ 241

>KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 705

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 36/65 (55%), Gaps = 2/65 (3%)

Query: 202 VEGRVKNSLAIVRPPGHHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHH 261
           VE     +   +RPPGHH+      GFCL +N  +A      TY   V   ++LD+D+HH
Sbjct: 178 VEQTSNRAFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--GVTHAVVLDFDLHH 235

Query: 262 GNGTQ 266
           G+GTQ
Sbjct: 236 GDGTQ 240

>YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}
           HOS3Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC) with specificity in vitro for
           histones H3, H4, H2A, and H2B; similar to Hda1p, Rpd3p,
           Hos1p, and Hos2p; deletion results in increased histone
           acetylation at rDNA repeats
          Length = 697

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 209 SLAIVRPPGHHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQ 266
           +   +RPPGHH       GFCL +N  VA      TY  +V  +++LD+D+HHG+GTQ
Sbjct: 186 AFVAIRPPGHHCHYGTPSGFCLLNNAHVAIEYAYDTY--NVTHVVVLDFDLHHGDGTQ 241

>ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]
           {ON} similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 436

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 67/133 (50%), Gaps = 12/133 (9%)

Query: 218 HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLY 277
           HHA  + A GFC  +++ +    I +   +  +++  +D+D+HHG+G ++AF    NV  
Sbjct: 195 HHAMKKRASGFCYVNDIVLL---IQKLRSKGFQRLSYIDFDLHHGDGVERAFQFSSNVQT 251

Query: 278 ISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNITWPVG-GVGDAEYMWAFEHVVMPLG 336
           IS+H +E   F+P +  G  +   +GK      NI  P+  G+ D         VV+PL 
Sbjct: 252 ISMHLFE-CGFFPTS--GSLEDNKKGKNIA---NI--PLAHGLNDEYLNEIVTQVVIPLT 303

Query: 337 REFRPDLVIVSSG 349
               P ++I+  G
Sbjct: 304 DRHSPQVIIIQCG 316

>NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON}
           Anc_3.362 YPR068C
          Length = 508

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 68/132 (51%), Gaps = 10/132 (7%)

Query: 218 HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLY 277
           HHA    A GFC  +++ +  +  LR+     ++I  +D+D+HHG+G Q++F    +V  
Sbjct: 233 HHALRNKASGFCYINDIVLLIQQ-LRS--NGYKRITYIDFDLHHGDGVQRSFQYSTSVQT 289

Query: 278 ISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGR 337
           IS H +E   F+P T   +  ++G+        NI   + GV D       E V++P  +
Sbjct: 290 ISAHMFEP-GFFPCTGSLKESKMGKNI-----VNIPL-LHGVDDMLMNEIVEKVMIPCVK 342

Query: 338 EFRPDLVIVSSG 349
            + P+++++  G
Sbjct: 343 RYDPEILVIQCG 354

>SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} similar
           to uniprot|Q02959 Saccharomyces cerevisiae YPL116W HOS3
           Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC)
          Length = 690

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (53%), Gaps = 7/82 (8%)

Query: 190 SCGGVIEACRAVVEGRVKNSLA-----IVRPPGHHAEPQAAGGFCLFSNVSVAARSILRT 244
           S G +     ++ +G  +  +A      VRPPGHH+      GFCL +N  +A      T
Sbjct: 161 SIGALETGIDSIFQGSSQEDIANRAFVAVRPPGHHSHTATPSGFCLLNNAHIAIEYAADT 220

Query: 245 YPESVRKILILDWDIHHGNGTQ 266
           +  +V   ++LD+D+HHG+GTQ
Sbjct: 221 F--NVTHAVVLDFDLHHGDGTQ 240

>NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.607
           YPL116W
          Length = 700

 Score = 57.8 bits (138), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 209 SLAIVRPPGHHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQ 266
           +   +RPPGHH       GFCL +N  VA      TY   V  + +LD+D+HHG+GTQ
Sbjct: 184 AFVAIRPPGHHCHFATPSGFCLLNNAHVAIEYAADTY--GVTHVAVLDFDLHHGDGTQ 239

>TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {ON}
           Anc_8.607 YPL116W
          Length = 674

 Score = 57.4 bits (137), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 43/82 (52%), Gaps = 7/82 (8%)

Query: 190 SCGGVIEACRAVVEG----RVKN-SLAIVRPPGHHAEPQAAGGFCLFSNVSVAARSILRT 244
           S G +     ++ EG     V N +  ++RPPGHH       GFCL +N  V+      T
Sbjct: 160 SIGALETGVDSIFEGPSPEHVSNRAFVVIRPPGHHCRAGTPSGFCLLNNAHVSIEYAHDT 219

Query: 245 YPESVRKILILDWDIHHGNGTQ 266
           Y   +   ++LD+D+HHG+GTQ
Sbjct: 220 Y--GITHAVVLDFDLHHGDGTQ 239

>Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {ON}
           YPL116W (HOS3) - sequence similar to the histone
           deacetylase Hda1p [contig 61] FULL
          Length = 708

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 209 SLAIVRPPGHHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQ 266
           +   +RPPGHH+      GFCL +N  +A      TY  +V   ++LD+D+HHG+GTQ
Sbjct: 187 AFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--NVTHAVVLDFDLHHGDGTQ 242

>KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {ON}
           Anc_8.607 YPL116W
          Length = 717

 Score = 57.0 bits (136), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 209 SLAIVRPPGHHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQ 266
           +   +RPPGHH       GFCL +N ++       TY   V  +++LD+D+HHG+GTQ
Sbjct: 185 AFVAIRPPGHHCHVGMPSGFCLLNNANITIEYAANTY--GVTHVVVLDFDLHHGDGTQ 240

>KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8.607
           YPL116W
          Length = 677

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 210 LAIVRPPGHHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQ 266
             +VRPPGHH       GFCL +N  ++      TY   V    ILD+D+HHG+GTQ
Sbjct: 184 FVVVRPPGHHCHVTGPSGFCLLNNAHISIEYAADTY--GVTHAAILDFDLHHGDGTQ 238

>TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.607
           YPL116W
          Length = 698

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 209 SLAIVRPPGHHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQ 266
           +   +RPPGHH       GFCL +N  +A       Y   V   +ILD+D+HHG+GTQ
Sbjct: 186 AFVAIRPPGHHCHVSTPSGFCLLNNAQIAIEYAYEKY--GVSHAVILDFDLHHGDGTQ 241

>Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116W
           (REAL)
          Length = 697

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 209 SLAIVRPPGHHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQ 266
           +   +RPPGHH       GFCL +N  VA       Y  +V  +++LD+D+HHG+GTQ
Sbjct: 186 AFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAHDAY--NVTHVVVLDFDLHHGDGTQ 241

>Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON}
           complement(10892..12958) [2067 nt, 689 aa]
          Length = 688

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 209 SLAIVRPPGHHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQ 266
           +   +RPPGHH       GFCL +N  +A      TY   +   +ILD+D+HHG+GTQ
Sbjct: 185 AFVAIRPPGHHCHVDTPSGFCLLNNAHIAIEYASDTY--GITHAVILDFDLHHGDGTQ 240

>TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {ON}
           Anc_3.362 YPR068C
          Length = 494

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 69/136 (50%), Gaps = 12/136 (8%)

Query: 218 HHAEPQAAGGFCLFSNVSVAARSILRTYPESV---RKILILDWDIHHGNGTQKAFYEDEN 274
           HHA    A GFC  +++ V+  + LR  P      RK+  +D D+HHG+G + AF   ++
Sbjct: 206 HHAMKSRANGFCYINDI-VSLINELRKTPGQQGHKRKLTYIDLDLHHGDGVENAFNYSKD 264

Query: 275 VLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNITWPVG-GVGDAEYMWAFEHVVM 333
           +  IS+H +E   FYP T   ++     GK +  N  I  PV  G+ ++       ++++
Sbjct: 265 IQIISIHLFEP-GFYPCTGGLKF-----GKPKSNNI-INLPVKHGLSNSNMFELVTNIII 317

Query: 334 PLGREFRPDLVIVSSG 349
           PL    + D +++  G
Sbjct: 318 PLIELHQSDDIVILCG 333

>NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.607
           YPL116W
          Length = 684

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 7/82 (8%)

Query: 190 SCGGVIEACRAVVEG----RVKN-SLAIVRPPGHHAEPQAAGGFCLFSNVSVAARSILRT 244
           S G +  A  ++ +G     + N +   +RPPGHH       GFC+ +N  VA      +
Sbjct: 160 SIGALETAVDSIFKGPSPEHISNRAFVAIRPPGHHCHFATPSGFCVLNNAHVAIEYAADS 219

Query: 245 YPESVRKILILDWDIHHGNGTQ 266
           Y   V  + +LD+D+HHG+GTQ
Sbjct: 220 Y--DVTHVAVLDFDLHHGDGTQ 239

>ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL116W (HOS3)
          Length = 694

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 209 SLAIVRPPGHHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQ 266
           +   +RPPGHH+      GFCL +N  +A       Y   V    ILD+D+HHG+GTQ
Sbjct: 184 AFVALRPPGHHSHTSTPSGFCLLNNAHIAVEYAASRY--GVTHAAILDFDLHHGDGTQ 239

>CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highly
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116w HOS3
          Length = 678

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 213 VRPPGHHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQ 266
           +RPPGHH       GFCL +N  +        Y   V   +ILD+D+HHG+GTQ
Sbjct: 186 IRPPGHHCHYATPSGFCLLNNAHIGIEYAADKY--GVTHAVILDFDLHHGDGTQ 237

>Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL339W
          Length = 445

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 63/137 (45%), Gaps = 21/137 (15%)

Query: 218 HHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLY 277
           HHA    A GFC  +++ +  + + +       ++  +D+D+HHG+  + AF    NV  
Sbjct: 195 HHAFKSRASGFCYINDIVLLIQELRKN---GYSRVSYVDFDLHHGDAVESAFQYSRNVQT 251

Query: 278 ISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNITWPVG-----GVGDAEYMWAFEHVV 332
            SLH +E+  F+PGT            G   NC  T  V      G+ D       ++++
Sbjct: 252 CSLHLFEA-GFFPGT------------GSFKNCRETNVVNIPLFHGLDDESLDEIVDNIL 298

Query: 333 MPLGREFRPDLVIVSSG 349
           +P   +  P+++++  G
Sbjct: 299 IPCVNKHDPEVLVIQCG 315

>TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa]
           {ON} Anc_8.607 YPL116W
          Length = 694

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 209 SLAIVRPPGHHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQ 266
           +   +RPPGHH +     GFCL +N  ++       Y   +   +ILD+D+HHG+GTQ
Sbjct: 187 AFVAIRPPGHHCKVATPSGFCLLNNAHISIEYAADHY--GITHAVILDFDLHHGDGTQ 242

>ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 668

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 41/82 (50%), Gaps = 7/82 (8%)

Query: 190 SCGGVIEACRAVVEG----RVKN-SLAIVRPPGHHAEPQAAGGFCLFSNVSVAARSILRT 244
           S G +  A  ++ +G     + N +   +RPPGHH       GFCL +N  VA       
Sbjct: 158 SIGALETAVDSIFDGPSPEHISNRAFVAIRPPGHHCHVATPSGFCLLNNAHVAIEYAKDR 217

Query: 245 YPESVRKILILDWDIHHGNGTQ 266
           +   V    ILD+D+HHG+GTQ
Sbjct: 218 F--GVTHAAILDFDLHHGDGTQ 237

>TBLA0A09030 Chr1 (2222340..2224682) [2343 bp, 780 aa] {ON}
           Anc_4.107 YGL009C
          Length = 780

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 55/124 (44%), Gaps = 23/124 (18%)

Query: 365 KIFKAETLVILVHDTPE-----LWGDRDIITGVLDPSTSVLIDTSMKFIKWAADRNYSIL 419
           KIF A T    VH  PE     L+ DR ++  V  P     +  + + ++   D   + +
Sbjct: 15  KIFDAHT----VHKDPETGSCLLYIDRHLVHEVTSPQAFEGLKNAHRKVR-RTDCTLATV 69

Query: 420 DINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTK------ICFIGIGESYQGIV 473
           D NIP   + +  F S+       +   D+ LQ + TL +      I F G+    QGIV
Sbjct: 70  DHNIP--TISRANFKSTST----FIKQQDSRLQ-VQTLEQNVRDFNIAFFGMSSENQGIV 122

Query: 474 HLIG 477
           H+IG
Sbjct: 123 HIIG 126

>TPHA0F00720 Chr6 (162768..166619) [3852 bp, 1283 aa] {ON} Anc_4.129
           YAL002W
          Length = 1283

 Score = 35.4 bits (80), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 58/121 (47%), Gaps = 16/121 (13%)

Query: 451 LQYISTLTKI-----CFIGIGE-SYQGIVHLIGERDLRVLSKAVI-----NFVGNFPLKS 499
           + +I+ +TK       F G+GE S+ G+  L+        S +++     N + N  LK 
Sbjct: 626 VSFIAQITKTKIVNNLFEGMGEASFIGVYDLLSSIYCNSSSPSLVHELEPNIISNAKLKI 685

Query: 500 LSSNFDETMVDWYFKNSLVFTNDSHNCWKESEEKRPRKKFGRVLKSDSDGIISIINERFD 559
               F+ T+V W + +     N  H C  E+EE+     F  +LK +S  ++ II++ F+
Sbjct: 686 NYVFFNGTLVTWPYHSG----NKFHTC-TEAEEEPVYPYFSVLLKHNSQNLLKIIDKMFE 740

Query: 560 E 560
           E
Sbjct: 741 E 741

>ZYRO0G10076g Chr7 (805645..807993) [2349 bp, 782 aa] {ON} highly
           similar to uniprot|P07264 Saccharomyces cerevisiae
           YGL009C LEU1 Isopropylmalate isomerase catalyzes the
           second step in the leucine biosynthesis pathway
          Length = 782

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 57/119 (47%), Gaps = 14/119 (11%)

Query: 365 KIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAADRNYSILDINIP 424
           K+F A  +      +  L+ DR ++  V  P     +  + + ++   D   + +D NIP
Sbjct: 15  KVFDAHVVKRDSSGSCLLYIDRHLVHEVTSPQAFEGLRNAGRKVR-RTDCTLATVDHNIP 73

Query: 425 KSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTK------ICFIGIGESYQGIVHLIG 477
            ++  ++T+ S+       +   D+ LQ + TL +      + F G+ E+ QGIVH+IG
Sbjct: 74  TAS--RKTYKSTAT----FIDQADSRLQ-VQTLEQNVKDFDVAFFGMAENRQGIVHVIG 125

>AFL203C Chr6 complement(53876..55033) [1158 bp, 385 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR346C
           (SVF1)
          Length = 385

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 48/106 (45%), Gaps = 12/106 (11%)

Query: 353 MKPHEKLVLASQKIFKAETLVILVHD--TPELWGDRDIITGVL---DPSTSVLIDTSMKF 407
           MKPH      +   F +ET  +L+ +  TP+ + +  +  G+L   D   SV ID  ++ 
Sbjct: 217 MKPHHAAKAWNFLNFHSETHSVLLMEFTTPKSYANTKVSIGILCDKDSVLSVTIDNEVEH 276

Query: 408 IK-------WAADRNYSILDINIPKSNLEKETFSSSKAANEIMLSL 446
           +K       W   +  S+    IP S  +KE  S+ K +  + + L
Sbjct: 277 VKPKTDEVGWPVPKALSMKFTGIPSSVPDKEVASAEKLSARVDIEL 322

>YMR208W Chr13 (684467..685798) [1332 bp, 443 aa] {ON}
           ERG12Mevalonate kinase, acts in the biosynthesis of
           isoprenoids and sterols, including ergosterol, from
           mevalonate
          Length = 443

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 54/129 (41%), Gaps = 22/129 (17%)

Query: 463 IGIGESYQGIVHLIGERDLRVLS---KAVIN---FVGNFPLKSLSSNFDETMVDWYFKNS 516
           + +  +Y G   LIG  DL  LS   K ++N   F+G   +    S  D  +  +   N+
Sbjct: 156 LALAMAYLG--GLIGSNDLEKLSENDKHIVNQWAFIGEKCIHGTPSGIDNAVATY--GNA 211

Query: 517 LVFTNDSHNCWKESEEKRPRKKF---------GRVLKSDSDGIISI---INERFDEATDF 564
           L+F  DSHN    +   +    F          R+ +S  D +  +   + E+F E    
Sbjct: 212 LLFEKDSHNGTINTNNFKFLDDFPAIPMILTYTRIPRSTKDLVARVRVLVTEKFPEVMKP 271

Query: 565 ILDAFEEWS 573
           ILDA  E +
Sbjct: 272 ILDAMGECA 280

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,245,961
Number of extensions: 2847425
Number of successful extensions: 7519
Number of sequences better than 10.0: 114
Number of HSP's gapped: 7487
Number of HSP's successfully gapped: 134
Length of query: 578
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 463
Effective length of database: 40,294,809
Effective search space: 18656496567
Effective search space used: 18656496567
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)