Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1003.352.284ON71371332470.0
TPHA0C033802.284ON69732413850.0
TDEL0G021502.284ON66131513341e-175
KAFR0J013702.284ON78031613221e-172
SAKL0E07722g2.284ON79131513191e-171
ZYRO0A01848g2.284ON70431813031e-170
Suva_9.1042.284ON80531713041e-169
YIL095W (PRK1)2.284ON81031713021e-168
Smik_9.842.284ON80831813001e-168
NCAS0B062602.284ON72332212821e-167
NDAI0B035602.284ON75631412841e-166
Skud_9.782.284ON80931512841e-166
TBLA0B059302.284ON71732112691e-165
NDAI0G006402.284ON62131512601e-165
KLTH0G10318g2.284ON79031512751e-165
NCAS0G038102.284ON66131112631e-165
Kwal_27.115422.284ON79131512711e-164
KAFR0H033302.284ON36931212101e-161
KLLA0E08405g2.284ON77731712471e-161
Skud_14.3092.284ON63931412211e-158
Suva_14.3272.284ON63230812111e-157
YNL020C (ARK1)2.284ON63831412101e-157
CAGL0G02607g2.284ON68832012061e-156
ADL217W2.284ON75031612071e-155
KNAG0H020202.284ON59231211891e-154
Smik_14.3112.284ON63730911901e-154
Ecym_33232.284ON74831711931e-153
Kpol_1039.332.284ON70132111781e-151
KNAG0A054302.284ON78832811091e-140
TBLA0B069402.284ON144331711511e-140
CAGL0J03432g2.284ON62231110881e-139
TPHA0D015402.284ON70730710311e-129
KNAG0J008203.273ON10913237958e-92
KAFR0A010403.273ON9123207772e-90
CAGL0H10208g3.273ON10273207771e-89
SAKL0D03234g3.273ON8583077653e-89
NCAS0A105903.273ON10953237632e-87
Kpol_251.43.273ON8383127495e-87
Kpol_1052.223.273ON11013207582e-86
TBLA0E025903.273ON10613167543e-86
NDAI0A057003.273ON11573287556e-86
KAFR0C004303.273ON9493237468e-86
KNAG0H012203.273ON9133267334e-84
TPHA0A040303.273ON10543237368e-84
TPHA0M011203.273ON7883147231e-83
KLLA0F18612g3.273ON8143047241e-83
TDEL0D035203.273ON10493177305e-83
Ecym_26503.273ON8943077211e-82
AGR027C3.273ON9613127232e-82
KLTH0C07260g3.273ON9013087158e-82
Smik_2.1913.273ON11083237203e-81
ZYRO0E06864g3.273ON11153207203e-81
Suva_4.2973.273ON11073237151e-80
Skud_2.1793.273ON10903217132e-80
YBR059C (AKL1)3.273ON11083237132e-80
Kwal_27.109453.273ON9353087046e-80
CAGL0K11990g3.273ON9913227059e-80
TBLA0I019303.273ON13613167069e-79
KAFR0A050906.31ON6683252636e-23
SAKL0A03344g6.262ON3643602442e-21
TDEL0A067506.262ON3723402282e-19
SAKL0H06754g8.668ON8842972316e-19
TPHA0F024306.31ON7982772262e-18
ZYRO0D05500g7.86ON12621822238e-18
Suva_16.1608.668ON9182872202e-17
Kwal_56.242746.262ON3463272122e-17
KLTH0D11044g8.668ON8492942182e-17
KAFR0D012207.86ON10553142183e-17
ZYRO0F07194g8.668ON9382762164e-17
Skud_16.1328.668ON9242872146e-17
ZYRO0F18062g1.24ON4711932118e-17
NCAS0C016708.668ON8962062139e-17
Kpol_1072.198.668ON8962012121e-16
Kwal_26.87518.668ON8482082121e-16
KLTH0H03080g6.262ON3463322052e-16
YPL150W8.668ON9012872102e-16
TDEL0C067801.24ON4682012072e-16
CAGL0M02299g8.668ON8932102102e-16
Kpol_1023.266.31ON7392722093e-16
KAFR0G012001.24ON5072152063e-16
Suva_16.706.262ON3643452033e-16
Smik_13.1596.31ON7052772074e-16
KNAG0F001701.24ON5432842064e-16
Kwal_33.131121.24ON5051922046e-16
NDAI0F045201.24ON4891942036e-16
KLLA0F07623g7.86ON12291962067e-16
YMR001C (CDC5)6.31ON7052772058e-16
CAGL0M11396g8.279ON11922102058e-16
TPHA0E038501.24ON4821932029e-16
Smik_6.3478.668ON9172872041e-15
Skud_13.1546.31ON7052772031e-15
KLTH0G05214g5.591ON6532822031e-15
Kpol_2002.241.24ON4871862011e-15
KAFR0C014403.92ON10952702041e-15
Skud_16.426.262ON3643321981e-15
Suva_13.1636.31ON7052772012e-15
KNAG0E008506.31ON7112812012e-15
KLTH0F16676g5.406ON8782052012e-15
CAGL0J11638g6.31ON7462782002e-15
TBLA0A074601.24ON5161891993e-15
NCAS0D021006.31ON7262842003e-15
TDEL0A061408.668ON8612862003e-15
TDEL0H036407.86ON12371862004e-15
KNAG0D048107.86ON14401822004e-15
Kpol_1037.206.31ON7042941994e-15
TBLA0A047207.86ON12621802004e-15
KAFR0B028008.279ON10952111994e-15
Smik_6.4416.262ON3643321945e-15
NDAI0C026806.31ON7502771976e-15
ZYRO0D06776g8.279ON12042101986e-15
Suva_15.2975.406ON10742191987e-15
KLTH0C10912g6.31ON6972841968e-15
ZYRO0C06776g5.591ON8902851969e-15
NDAI0H024707.86ON14111851961e-14
TDEL0G043806.31ON7222841951e-14
Smik_1.793.177ON9742721951e-14
Skud_8.1635.406ON10762191951e-14
Kwal_47.183075.591ON6212741941e-14
SAKL0C00946g1.24ON5641931931e-14
YPL236C (ENV7)6.262ON3643321901e-14
Kwal_55.215455.406ON8652051942e-14
Skud_1.723.177ON9742681942e-14
Ecym_26407.86ON13251791952e-14
KLTH0F00946g1.24ON5121921912e-14
KAFR0K007007.86ON13811821942e-14
Smik_8.1805.406ON10732191932e-14
Kpol_1012.68.654ON6282331922e-14
KLLA0E21693g5.406ON10162221932e-14
TPHA0H016305.406ON10362191933e-14
CAGL0F00913g7.86ON12061861933e-14
CAGL0B01925g8.279ON9442141923e-14
TPHA0G016308.668ON8712911923e-14
ACL006W6.31ON7082851904e-14
NCAS0C041008.141ON9053361914e-14
SAKL0H16632g8.279ON10623071914e-14
KNAG0J016708.668ON10091971915e-14
ZYRO0A06446g5.406ON9431861905e-14
YAR019C (CDC15)3.177ON9742721905e-14
CAGL0L11550g5.406ON10721941905e-14
Ecym_30356.31ON7402851895e-14
Kpol_1031.105.406ON11271861906e-14
NCAS0A002801.24ON5352841886e-14
Kpol_1040.207.86ON12971811906e-14
KLLA0C06138g6.31ON7082771896e-14
YHR102W (KIC1)5.406ON10802191897e-14
SAKL0H07084g8.654ON9192211897e-14
YOL045W (PSK2)7.86ON11011841897e-14
ACR133C8.668ON8512141897e-14
TBLA0C046008.279ON13152111897e-14
Ecym_21536.262ON3633461848e-14
Kwal_26.71547.86ON12132031898e-14
NDAI0E012908.654ON7292341888e-14
CAGL0I07513g3.92ON10762831881e-13
TPHA0H026307.86ON13671841881e-13
TPHA0I009201.271ON14342621871e-13
KLLA0F14190g1.271ON13382531872e-13
ZYRO0C07480g6.31ON7742841852e-13
KLLA0C00979g1.24ON4832091832e-13
TPHA0J004206.31ON7072751842e-13
CAGL0G04609g3.92ON9652841852e-13
TBLA0B082503.92ON13472151852e-13
KNAG0G021108.279ON11921911852e-13
TDEL0D053203.92ON10572261842e-13
Smik_4.7673.92ON7582881843e-13
TDEL0F040608.279ON11262221843e-13
Ecym_10301.24ON4401991813e-13
TBLA0A035705.406ON9751951843e-13
KLLA0F11319g8.668ON8431931843e-13
AFR724C1.24ON4402811813e-13
SAKL0G01848g5.406ON8851971833e-13
NDAI0B020708.279ON12582121843e-13
KAFR0C009303.177ON9362681833e-13
NCAS0F015807.86ON13821851843e-13
YDR523C (SPS1)1.24ON4901931814e-13
TPHA0D011408.654ON6222331824e-13
Kwal_26.73551.271ON14462361834e-13
TBLA0B039708.654ON12082091834e-13
Suva_2.7031.24ON4851921804e-13
Kwal_27.100041.507ON7351741824e-13
TBLA0B004906.31ON7872781825e-13
Ecym_35863.92ON10771931825e-13
KAFR0H025108.668ON8793061825e-13
KLTH0D10714g8.654ON8722081825e-13
KAFR0D049505.406ON10082371825e-13
Skud_4.7971.24ON4851921795e-13
KNAG0A030408.654ON6442011806e-13
ZYRO0B01166g2.496ON9632491816e-13
NCAS0A094701.271ON15152061817e-13
NCAS0H019405.406ON10152191817e-13
TPHA0G032902.496ON9732271807e-13
NCAS0B050908.279ON12102111817e-13
Kpol_463.81.271ON14472681817e-13
Kwal_56.224766.31ON6972771808e-13
KLTH0G13288g8.279ON11422141808e-13
KLTH0D02486g7.86ON12232031808e-13
Skud_15.543.92ON10822271809e-13
SAKL0A04246g6.222ON4001971769e-13
SAKL0D12628g1.507ON8181861799e-13
Skud_15.1127.86ON11011841801e-12
Kwal_26.78612.496ON9552171791e-12
SAKL0B09856g7.86ON12741901791e-12
AFR092W1.271ON14232721801e-12
TBLA0E022907.86ON13001851791e-12
TBLA0B023103.92ON8191961791e-12
Smik_4.8031.24ON4901931771e-12
Kwal_56.226933.92ON9841931791e-12
CAGL0H01639g1.24ON5211921771e-12
TDEL0A060008.654ON7902011781e-12
Skud_4.7643.92ON7562011781e-12
KLTH0C09548g3.92ON9931991781e-12
NCAS0B037408.279ON10492241781e-12
KLTH0D03454g1.271ON14332361791e-12
CAGL0K02673g2.496ON9152251781e-12
Smik_15.1227.86ON11011841781e-12
NDAI0K021002.496ON9092221781e-12
Suva_6.1691.271ON14842061791e-12
Ecym_55055.406ON10031951781e-12
Skud_1.447.86ON13561811781e-12
Kpol_1072.298.654ON8932791782e-12
Skud_16.3403.338ON3882271742e-12
Suva_16.3823.338ON3982231742e-12
KNAG0B043205.406ON10272301782e-12
NDAI0E023908.668ON8832021772e-12
YPL141C (FRK1)8.654ON8652471772e-12
SAKL0E01584g6.31ON6952841772e-12
Skud_10.1191.271ON14812061782e-12
Kpol_1044.37.86ON9321811772e-12
TDEL0A045805.591ON6942851772e-12
CAGL0M02519g8.654ON7562071762e-12
Smik_4.3678.279ON10662241772e-12
Kwal_56.237178.279ON8582141772e-12
Kpol_1065.36.222ON3761951732e-12
YDR490C (PKH1)3.92ON7661941762e-12
YOL100W (PKH2)3.92ON10812851772e-12
KAFR0G026906.31ON7132901762e-12
Ecym_42918.279ON11452021772e-12
TBLA0H016605.406ON9962411762e-12
YJL095W (BCK1)1.271ON14782061772e-12
TDEL0D014001.271ON14292061772e-12
KLLA0E03587g5.591ON6472901752e-12
YAL017W (PSK1)7.86ON13561811762e-12
ZYRO0F06842g8.654ON8432021762e-12
TPHA0J008208.279ON12182501762e-12
Smik_10.1471.271ON14782061763e-12
CAGL0H06259g7.86ON13361791763e-12
Smik_8.422.496ON9392291763e-12
Suva_2.2838.279ON10892221763e-12
ACR281C7.86ON12591411763e-12
KLLA0C04191g3.177ON7972171753e-12
Smik_6.3398.654ON8652061753e-12
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1003.35
         (713 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....  1255   0.0  
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...   538   0.0  
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...   518   e-175
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...   513   e-172
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...   512   e-171
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...   506   e-170
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...   506   e-169
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...   506   e-168
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...   505   e-168
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...   498   e-167
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...   499   e-166
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...   499   e-166
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...   493   e-165
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284    489   e-165
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...   495   e-165
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...   491   e-165
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...   494   e-164
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...   470   e-161
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...   484   e-161
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...   474   e-158
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...   471   e-157
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...   470   e-157
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...   469   e-156
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...   469   e-155
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...   462   e-154
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...   462   e-154
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...   464   e-153
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...   458   e-151
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...   431   e-140
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...   447   e-140
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...   423   e-139
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...   401   e-129
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...   310   8e-92
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...   303   2e-90
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...   303   1e-89
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...   299   3e-89
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...   298   2e-87
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...   293   5e-87
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...   296   2e-86
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...   295   3e-86
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...   295   6e-86
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...   291   8e-86
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...   286   4e-84
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....   288   8e-84
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...   283   1e-83
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...   283   1e-83
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....   285   5e-83
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...   282   1e-82
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...   283   2e-82
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...   280   8e-82
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...   281   3e-81
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...   281   3e-81
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...   280   1e-80
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...   279   2e-80
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...   279   2e-80
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...   275   6e-80
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...   276   9e-80
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...   276   9e-79
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}            105   6e-23
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    99   2e-21
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    92   2e-19
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    94   6e-19
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    92   2e-18
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    91   8e-18
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    89   2e-17
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    86   2e-17
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    89   2e-17
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    89   3e-17
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    88   4e-17
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    87   6e-17
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    86   8e-17
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    87   9e-17
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    86   1e-16
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    86   1e-16
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    84   2e-16
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    86   2e-16
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    84   2e-16
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    86   2e-16
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    85   3e-16
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    84   3e-16
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    83   3e-16
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    84   4e-16
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    84   4e-16
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    83   6e-16
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    83   6e-16
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    84   7e-16
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    84   8e-16
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    84   8e-16
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    82   9e-16
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    83   1e-15
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    83   1e-15
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    83   1e-15
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    82   1e-15
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    83   1e-15
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    81   1e-15
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    82   2e-15
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    82   2e-15
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    82   2e-15
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    82   2e-15
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    81   3e-15
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      82   3e-15
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    82   3e-15
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    82   4e-15
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    82   4e-15
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    81   4e-15
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    82   4e-15
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    81   4e-15
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    79   5e-15
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    80   6e-15
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    81   6e-15
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    81   7e-15
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    80   8e-15
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    80   9e-15
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    80   1e-14
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    80   1e-14
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    80   1e-14
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    80   1e-14
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    79   1e-14
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    79   1e-14
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    78   1e-14
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    79   2e-14
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    79   2e-14
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    80   2e-14
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    78   2e-14
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    79   2e-14
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    79   2e-14
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    79   2e-14
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    79   2e-14
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    79   3e-14
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    79   3e-14
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    79   3e-14
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    79   3e-14
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    78   4e-14
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     78   4e-14
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    78   4e-14
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    78   5e-14
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    78   5e-14
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    78   5e-14
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    78   5e-14
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    77   5e-14
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    78   6e-14
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        77   6e-14
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    78   6e-14
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    77   6e-14
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    77   7e-14
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    77   7e-14
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    77   7e-14
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    77   7e-14
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    77   7e-14
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    75   8e-14
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    77   8e-14
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    77   8e-14
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    77   1e-13
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    77   1e-13
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    77   1e-13
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    77   2e-13
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    76   2e-13
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    75   2e-13
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    75   2e-13
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    76   2e-13
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    76   2e-13
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    76   2e-13
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    75   2e-13
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    75   3e-13
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    75   3e-13
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    74   3e-13
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    75   3e-13
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    75   3e-13
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    74   3e-13
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    75   3e-13
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              75   3e-13
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    75   3e-13
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    75   3e-13
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    74   4e-13
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    75   4e-13
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    75   4e-13
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    75   4e-13
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    74   4e-13
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    75   4e-13
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    75   5e-13
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    75   5e-13
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    75   5e-13
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    75   5e-13
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    75   5e-13
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    74   5e-13
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    74   6e-13
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    74   6e-13
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    74   7e-13
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    74   7e-13
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    74   7e-13
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              74   7e-13
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    74   7e-13
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    74   8e-13
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    74   8e-13
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    74   8e-13
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    74   9e-13
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    72   9e-13
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    74   9e-13
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    74   1e-12
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    74   1e-12
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    74   1e-12
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    74   1e-12
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    74   1e-12
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    74   1e-12
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    73   1e-12
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    74   1e-12
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    73   1e-12
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    73   1e-12
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    73   1e-12
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    73   1e-12
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    73   1e-12
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    74   1e-12
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    73   1e-12
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    73   1e-12
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    73   1e-12
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    74   1e-12
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    73   1e-12
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    73   1e-12
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    73   2e-12
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    72   2e-12
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    72   2e-12
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    73   2e-12
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    73   2e-12
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    73   2e-12
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    73   2e-12
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    73   2e-12
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    73   2e-12
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    73   2e-12
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    72   2e-12
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    73   2e-12
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    73   2e-12
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    71   2e-12
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    72   2e-12
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    73   2e-12
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    72   2e-12
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    73   2e-12
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    72   2e-12
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    73   2e-12
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    73   2e-12
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    72   2e-12
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    72   2e-12
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    72   2e-12
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    72   2e-12
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    72   3e-12
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    72   3e-12
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    72   3e-12
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    72   3e-12
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    72   3e-12
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    72   3e-12
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    72   3e-12
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    72   3e-12
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    72   3e-12
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    72   3e-12
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    72   3e-12
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    72   3e-12
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    72   3e-12
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    72   4e-12
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    72   4e-12
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    72   4e-12
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    72   4e-12
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    69   4e-12
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    72   5e-12
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    72   5e-12
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    71   5e-12
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    70   5e-12
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    71   5e-12
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     71   6e-12
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    71   6e-12
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    71   6e-12
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    71   6e-12
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    71   6e-12
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    71   6e-12
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    71   6e-12
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    70   6e-12
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    71   7e-12
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    70   7e-12
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    69   7e-12
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    71   7e-12
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    70   7e-12
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    69   7e-12
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    71   8e-12
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    71   8e-12
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    70   8e-12
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    70   9e-12
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    70   9e-12
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    70   9e-12
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    70   9e-12
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    70   1e-11
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    70   1e-11
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    70   1e-11
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    70   1e-11
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    70   1e-11
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    70   1e-11
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    70   1e-11
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    70   1e-11
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    69   1e-11
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    70   1e-11
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    69   1e-11
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    70   2e-11
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              68   2e-11
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    69   2e-11
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    69   2e-11
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    70   2e-11
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    69   2e-11
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    70   2e-11
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    70   2e-11
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    70   2e-11
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    68   2e-11
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     69   2e-11
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    70   2e-11
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    67   2e-11
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    69   2e-11
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    69   2e-11
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    69   2e-11
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    68   2e-11
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    69   2e-11
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    69   2e-11
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    69   3e-11
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    69   3e-11
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    67   3e-11
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    69   3e-11
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    69   3e-11
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    69   3e-11
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     69   3e-11
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    65   3e-11
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    69   3e-11
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    69   3e-11
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    68   3e-11
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    69   3e-11
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    69   3e-11
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    69   3e-11
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    69   4e-11
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    68   4e-11
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    67   4e-11
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    67   4e-11
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    69   4e-11
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    69   4e-11
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               68   5e-11
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    67   5e-11
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    68   5e-11
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               67   5e-11
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    66   5e-11
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    68   6e-11
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     67   6e-11
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    68   6e-11
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    67   6e-11
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    67   7e-11
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       68   7e-11
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    68   7e-11
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    68   7e-11
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    68   8e-11
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    67   8e-11
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    65   8e-11
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     66   8e-11
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     67   8e-11
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    67   8e-11
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    67   8e-11
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    65   9e-11
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    67   9e-11
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    67   9e-11
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    67   9e-11
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    67   9e-11
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    67   9e-11
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    67   1e-10
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    67   1e-10
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    67   1e-10
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    67   1e-10
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    67   1e-10
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    67   1e-10
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    66   1e-10
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    67   1e-10
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    65   2e-10
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    67   2e-10
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    66   2e-10
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    67   2e-10
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    65   2e-10
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    65   2e-10
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    65   2e-10
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    66   2e-10
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    66   2e-10
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    66   2e-10
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    65   2e-10
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    65   2e-10
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    66   2e-10
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    65   2e-10
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    65   2e-10
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    65   3e-10
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    65   3e-10
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    65   3e-10
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    65   3e-10
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    66   3e-10
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    64   3e-10
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    64   3e-10
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    65   4e-10
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    64   4e-10
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    64   4e-10
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    65   4e-10
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    65   4e-10
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    64   4e-10
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    63   5e-10
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    65   5e-10
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    65   5e-10
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    65   5e-10
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    65   5e-10
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    65   5e-10
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    63   5e-10
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    64   5e-10
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    65   6e-10
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    64   6e-10
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    64   6e-10
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    64   6e-10
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    64   6e-10
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    64   6e-10
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    64   6e-10
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    65   7e-10
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    64   7e-10
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    65   7e-10
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    64   8e-10
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    64   8e-10
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    64   8e-10
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    64   8e-10
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    64   8e-10
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    62   8e-10
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    62   9e-10
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    64   9e-10
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    64   9e-10
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    64   9e-10
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    64   1e-09
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    64   1e-09
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    64   1e-09
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    64   1e-09
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    63   1e-09
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    64   1e-09
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    64   1e-09
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    64   1e-09
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               64   1e-09
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    64   1e-09
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    63   1e-09
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    62   1e-09
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    63   1e-09
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    63   1e-09
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    63   1e-09
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    62   1e-09
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    62   2e-09
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    63   2e-09
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    63   2e-09
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    64   2e-09
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    63   2e-09
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    62   2e-09
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    63   2e-09
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    62   2e-09
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    63   2e-09
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    63   2e-09
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    62   2e-09
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    62   2e-09
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    63   2e-09
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    63   2e-09
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    62   2e-09
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    62   2e-09
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    63   2e-09
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    63   2e-09
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              63   2e-09
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    63   2e-09
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    63   2e-09
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    62   2e-09
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    62   2e-09
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    63   2e-09
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    63   3e-09
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    63   3e-09
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    62   3e-09
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    62   3e-09
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    61   3e-09
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    62   3e-09
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    62   3e-09
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    62   3e-09
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    63   3e-09
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    62   3e-09
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    61   3e-09
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    62   3e-09
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    62   3e-09
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    62   3e-09
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    61   3e-09
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    62   3e-09
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    62   3e-09
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    62   3e-09
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               62   3e-09
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    62   4e-09
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    60   4e-09
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    62   4e-09
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    62   4e-09
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    62   4e-09
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    62   4e-09
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    62   4e-09
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    62   4e-09
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    62   4e-09
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    61   4e-09
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    60   4e-09
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    60   4e-09
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              62   4e-09
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    62   4e-09
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    62   4e-09
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    62   4e-09
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    62   4e-09
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    61   5e-09
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    60   5e-09
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    61   5e-09
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    62   5e-09
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    62   5e-09
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    62   5e-09
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    62   5e-09
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    61   5e-09
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    62   5e-09
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    62   5e-09
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    61   5e-09
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    62   5e-09
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    62   5e-09
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    62   5e-09
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    62   5e-09
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    62   6e-09
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    61   6e-09
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    61   6e-09
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    61   6e-09
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    61   6e-09
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    61   6e-09
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    61   6e-09
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    60   6e-09
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    60   6e-09
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    61   7e-09
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    61   7e-09
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    61   7e-09
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    61   7e-09
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    60   7e-09
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    60   7e-09
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    61   7e-09
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    61   7e-09
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    60   8e-09
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    61   8e-09
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    61   8e-09
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    60   8e-09
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    61   8e-09
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    60   8e-09
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    60   8e-09
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    61   8e-09
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    61   9e-09
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    61   9e-09
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    60   9e-09
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    59   9e-09
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    61   9e-09
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    60   9e-09
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    61   9e-09
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    61   9e-09
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    60   9e-09
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    61   1e-08
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    60   1e-08
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    61   1e-08
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    60   1e-08
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    60   1e-08
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    60   1e-08
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    61   1e-08
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    60   1e-08
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    61   1e-08
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    60   1e-08
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    61   1e-08
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    60   1e-08
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    60   1e-08
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    60   1e-08
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     60   1e-08
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    60   1e-08
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    60   1e-08
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    60   1e-08
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    60   1e-08
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    60   1e-08
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    60   1e-08
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    60   1e-08
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    60   1e-08
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    60   1e-08
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    60   1e-08
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     60   1e-08
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    60   1e-08
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    60   1e-08
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    60   1e-08
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    60   1e-08
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    60   1e-08
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     60   1e-08
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    60   1e-08
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    60   1e-08
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    60   1e-08
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    60   2e-08
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    60   2e-08
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    60   2e-08
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    60   2e-08
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    59   2e-08
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    59   2e-08
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    60   2e-08
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    60   2e-08
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    59   2e-08
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     59   2e-08
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     60   2e-08
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    60   2e-08
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    59   2e-08
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    59   2e-08
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    60   2e-08
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    60   2e-08
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    59   2e-08
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    59   2e-08
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    58   2e-08
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    60   2e-08
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    60   2e-08
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    60   2e-08
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              60   2e-08
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               60   2e-08
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    60   2e-08
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    60   2e-08
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    59   2e-08
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    60   2e-08
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    59   2e-08
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    59   2e-08
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    59   2e-08
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    59   2e-08
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    59   2e-08
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    59   3e-08
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    60   3e-08
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    60   3e-08
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    59   3e-08
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    59   3e-08
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    59   3e-08
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    59   3e-08
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    59   3e-08
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    59   3e-08
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    59   3e-08
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    59   3e-08
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    59   3e-08
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    59   3e-08
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    59   3e-08
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    59   3e-08
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    59   3e-08
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    59   3e-08
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    59   3e-08
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               59   3e-08
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    59   3e-08
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    59   3e-08
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    58   3e-08
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    59   3e-08
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    58   3e-08
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    59   3e-08
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    59   3e-08
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    59   4e-08
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    59   4e-08
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    59   4e-08
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    59   4e-08
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    59   4e-08
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    58   4e-08
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    59   4e-08
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    59   4e-08
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    59   4e-08
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    59   4e-08
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    59   4e-08
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    59   4e-08
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    59   4e-08
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    59   4e-08
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    58   4e-08
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    58   4e-08
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    59   4e-08
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    58   4e-08
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    58   5e-08
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    59   5e-08
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    59   5e-08
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    58   5e-08
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    58   5e-08
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     58   5e-08
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    58   5e-08
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     58   5e-08
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    58   5e-08
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    58   5e-08
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    58   5e-08
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    59   5e-08
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    58   5e-08
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    58   5e-08
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    58   5e-08
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    58   5e-08
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    58   5e-08
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    58   6e-08
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    58   6e-08
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    58   6e-08
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    58   6e-08
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    59   6e-08
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    57   6e-08
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              58   6e-08
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    58   6e-08
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    58   6e-08
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    58   6e-08
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    58   6e-08
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    57   6e-08
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    58   6e-08
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    58   6e-08
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    58   7e-08
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    58   7e-08
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    58   7e-08
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    58   7e-08
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    58   7e-08
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    58   7e-08
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    58   7e-08
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    58   7e-08
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    57   7e-08
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    57   8e-08
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    58   8e-08
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    57   8e-08
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    58   8e-08
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    57   8e-08
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    58   8e-08
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    58   8e-08
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    58   8e-08
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     57   8e-08
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    57   9e-08
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    57   9e-08
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    58   9e-08
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    57   9e-08
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    57   9e-08
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    58   1e-07
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    57   1e-07
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    57   1e-07
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    57   1e-07
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    57   1e-07
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    57   1e-07
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    57   1e-07
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    57   1e-07
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    57   1e-07
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    57   1e-07
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    57   1e-07
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    57   1e-07
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    57   1e-07
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    57   1e-07
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    57   1e-07
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    57   1e-07
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    57   1e-07
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    57   1e-07
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    57   1e-07
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    56   1e-07
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    57   1e-07
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    57   1e-07
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    57   1e-07
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    57   1e-07
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    57   1e-07
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    57   1e-07
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    57   1e-07
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    55   1e-07
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    57   1e-07
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    57   1e-07
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    56   1e-07
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    57   1e-07
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    56   2e-07
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    57   2e-07
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              57   2e-07
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    57   2e-07
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    57   2e-07
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    57   2e-07
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    57   2e-07
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    57   2e-07
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    57   2e-07
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    57   2e-07
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    57   2e-07
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    57   2e-07
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       56   2e-07
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    57   2e-07
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     56   2e-07
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    57   2e-07
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    56   2e-07
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     56   2e-07
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    56   2e-07
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    56   2e-07
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    56   2e-07
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    57   2e-07
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    56   2e-07
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    57   2e-07
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    57   2e-07
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    56   2e-07
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    56   2e-07
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    56   2e-07
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    56   2e-07
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    57   2e-07
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               56   2e-07
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    56   2e-07
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    56   2e-07
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     56   2e-07
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    56   2e-07
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    56   2e-07
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    56   2e-07
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    56   2e-07
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    57   2e-07
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    56   2e-07
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    56   2e-07
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    56   2e-07
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    56   2e-07
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    56   2e-07
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    56   2e-07
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    56   2e-07
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    56   2e-07
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    56   2e-07
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    56   2e-07
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    56   3e-07
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    56   3e-07
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    56   3e-07
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    56   3e-07
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    55   3e-07
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    55   3e-07
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    56   3e-07
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    56   3e-07
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    56   3e-07
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    55   3e-07
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    56   3e-07
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    56   3e-07
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    55   3e-07
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    56   3e-07
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    56   3e-07
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    56   3e-07
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    56   3e-07
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    55   3e-07
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    56   3e-07
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    55   3e-07
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    55   3e-07
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    55   3e-07
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    56   4e-07
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    55   4e-07
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    55   4e-07
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    55   4e-07
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    54   4e-07
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    55   4e-07
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    55   4e-07
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    55   4e-07
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    55   4e-07
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    54   4e-07
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    55   4e-07
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    55   4e-07
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    55   4e-07
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    55   4e-07
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    55   4e-07
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    55   4e-07
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    55   4e-07
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    55   4e-07
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    55   4e-07
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    55   4e-07
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    55   4e-07
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    54   5e-07
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    55   5e-07
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    55   5e-07
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    55   5e-07
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    55   5e-07
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    55   5e-07
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    55   5e-07
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    54   5e-07
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    55   5e-07
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    55   5e-07
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    55   5e-07
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    55   5e-07
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    55   5e-07
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    55   5e-07
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    55   5e-07
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    55   5e-07
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    54   5e-07
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    55   5e-07
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               55   5e-07
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    55   5e-07
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    55   5e-07
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    54   5e-07
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    55   6e-07
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    55   6e-07
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    54   6e-07
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    55   6e-07
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    55   6e-07
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    55   6e-07
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    55   6e-07
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    55   6e-07
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    54   6e-07
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    54   6e-07
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    54   6e-07
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    55   6e-07
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    55   6e-07
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    54   6e-07
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    54   7e-07
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    55   7e-07
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    55   7e-07
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    54   7e-07
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    55   7e-07
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    55   7e-07
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    54   7e-07
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    55   7e-07
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    55   7e-07
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    55   7e-07
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    54   7e-07
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    55   7e-07
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    55   7e-07
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    55   7e-07
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    55   7e-07
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    55   7e-07
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    55   7e-07
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    54   8e-07
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    54   8e-07
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    54   8e-07
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    54   8e-07
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    55   8e-07
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    54   8e-07
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    54   8e-07
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    55   8e-07
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    54   8e-07
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    54   9e-07
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    54   9e-07
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    54   9e-07
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    54   9e-07
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    54   9e-07
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    54   9e-07
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    54   9e-07
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    54   9e-07
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    54   9e-07
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    54   9e-07
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    54   9e-07
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    54   1e-06
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    54   1e-06
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    53   1e-06
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    54   1e-06
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    54   1e-06
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    54   1e-06
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    54   1e-06
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    54   1e-06
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    54   1e-06
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    54   1e-06
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    54   1e-06
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    53   1e-06
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    54   1e-06
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    54   1e-06
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    54   1e-06
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    54   1e-06
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    54   1e-06
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    54   1e-06
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    54   1e-06
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    54   1e-06
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    54   1e-06
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    54   1e-06
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    54   1e-06
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    54   1e-06
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    53   1e-06
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              54   1e-06
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     54   1e-06
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    54   1e-06
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    53   1e-06
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    54   1e-06
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    53   1e-06
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    54   1e-06
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    54   1e-06
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    54   1e-06
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    54   1e-06
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    54   1e-06
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    54   1e-06
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    53   1e-06
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    54   1e-06
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    54   1e-06
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    54   1e-06
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    54   1e-06
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    54   1e-06
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    54   1e-06
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    53   1e-06
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    54   1e-06
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    52   1e-06
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    53   1e-06
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    54   1e-06
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    54   1e-06
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      54   2e-06
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    54   2e-06
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     54   2e-06
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    53   2e-06
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    53   2e-06
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    54   2e-06
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    54   2e-06
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    54   2e-06
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    54   2e-06
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    53   2e-06
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    54   2e-06
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    52   2e-06
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    54   2e-06
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    53   2e-06
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    53   2e-06
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    53   2e-06
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    53   2e-06
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    53   2e-06
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    53   2e-06
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    53   2e-06
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    53   2e-06
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    52   2e-06
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    53   2e-06
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    52   2e-06
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    52   2e-06
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    53   2e-06
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    53   2e-06
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    53   2e-06
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    53   2e-06
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    54   2e-06
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    53   2e-06
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    53   2e-06
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    52   2e-06
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    54   2e-06
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    53   2e-06
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    52   2e-06
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    53   2e-06
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    53   2e-06
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    53   2e-06
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    53   2e-06
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    53   2e-06
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    53   2e-06
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    53   2e-06
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    53   2e-06
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    53   2e-06
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    52   2e-06
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    52   2e-06
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    53   2e-06
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    53   2e-06
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    52   2e-06
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    52   2e-06
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    52   3e-06
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    52   3e-06
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    52   3e-06
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    53   3e-06
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    52   3e-06
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    52   3e-06
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    53   3e-06
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    53   3e-06
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       53   3e-06
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    52   3e-06
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    52   3e-06
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    53   3e-06
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    52   3e-06
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      53   3e-06
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    53   3e-06
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    52   3e-06
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    52   3e-06
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               52   3e-06
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    52   3e-06
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    52   3e-06
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    52   3e-06
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    53   3e-06
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    52   3e-06
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    52   3e-06
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    52   3e-06
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    52   3e-06
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    52   3e-06
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    52   3e-06
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    52   3e-06
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    52   3e-06
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    53   3e-06
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    52   3e-06
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     52   3e-06
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    52   3e-06
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    52   3e-06
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    52   4e-06
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    52   4e-06
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    52   4e-06
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    52   4e-06
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    52   4e-06
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     52   4e-06
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    52   4e-06
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    52   4e-06
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    52   4e-06
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    52   4e-06
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               52   4e-06
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    52   4e-06
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    52   4e-06
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    52   4e-06
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    52   4e-06
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    52   4e-06
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    52   4e-06
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    52   4e-06
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    52   4e-06
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    52   4e-06
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    52   4e-06
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    52   5e-06
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    52   5e-06
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    52   5e-06
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    52   5e-06
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    52   5e-06
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    50   5e-06
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    52   5e-06
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    51   5e-06
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    52   5e-06
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    52   5e-06
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    52   5e-06
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    52   5e-06
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    52   5e-06
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    52   5e-06
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    52   5e-06
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    52   5e-06
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    52   5e-06
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    51   5e-06
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    52   5e-06
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    51   5e-06
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    51   5e-06
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    52   5e-06
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    52   5e-06
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    52   5e-06
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    51   5e-06
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    51   6e-06
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    51   6e-06
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    52   6e-06
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    52   6e-06
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    52   6e-06
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    52   6e-06
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    52   6e-06
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    52   6e-06
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    52   6e-06
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    52   6e-06
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    51   6e-06
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    51   6e-06
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    52   6e-06
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    52   7e-06
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    51   7e-06
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    51   7e-06
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    50   7e-06
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    52   7e-06
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    51   7e-06
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    51   7e-06
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    52   7e-06
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    51   7e-06
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    51   7e-06
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    51   7e-06
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    51   8e-06
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    51   8e-06
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    51   8e-06
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    52   8e-06
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    51   8e-06
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    51   8e-06
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    51   8e-06
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    50   8e-06
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    51   8e-06
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    51   8e-06
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    50   8e-06
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    51   9e-06
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    50   9e-06
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    51   9e-06
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    51   9e-06
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    50   9e-06
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    50   9e-06
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    50   9e-06
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    51   1e-05
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    50   1e-05
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    51   1e-05
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    50   1e-05
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    51   1e-05
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    51   1e-05
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162     51   1e-05
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    50   1e-05
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    51   1e-05
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    51   1e-05
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    51   1e-05
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    51   1e-05
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    51   1e-05
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    50   1e-05
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    50   1e-05
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    50   1e-05
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    50   1e-05
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    50   1e-05
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    50   1e-05
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    50   1e-05
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             50   1e-05
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    50   1e-05
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    50   1e-05
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    49   1e-05
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    50   1e-05
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    50   1e-05
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    50   1e-05
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    50   1e-05
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    50   1e-05
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    50   1e-05
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    50   1e-05
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    51   1e-05
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    50   1e-05
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    50   1e-05
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    50   1e-05
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    50   1e-05
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    50   1e-05
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    50   1e-05
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      50   1e-05
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    50   1e-05
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    50   1e-05
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    50   1e-05
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    50   1e-05
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    50   1e-05
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    50   1e-05
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    50   1e-05
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    50   1e-05
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    50   1e-05
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    50   1e-05
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    49   1e-05
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    50   2e-05
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    50   2e-05
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    50   2e-05
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    50   2e-05
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    50   2e-05
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    50   2e-05
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    50   2e-05
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    50   2e-05
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    50   2e-05
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    50   2e-05
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    50   2e-05
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    50   2e-05
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    50   2e-05
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    49   2e-05
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    50   2e-05
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    50   2e-05
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    50   2e-05
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    49   2e-05
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    49   2e-05
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    49   2e-05
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    50   2e-05
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    50   2e-05
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    50   2e-05
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    50   2e-05
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    50   2e-05
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    50   2e-05
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    50   2e-05
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    50   2e-05
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    50   2e-05
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    50   2e-05
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    50   2e-05
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    50   2e-05
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    49   2e-05
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    50   2e-05
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    50   2e-05
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    50   2e-05
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    50   2e-05
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    50   2e-05
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    50   2e-05
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    49   2e-05
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    50   2e-05
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    50   2e-05
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               49   2e-05
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    50   2e-05
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    49   2e-05
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    50   2e-05
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    49   2e-05
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    49   2e-05
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    49   2e-05
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    50   2e-05
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    49   2e-05
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    49   2e-05
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    50   3e-05
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    49   3e-05
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    49   3e-05
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    49   3e-05
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    49   3e-05
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    49   3e-05
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    49   3e-05
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    49   3e-05
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    49   3e-05
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    49   3e-05
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    49   3e-05
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    49   3e-05
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    50   3e-05
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    49   3e-05
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    49   3e-05
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    49   3e-05
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    49   3e-05
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               49   3e-05
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    49   3e-05
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    49   3e-05
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    49   3e-05
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    49   3e-05
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    49   3e-05
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    49   3e-05
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    49   3e-05
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    49   3e-05
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    49   3e-05
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    49   3e-05
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    49   4e-05
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    48   4e-05
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    49   4e-05
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    49   4e-05
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    49   4e-05
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    49   4e-05
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    49   4e-05
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    49   4e-05
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    48   4e-05
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    49   4e-05
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    49   4e-05
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    49   4e-05
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    49   4e-05
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    49   4e-05
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    49   4e-05
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    48   4e-05
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    47   4e-05
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    49   4e-05
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    49   4e-05
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    49   4e-05
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     48   4e-05
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    49   5e-05
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    48   5e-05
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    48   5e-05
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    49   5e-05
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    49   5e-05
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              49   5e-05
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    49   5e-05
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    49   5e-05
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    49   5e-05
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    49   5e-05
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    48   5e-05
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    49   5e-05
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    48   5e-05
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    49   5e-05
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    49   5e-05
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    48   5e-05
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    48   5e-05
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    48   5e-05
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...    49   5e-05
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    48   5e-05
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    49   5e-05
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    49   5e-05
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    49   5e-05
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    48   5e-05
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    49   5e-05
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    49   5e-05
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    48   6e-05
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    48   6e-05
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    49   6e-05
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    48   6e-05
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    48   6e-05
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    48   6e-05
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    48   6e-05
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    48   6e-05
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    48   6e-05
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    48   6e-05
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    48   6e-05
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    48   6e-05
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    48   7e-05
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    48   7e-05
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    48   7e-05
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    48   7e-05
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    48   7e-05
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    48   7e-05
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     48   7e-05
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    48   7e-05
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    48   7e-05
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    48   7e-05
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    47   7e-05
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    48   7e-05
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    48   7e-05
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    48   7e-05
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    48   7e-05
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    48   7e-05
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    48   7e-05
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    48   8e-05
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    48   8e-05
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    48   8e-05
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    48   8e-05
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    48   8e-05
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    48   8e-05
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    48   8e-05
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    48   8e-05
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    48   8e-05
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    47   8e-05
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    48   8e-05
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    48   8e-05
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    48   8e-05
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...    48   8e-05
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    47   8e-05
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    47   9e-05
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    48   9e-05
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    47   9e-05
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    48   9e-05
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    47   9e-05
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    47   9e-05
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    47   1e-04
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    47   1e-04
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    47   1e-04
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    47   1e-04
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     48   1e-04
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    48   1e-04
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    48   1e-04
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    47   1e-04
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    48   1e-04
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    47   1e-04
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    47   1e-04
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    48   1e-04
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    47   1e-04
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    47   1e-04
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    47   1e-04
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    47   1e-04
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    47   1e-04
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    47   1e-04
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    47   1e-04
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    47   1e-04
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    47   1e-04
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    47   1e-04
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    47   1e-04
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    47   1e-04
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    47   1e-04
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    47   1e-04
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    47   1e-04
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    47   1e-04
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    47   1e-04
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    47   1e-04
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    47   1e-04
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    47   1e-04
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    47   1e-04
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    47   1e-04
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    47   1e-04
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    47   1e-04
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    47   1e-04
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    47   1e-04
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    47   1e-04
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    47   1e-04
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    47   2e-04
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    47   2e-04
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    47   2e-04
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    47   2e-04
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    47   2e-04
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    47   2e-04
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    47   2e-04
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     47   2e-04
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    47   2e-04
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    47   2e-04
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    47   2e-04
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    47   2e-04
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    47   2e-04
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    46   2e-04
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    47   2e-04
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    46   2e-04
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...    47   2e-04
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    47   2e-04
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     46   2e-04
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    47   2e-04
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    47   2e-04
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    47   2e-04
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    46   2e-04
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    47   2e-04
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    47   2e-04
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    46   2e-04
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    47   2e-04
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    47   2e-04
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    46   2e-04
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    47   2e-04
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    47   2e-04
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    47   2e-04
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    46   2e-04
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    46   2e-04
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    46   2e-04
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    47   2e-04
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    46   2e-04
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    46   2e-04
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    46   2e-04
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    46   2e-04
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    47   2e-04
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    46   2e-04
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    46   2e-04
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    46   2e-04
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    47   2e-04
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    46   2e-04
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    46   2e-04
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    47   2e-04
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    47   2e-04
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    46   2e-04
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    46   2e-04
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    46   2e-04
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    46   3e-04
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    45   3e-04
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    46   3e-04
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    46   3e-04
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    46   3e-04
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    45   3e-04
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    46   3e-04
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    46   3e-04
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    46   3e-04
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    45   3e-04
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    46   3e-04
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    46   3e-04
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    46   3e-04
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    46   3e-04
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    46   3e-04
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    46   3e-04
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    46   3e-04
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    46   3e-04
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    46   3e-04
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    46   3e-04
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     46   3e-04
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    45   3e-04
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    45   3e-04
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    46   3e-04
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    45   3e-04
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    46   4e-04
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    46   4e-04
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    45   4e-04
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    46   4e-04
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    45   4e-04
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    46   4e-04
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    46   4e-04
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...    45   4e-04
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    45   4e-04
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    46   4e-04
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    45   4e-04
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    45   4e-04
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    45   4e-04
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    46   4e-04
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    46   4e-04
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    45   4e-04
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    45   4e-04
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    45   4e-04
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    45   4e-04
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    45   5e-04
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    45   5e-04
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    45   5e-04
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    45   5e-04
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    45   5e-04
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    45   5e-04
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    45   5e-04
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    45   5e-04
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    45   5e-04
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    45   5e-04
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    45   5e-04
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    45   6e-04
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    45   6e-04
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    45   6e-04
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    45   6e-04
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    45   6e-04
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    45   6e-04
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    45   6e-04
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    45   6e-04
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               45   6e-04
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    45   7e-04
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    45   7e-04
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    45   7e-04
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    45   7e-04
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    45   7e-04
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    44   7e-04
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    45   8e-04
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    45   8e-04
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    45   8e-04
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    45   8e-04
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    45   8e-04
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    45   8e-04
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    45   8e-04
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    44   8e-04
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    45   8e-04
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    45   8e-04
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    44   9e-04
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    44   9e-04
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    44   0.001
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    44   0.001
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    44   0.001
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    45   0.001
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    44   0.001
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    44   0.001
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    44   0.001
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    44   0.001
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    44   0.001
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    44   0.001
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    44   0.001
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    44   0.001
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    44   0.001
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    44   0.001
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    44   0.001
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    44   0.001
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    44   0.001
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    44   0.001
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    44   0.001
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    44   0.001
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    44   0.001
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    44   0.001
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    44   0.002
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    44   0.002
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    43   0.002
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    44   0.002
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    44   0.002
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    44   0.002
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    44   0.002
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    43   0.002
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    43   0.002
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    44   0.002
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    44   0.002
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    44   0.002
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    43   0.002
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    43   0.002
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       43   0.002
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    43   0.002
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    42   0.003
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    43   0.003
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    43   0.003
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    43   0.003
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    43   0.003
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    42   0.003
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    43   0.003
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    43   0.003
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    43   0.003
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    42   0.003
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    43   0.003
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    42   0.003
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    43   0.003
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    43   0.003
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    40   0.003
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    42   0.004
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    42   0.004
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    42   0.004
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    43   0.004
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    42   0.004
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    42   0.004
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    42   0.004
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    42   0.004
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    42   0.004
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    42   0.004
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    42   0.004
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    42   0.004
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    42   0.004
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    42   0.004
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    42   0.005
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    42   0.005
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    42   0.005
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    42   0.005
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    42   0.005
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    42   0.005
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    42   0.005
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    42   0.005
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    42   0.005
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               42   0.006
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    42   0.006
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    42   0.006
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    42   0.006
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    42   0.006
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    42   0.006
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    42   0.006
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    42   0.006
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    42   0.006
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      42   0.006
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    42   0.006
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    41   0.007
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    42   0.007
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    42   0.007
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    42   0.008
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    42   0.008
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    42   0.008
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    41   0.008
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    41   0.008
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    41   0.008
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    42   0.008
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    41   0.008
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    41   0.009
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    41   0.009
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    41   0.010
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    41   0.010
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    41   0.010
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    41   0.010
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    41   0.010
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    41   0.011
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    41   0.012
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    41   0.013
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    40   0.014
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    40   0.016
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    40   0.016
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    40   0.018
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    40   0.018
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    40   0.019
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    40   0.019
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    40   0.019
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               40   0.020
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    40   0.020
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    40   0.021
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    40   0.021
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    40   0.021
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    40   0.022
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    40   0.022
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    40   0.023
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    40   0.023
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    40   0.025
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 40   0.025
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    40   0.025
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    40   0.027
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    40   0.027
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    40   0.027
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...    40   0.028
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      40   0.028
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    40   0.028
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    39   0.029
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...    39   0.031
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    39   0.032
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    39   0.033
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    39   0.033
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    39   0.033
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    39   0.036
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    39   0.040
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...    39   0.041
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    39   0.041
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    39   0.041
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    39   0.041
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    39   0.042
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    39   0.043
TBLA0B06620 Chr2 complement(1556378..1559671) [3294 bp, 1097 aa]...    39   0.043
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    39   0.044
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    39   0.045
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    39   0.045
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    39   0.045
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    39   0.046
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    39   0.046
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    39   0.049
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    39   0.049
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    39   0.053
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    39   0.054
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    39   0.057
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    39   0.057
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    38   0.060
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    38   0.061
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    39   0.062
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    39   0.065
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    38   0.073
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    38   0.074
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    38   0.078
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    38   0.079
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    38   0.079
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    38   0.081
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    38   0.085
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    38   0.086
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...    38   0.091
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    38   0.093
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    38   0.094
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    37   0.10 
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    37   0.10 
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    38   0.11 
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    38   0.11 
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               38   0.11 
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    37   0.12 
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    38   0.12 
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...    38   0.12 
ADL043C Chr4 complement(612088..614109) [2022 bp, 673 aa] {ON} S...    38   0.12 
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    38   0.12 
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    37   0.12 
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    37   0.13 
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    37   0.13 
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    37   0.13 
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             37   0.13 
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...    37   0.14 
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    37   0.14 
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    37   0.14 
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    37   0.14 
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    37   0.15 
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    37   0.15 
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    37   0.15 
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    37   0.16 
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    37   0.16 
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    37   0.18 
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    37   0.18 
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    37   0.18 
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    37   0.20 
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    37   0.20 
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    37   0.21 
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    37   0.21 
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    37   0.23 
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    37   0.23 
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    37   0.24 
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    37   0.25 
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    37   0.26 
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    36   0.26 
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    36   0.27 
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    36   0.32 
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    36   0.33 
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    36   0.33 
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    36   0.34 
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    36   0.38 
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    36   0.40 
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      36   0.41 
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    36   0.42 
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    35   0.46 
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    35   0.50 
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    35   0.57 
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    35   0.58 
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    35   0.60 
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    35   0.61 
ZYRO0G08316g Chr7 (677123..679465) [2343 bp, 780 aa] {ON} simila...    35   0.64 
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    35   0.64 
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    35   0.65 
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               35   0.75 
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    35   0.77 
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    35   0.81 
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    35   0.86 
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    35   0.91 
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    34   0.93 
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    34   0.95 
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    34   1.0  
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    34   1.0  
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               34   1.0  
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    34   1.0  
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    34   1.0  
TBLA0B05130 Chr2 complement(1207884..1210484) [2601 bp, 866 aa] ...    35   1.0  
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    34   1.1  
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    34   1.2  
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    34   1.2  
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    34   1.2  
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    34   1.3  
SAKL0C05236g Chr3 (498347..501385) [3039 bp, 1012 aa] {ON} simil...    34   1.3  
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    34   1.3  
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    34   1.3  
TBLA0G02780 Chr7 (730835..732529) [1695 bp, 564 aa] {ON} Anc_8.1...    34   1.4  
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    34   1.6  
CAGL0I08899g Chr9 complement(863906..866701) [2796 bp, 931 aa] {...    34   1.6  
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    34   1.7  
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    33   1.8  
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    33   2.0  
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    33   2.0  
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    33   2.0  
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    33   2.6  
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    33   2.7  
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    33   3.5  
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    33   3.6  
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    33   3.7  
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    33   3.9  
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    33   4.5  
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    32   4.8  
TBLA0D01110 Chr4 (283160..285640) [2481 bp, 826 aa] {ON} Anc_8.7...    32   5.1  
KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {O...    32   6.7  
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    32   7.5  
TDEL0H01730 Chr8 complement(299733..301586) [1854 bp, 617 aa] {O...    32   8.4  

>Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON}
           (89266..91407) [2142 nt, 714 aa]
          Length = 713

 Score = 1255 bits (3247), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 622/713 (87%), Positives = 622/713 (87%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60
           MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV
Sbjct: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60

Query: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120
           PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF
Sbjct: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180
           MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180

Query: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240
           VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300
           YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ
Sbjct: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300

Query: 301 GIPCPIKNFYLERAIHRSTLMPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 360
           GIPCPIKNFYLERAIHRSTLMP                                      
Sbjct: 301 GIPCPIKNFYLERAIHRSTLMPHQQQNNHHHHQQQQQQQLQQQQQQIQQQQQQIQQQFHI 360

Query: 361 XXXXXRGLHQSLSFPSLNSPLHNAQNITPNNVILTGVPLSAHASNDPAVVNNSFNVAATA 420
                RGLHQSLSFPSLNSPLHNAQNITPNNVILTGVPLSAHASNDPAVVNNSFNVAATA
Sbjct: 361 HQEQIRGLHQSLSFPSLNSPLHNAQNITPNNVILTGVPLSAHASNDPAVVNNSFNVAATA 420

Query: 421 KLQQIHIGTTDKNANILTNQRSRTMPDDQMSDYIGRTTSAGRGDISKIVASNPTLFDKTS 480
           KLQQIHIGTTDKNANILTNQRSRTMPDDQMSDYIGRTTSAGRGDISKIVASNPTLFDKTS
Sbjct: 421 KLQQIHIGTTDKNANILTNQRSRTMPDDQMSDYIGRTTSAGRGDISKIVASNPTLFDKTS 480

Query: 481 KSEVNSTGSLAENIASIASEKIXXXXXXXXXXXXXXXXXXXXIIVNDGDLTKLEKVQTSK 540
           KSEVNSTGSLAENIASIASEKI                    IIVNDGDLTKLEKVQTSK
Sbjct: 481 KSEVNSTGSLAENIASIASEKISSLKNQNLSQSSSTGSSHRSIIVNDGDLTKLEKVQTSK 540

Query: 541 EFEADSPIPVSKAKHHSLPSNFSSSIKIGNGEGTLTTXXXXXXXXXXXXXRMKNLIDNAD 600
           EFEADSPIPVSKAKHHSLPSNFSSSIKIGNGEGTLTT             RMKNLIDNAD
Sbjct: 541 EFEADSPIPVSKAKHHSLPSNFSSSIKIGNGEGTLTTSDSNQSDNNSIQDRMKNLIDNAD 600

Query: 601 NIPINKIASDYGKYTKSSDNFGKDSGEEMNDKENIKTANSGTRNQXXXXXXXXXXXXXXX 660
           NIPINKIASDYGKYTKSSDNFGKDSGEEMNDKENIKTANSGTRNQ               
Sbjct: 601 NIPINKIASDYGKYTKSSDNFGKDSGEEMNDKENIKTANSGTRNQPKKNKKEKPVPAKKP 660

Query: 661 AHLRPQKPPKPTFLAGKRKLDKNKSDVKTSSESMEPNLETLTEEFNKRFPNIS 713
           AHLRPQKPPKPTFLAGKRKLDKNKSDVKTSSESMEPNLETLTEEFNKRFPNIS
Sbjct: 661 AHLRPQKPPKPTFLAGKRKLDKNKSDVKTSSESMEPNLETLTEEFNKRFPNIS 713

>TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.284
           YNL020C
          Length = 697

 Score =  538 bits (1385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/324 (76%), Positives = 283/324 (87%), Gaps = 4/324 (1%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60
           MNQP+IP Y  GI L VG H A ILKYLTSGG+AQVYQ +ISP D  +GS+I CLKR+IV
Sbjct: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60

Query: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKS----GLHNGAYEVLLLMEFCAEGG 116
           PDK SLN PRAEV+AMKLLRN  +VVSYIDS+AAKS    G+ NG+YEV LLME+C+  G
Sbjct: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120

Query: 117 LIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLC 176
           LIDFMNTRLQNRL+EFEILNIMS V+QGVAAMH+L+PPLLHRDIKIENVLISN  E+KLC
Sbjct: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180

Query: 177 DFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFL 236
           DFGSVCGVIRPPT+Q E +FVQHDILKNTTAQYR+PEM+ LS+ +PI+EKSDIWALGVFL
Sbjct: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240

Query: 237 YKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEV 296
           YK+CYYTTPFEK GE AILHSRY+Y AYP YSDNLKNLIR+ML   PS+RPNICQV+EEV
Sbjct: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300

Query: 297 SRLQGIPCPIKNFYLERAIHRSTL 320
           SRLQG+PCP+KNFYLERAI ++ +
Sbjct: 301 SRLQGVPCPLKNFYLERAIRQTAV 324

>TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.284
           YNL020C
          Length = 661

 Score =  518 bits (1334), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 237/315 (75%), Positives = 270/315 (85%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60
           MNQP+IP Y  G  L VG HHA ++ YLTSGG+AQVY A+I P D+   S++ CLKR+IV
Sbjct: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60

Query: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120
           PDK SLNT RAEVDAMKLLRN  HVVSYIDS+AAKS   NG+YEV LLME+CA GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180
           MNTRLQNRLQEFEILNIMSQVTQG+AAMH+L+PPL+HRDIKIENVLIS++G+YK+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180

Query: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240
           VCGVIRPP + QEF +VQHD+LKNTTAQYR+PEMIDL R  PIDEKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300
           YYTTPFEK GE AILHSR+++ A P YSD LK LIR ML   P QRPN+CQVLE+VSR+Q
Sbjct: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300

Query: 301 GIPCPIKNFYLERAI 315
           GI CP++NFYL RA+
Sbjct: 301 GIQCPVRNFYLLRAM 315

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 55/247 (22%), Positives = 98/247 (39%), Gaps = 27/247 (10%)

Query: 461 GRGDISKIVASNPTLFDKTSKSE-VNSTGSLAENIASIASEKIXXXXXXXXXXXXXXXXX 519
           GRG+IS+IV SN T FD+    + V  T    E    +AS+                   
Sbjct: 425 GRGNISQIVESNRTSFDRPRYVDSVTQTSDTEEEPLKVASKSSVSLPARESHAVADKSSV 484

Query: 520 XXXIIVNDGDLTKLEKVQTSKEFEADSPIPVSKAKH---HSLPSNFSSSIKIGNGEGTLT 576
                +     +        K+  A   +P +K +H     +P+   S  +    E  LT
Sbjct: 485 VRSSSLRSKSTSSERPAVAPKQQVA---VPHTKLEHIYAAKIPTGRQSLRQESEIEIPLT 541

Query: 577 TXXXXXXXXXXXXXRMKNLIDNADNIPINKIASDYGKYTKSSDNFGKDSGEEMNDKENIK 636
           +             R+++L+++++++P++K      +  K     G+ S    ++K ++K
Sbjct: 542 SVRSREAKESIQR-RVRDLLNSSEDLPLSK-----SEPKKDEPKRGQLSKTHHDEKPSVK 595

Query: 637 TANSGTRNQXXXXXXXXXXXXXXXAHLRPQKPPKPTFLAGKRKLDKNKSD-----VKTSS 691
             +                     AHLRP+ PPKP FL+GK+ +D   S+     +    
Sbjct: 596 EKSK---------QKVRPRAPPKPAHLRPKPPPKPAFLSGKKMVDTEPSEAGKAVIDAKV 646

Query: 692 ESMEPNL 698
           ES+E +L
Sbjct: 647 ESLERDL 653

>KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {ON}
           Anc_2.284 YNL020C
          Length = 780

 Score =  513 bits (1322), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 233/316 (73%), Positives = 270/316 (85%), Gaps = 1/316 (0%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60
           MN P I T+P G  L VG HHA ++KYLTSGGYAQVY+ +ISP D    S+I CLKR+IV
Sbjct: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60

Query: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120
           PDK SLNT RAEVDAMKLL+N  HVVSYIDS+A+KS ++NGAYEV +LMEFC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180
           MN+RLQ+RL E EIL IMS  +QG+AAMH L+P LLHRDIKIENVLIS + EYK+CDFGS
Sbjct: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180

Query: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240
           VCG++RPP +QQEFNFV HDI+KNTTAQYR+PEM+DLS+ LPI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEK-AGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRL 299
           YYTTPFEK  GEAAIL +R++Y +YP YSD LKNLIR+ML+  PS RPN+CQVLEEVSRL
Sbjct: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300

Query: 300 QGIPCPIKNFYLERAI 315
           QGIPCPI+NFYL RA+
Sbjct: 301 QGIPCPIRNFYLLRAM 316

>SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 791

 Score =  512 bits (1319), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 232/315 (73%), Positives = 269/315 (85%), Gaps = 1/315 (0%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60
           M+QP + TYP G  L VG H A I+KYLTSGG+A +Y A+ISPPD  + S I CLKR++V
Sbjct: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSS-IACLKRVLV 59

Query: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120
           PDK SLN+ RAEVDAMKLL+    VVSYIDS+AAKS L+NG+YEV LLME+CA GGLIDF
Sbjct: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180
           MNTRLQNRL+EFE+L IMSQV+QGVAAMH+L+PPL+HRDIKIENVLIS  G +K+CDFGS
Sbjct: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179

Query: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240
           VCGVIRPP + QE N+VQHDILKNTTAQYR+PEMIDL R LP+DEKSDIWALGVFLYKLC
Sbjct: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300
           YYTTPFEKAGE AILHS++++ AYP YSD LKNLI  +L   P QRPNICQ+L EVSR+Q
Sbjct: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299

Query: 301 GIPCPIKNFYLERAI 315
           G+PCP+KNFYLER +
Sbjct: 300 GVPCPVKNFYLERKM 314

 Score = 32.7 bits (73), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 22/34 (64%), Gaps = 1/34 (2%)

Query: 461 GRGDISKIVASNPTLFDKTSKSEVNSTGSLAENI 494
           GRGDISKI+ SNPT  D+ S S V+S     E I
Sbjct: 441 GRGDISKILKSNPTSVDRLS-SYVDSETQTFETI 473

>ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 704

 Score =  506 bits (1303), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 231/318 (72%), Positives = 267/318 (83%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60
           MN P+IPTY  G  L VG HHA ILKY+ SGG+AQVY A++ P D+ TG++ VCLKR+I+
Sbjct: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60

Query: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120
           P+KA LN  RAEV+AMKLL+   HVV YIDS+AA+S L NG YEV LLMEFC  GGLIDF
Sbjct: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180
           MNTRLQNRL+E+EILNIMSQVTQG+AAMH+L+PPL+HRDIKIENVLIS  GEYK+CDFGS
Sbjct: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180

Query: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240
           V G IRPP + QEF FVQHDILKNTTAQYR+PEMIDL R   IDEKSDIWALG+FLYKLC
Sbjct: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300
           YYTTPFEK G+ AILHSRY++LA+P YSD LKNLI  ML+ QP QRPNICQVLEEVSR+Q
Sbjct: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300

Query: 301 GIPCPIKNFYLERAIHRS 318
           G+  P++NFYL RA+  +
Sbjct: 301 GVSSPMRNFYLLRAMQHT 318

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 10/97 (10%)

Query: 591 RMKNLIDNADNIPINKIASDYGKYTKSSDNFGKDSGEEMNDKENIKTANSGTR------- 643
           ++++L+  A++ P NK  S+      ++ +F ++   +     N++   S TR       
Sbjct: 585 KVQSLLKAAEDSPKNKSTSEIVNIRTTTSSFSENGLRKTT--SNVENGKSTTRSIKTPSS 642

Query: 644 -NQXXXXXXXXXXXXXXXAHLRPQKPPKPTFLAGKRK 679
            N                 HLRP+KPPKP FL+GKRK
Sbjct: 643 VNGKSESKSKPPPPPPKPEHLRPKKPPKPAFLSGKRK 679

>Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W
           (REAL)
          Length = 805

 Score =  506 bits (1304), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 235/317 (74%), Positives = 268/317 (84%), Gaps = 1/317 (0%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60
           MN P I  Y  G  L VG HHA I+KYLTSGG+AQVY A+ISPPD  + ++I CLKR+IV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSSANIACLKRVIV 60

Query: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120
           PDK  LNT RAEVDAMKLL+N  HVVSYIDS+AAKS ++  AYEV +LME+C  GGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGVAYEVFVLMEYCERGGLIDF 119

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180
           MNTRL+NRLQE EIL+IM Q  QG+AAMH+L+PPL+HRDIKIENVLIS+ G YK+CDFGS
Sbjct: 120 MNTRLKNRLQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYKVCDFGS 179

Query: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240
           V GVIRPP + QEFN+VQHDIL NTTAQYR+PEMIDL R LPIDEKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPKNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300
           YYTTPFEK GEAAILH+RY+Y ++P YSD LKNLIRLML   PSQRPNICQVLEEVSRLQ
Sbjct: 240 YYTTPFEKTGEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQ 299

Query: 301 GIPCPIKNFYLERAIHR 317
             PCPI+NFYL RA+++
Sbjct: 300 NRPCPIRNFYLLRAMNQ 316

>YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protein
           serine/threonine kinase; regulates the organization and
           function of the actin cytoskeleton and reduces endocytic
           ability of cell through the phosphorylation of the
           Pan1p-Sla1p-End3p protein complex
          Length = 810

 Score =  506 bits (1302), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 235/317 (74%), Positives = 266/317 (83%), Gaps = 1/317 (0%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60
           MN P I  Y  G  L VG HHA I+KYLTSGG+AQVY A+ISPPD  + ++I CLKR+IV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANIACLKRVIV 60

Query: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120
           P K  LNT RAEVDAMKLLRN  HVVSYIDS+AA+S ++  AYEV +LMEFC  GGLIDF
Sbjct: 61  PHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARS-VNGIAYEVFVLMEFCERGGLIDF 119

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180
           MNTRLQNRLQE EIL IMSQ  QG+ AMH+L+PPL+HRDIKIENVLIS+ G YK+CDFGS
Sbjct: 120 MNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCDFGS 179

Query: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240
           V GVIRPP + QEFN+VQHDIL NTTAQYR+PEMIDL R LPIDEKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300
           YYTTPFEK+GEA ILH+RY+Y ++P YSD LKNLIRLML   PSQRPNICQVLEEVSRLQ
Sbjct: 240 YYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQ 299

Query: 301 GIPCPIKNFYLERAIHR 317
             PCPI+NFYL RA+++
Sbjct: 300 NKPCPIRNFYLLRAMNQ 316

>Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W
           (REAL)
          Length = 808

 Score =  505 bits (1300), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 235/318 (73%), Positives = 268/318 (84%), Gaps = 1/318 (0%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60
           MN P I  Y  G  L VG HHA I+KYLTSGG+AQVY A+ISPPD  T ++I CLKR+IV
Sbjct: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60

Query: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120
           PDK  LNT RAEVDAMKLL+N  HVVSYIDS+AAKS ++  AYEV +LMEFC  GGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGVAYEVFVLMEFCERGGLIDF 119

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180
           MNTRLQNRL+E EIL IMSQ  QG+AAMH+L+PPL+HRDIKIENVLIS++G YK+CDFGS
Sbjct: 120 MNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGS 179

Query: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240
           V GVIRPP + QEFN+VQHDIL NTTAQYR+PEMIDL R LPIDEKSDIWALG+FLYK+C
Sbjct: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKIC 239

Query: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300
           YYTTPFEK+GEA ILH+RY+Y  +P YSD LKNLIRLML   PS+RPNICQVLEEVSRLQ
Sbjct: 240 YYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQ 299

Query: 301 GIPCPIKNFYLERAIHRS 318
             PCPI+NFYL RA+ ++
Sbjct: 300 IKPCPIRNFYLLRAMSQT 317

>NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa]
           {ON} Anc_2.284
          Length = 723

 Score =  498 bits (1282), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 231/322 (71%), Positives = 267/322 (82%), Gaps = 1/322 (0%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60
           MNQP+IPTYP G  L VG H+  I+KYLTSGG+AQ+Y  +ISP +    S   CLKR+IV
Sbjct: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60

Query: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120
           PDKA LNT RAEVDAMKLL+N  HVVSYIDS+AA+S +  GAYEV LLME+C  GGLIDF
Sbjct: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180
           MNTRLQNRL E EILNI+SQ  QGV+AMH+L+P L+HRDIKIENVLIS  GE+K+CDFGS
Sbjct: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180

Query: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240
           VC  IRPP + QE  +VQHD+LKNTTAQYRAPEM+DL R LPI+EKSDIWALGVFLYKLC
Sbjct: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300
           YYTTPFEK GEAAILHSRY+Y A+P Y+D LKNLIR  L   PS+RPNICQ+LEE+SR+Q
Sbjct: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300

Query: 301 GIPCPIKNFYLERAIH-RSTLM 321
           GIPCPI NFYL R I+ +++LM
Sbjct: 301 GIPCPINNFYLSRTINVQASLM 322

 Score = 38.5 bits (88), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 57/128 (44%), Gaps = 14/128 (10%)

Query: 591 RMKNLIDNADNIPIN-KIASDYGKYTKSS--DNFGKDSGEEMNDKENIKTANSGTRNQXX 647
           R+K L++  +  P   K AS YGKYT S    +   + G  +    N K  +S   N   
Sbjct: 601 RVKALLETFEEEPSTIKTASGYGKYTDSEFITSPVPERGGRIPTPTN-KRYSSVIINPVT 659

Query: 648 XXXXXXXXXXXXXAHLRPQKPPKPTFLAGKRKLDKNKSDVKTSSESMEP----NLETLTE 703
                         HLRP  PPKPT      +L K   D + SS + E     ++E+L +
Sbjct: 660 EPISIRPSPPPKPKHLRPIPPPKPT------RLSKIYPDERISSTATERIVNLDVESLEK 713

Query: 704 EFNKRFPN 711
           +F +RFP+
Sbjct: 714 DFKRRFPS 721

>NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {ON}
           Anc_2.284
          Length = 756

 Score =  499 bits (1284), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 227/314 (72%), Positives = 266/314 (84%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60
           MNQP+IP YP G  L VG H A I KYLTSGG+AQ+Y  +I+P D+ + S++ CLKR+IV
Sbjct: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60

Query: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120
           P K+ LNT RAEVDAMKLL+N  HVVSYIDSNA KS  +NG+YEVLLLME+C  GGLIDF
Sbjct: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180
           MN+RLQNRL E EILNI+SQ  QGVA MH+L+P LLHRDIKIENVL S +GE+KLCDFGS
Sbjct: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180

Query: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240
           VCG IRPP +QQE ++VQHDILKNTTAQYR PEM+DL R LPIDEKSDIWALGVFLYKLC
Sbjct: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300
           YYTTPFEK GE AILHS+++Y A+P YSD LKNLIR+ML+  P++RPNIC++LEE+S +Q
Sbjct: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300

Query: 301 GIPCPIKNFYLERA 314
           G+PCPI+NFYL RA
Sbjct: 301 GVPCPIQNFYLIRA 314

 Score = 40.0 bits (92), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 662 HLRPQKPPKPTFLAGKRKLDKNKSDVKTSSESMEPNLETLTEEFNKRFPN 711
           HLRP+ PPKPT+L+  +   K +     + + +  +++TL  +F KRFP+
Sbjct: 704 HLRPKPPPKPTYLS--KMFSKERISSTATEQLVTLDVDTLERDFRKRFPS 751

>Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W
           (REAL)
          Length = 809

 Score =  499 bits (1284), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 233/315 (73%), Positives = 263/315 (83%), Gaps = 1/315 (0%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60
           MN P I  Y  G  L VG HHA I+KYLTSGG+AQVY A+ISPPD  + ++  CLKR+IV
Sbjct: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60

Query: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120
           PDK  LNT RAEVDAMKLL+N  HVVSYIDS+AAKS ++  AYEV +LMEFC  GGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGIAYEVFVLMEFCERGGLIDF 119

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180
           MNTRLQ+RL+E EIL IMSQ  QG+AAMH L+PPL+HRDIKIENVLIS+ G YK+CDFGS
Sbjct: 120 MNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGS 179

Query: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240
           V GVIRPP + QEFN+VQHDIL NTTAQYR+PEMIDL R+ PIDEKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300
           YYTTPFEK+GEAAILHSRY+Y ++P YSD LK LI LML   PSQRPNICQVLEEVSRLQ
Sbjct: 240 YYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQ 299

Query: 301 GIPCPIKNFYLERAI 315
             PCPI+NFYL RA+
Sbjct: 300 NEPCPIRNFYLLRAM 314

>TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON}
           Anc_2.284 YNL020C
          Length = 717

 Score =  493 bits (1269), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 220/321 (68%), Positives = 264/321 (82%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60
           MNQP I  Y  G  L VG+H  +I+KYLTSGG+AQ+YQ +++PP+   G ++ CLKR+IV
Sbjct: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60

Query: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120
           P+K+ LNT RAEV+AM+LL+   HVV YIDSNAA+S  ++G YEVL LMEFC  GGLIDF
Sbjct: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180
           MNTRLQNRL+EFE+LNIM+QVTQG+ AMHSL PPL+HRDIKIENVLIS++GEYK+CDFGS
Sbjct: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180

Query: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240
           V G+IRPP + +EFNFVQ DI+KNTTAQYR PEM+DL R  PI+EKSDIWALGVFLYK+C
Sbjct: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300
           YYTTPFE  GE AILH+RY+Y  YP YS  LKNLIR+ML  +P QRPN+CQVLEEVS +Q
Sbjct: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300

Query: 301 GIPCPIKNFYLERAIHRSTLM 321
           GIPCP+ NFYL+R      +M
Sbjct: 301 GIPCPLPNFYLQRQQATQLMM 321

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 662 HLRPQKPPKPTFLAGKR--KLDKNKSDVKTSSESMEPNLETLTEEFNKRFPNI 712
           +LRP+KPPKP  L G +  K +  + ++K   E+ +  L+ +  +F++R+P++
Sbjct: 665 YLRPKKPPKPANLQGMKFMKSENVEQEIKERKENSKKQLQKMEVDFSQRYPSV 717

>NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284
          Length = 621

 Score =  489 bits (1260), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 226/315 (71%), Positives = 265/315 (84%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60
           MNQP +  Y  G  L VG H A I+KYLTSGG+AQVY A+ISP D    S IVCLKR+IV
Sbjct: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60

Query: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120
           PDK SLNT RAEVDAMKLLRN  HVVSYIDS+AAK   + G+YEV LLME+C  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180
           MNTRLQNRL E EIL+IMSQV+QGVAAMH+L+PPLLHRDIKIENVL+++ G YKLCDFGS
Sbjct: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180

Query: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240
           VCG+IRPPT+ QEF +VQHDI+KNTTAQYR+PEMI+L + LPI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300
           YYTTPFEK GE AILH+ +++  +PHYSD +K+LIR+ L  QPSQRPNI Q+LEEVS++Q
Sbjct: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300

Query: 301 GIPCPIKNFYLERAI 315
            +PCPI +FYL+R +
Sbjct: 301 NVPCPIPDFYLQRKL 315

>KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p- Sla1p-End3p
           protein complex
          Length = 790

 Score =  495 bits (1275), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 225/315 (71%), Positives = 264/315 (83%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60
           MNQ     Y  G  L VG H A I+KYLTSGG+A +Y A+I P D  + + I CLKR++V
Sbjct: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60

Query: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120
           PDK SLN  RAEVDAMKLLR   HVVSYIDS+AAKSG+H+G+YEV LLME+C+ GGLIDF
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180
           MNTRLQNRLQE E+L I S +TQG+AAMH+L+PPL+HRDIKIENVLIS+   +K+CDFGS
Sbjct: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180

Query: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240
           VCGVIRPP + QEFN+VQHDILKNTTAQYRAPEMIDL R  PI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300
           YYTTPFEK GEAAILHSR+++ +YP YSD+LK+LI  ML+  P+QRPNICQVLEEVSR+Q
Sbjct: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300

Query: 301 GIPCPIKNFYLERAI 315
           G PCP++NFY+ RA+
Sbjct: 301 GTPCPLRNFYVTRAM 315

>NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score =  491 bits (1263), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 225/311 (72%), Positives = 257/311 (82%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60
           MNQP IP Y  G  L VG H   ++KYLTSGG+AQ+Y  +ISPPD  T +++ CLKR+IV
Sbjct: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60

Query: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120
           PDK SLNT RAEVD MKLLRN  HVVSYIDS+AAK   + G+YEV LLME+C  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180
           MNTRLQ RL+E EILNIMSQVTQG+AAMH+L PPLLHRDIKIENVL+++ GEYK+CDFGS
Sbjct: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180

Query: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240
           VCG+IRPP++ QE ++VQHDI+KNTTAQYRAPEMIDL R LPIDEKSDIWALGVFLYKLC
Sbjct: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300
           YYTTPFEK GEAAILH+ +++  YP YSD LK LI  ML  QPSQRPN  QVLEEVS +Q
Sbjct: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300

Query: 301 GIPCPIKNFYL 311
            + CPI NFYL
Sbjct: 301 NVQCPIPNFYL 311

>Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {ON}
           YIL095W (PRK1) - probable serine/threonine-protein
           kinase [contig 27] FULL
          Length = 791

 Score =  494 bits (1271), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 223/315 (70%), Positives = 265/315 (84%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60
           MNQP    Y QG +L VG H A I+KYLTSGG+A +Y A+ISP D  +  ++ CLKR++V
Sbjct: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60

Query: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120
           PDK SLN  RAEVDAMKLLR   HVVSYIDS+AAKSG  +G+YEV LLME+C+ GGLIDF
Sbjct: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180
           MNTRLQNRL E E+L IMS +TQG+AAMH+L PPL+HRDIKIENVLIS+   +K+CDFGS
Sbjct: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180

Query: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240
           VCGVIRPP + QEF++VQ+DILKNTTAQYR+PEMIDL R  PI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300
           YYTTPFEK G+AAILHSR+++ AYP YSD LKNLI +ML+  P+QRPNICQVLEEVSR+Q
Sbjct: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300

Query: 301 GIPCPIKNFYLERAI 315
            +PCP++NFYL R++
Sbjct: 301 NVPCPLRNFYLLRSM 315

 Score = 38.9 bits (89), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 30/138 (21%), Positives = 54/138 (39%), Gaps = 20/138 (14%)

Query: 591 RMKNLIDNADNIPINKIASDYGKYTKSSDNFGKDSGEEMNDKENIKTANSGTRN------ 644
           R++NL+ ++ + P+ K A  YG+ ++  D   K+S E+   K  +  A    R       
Sbjct: 655 RVQNLLKSSQDSPVKKSAHGYGEVSEKED---KESPEQFTGKPAVAEARPIKRTVVPPPK 711

Query: 645 -----------QXXXXXXXXXXXXXXXAHLRPQKPPKPTFLAGKRKLDKNKSDVKTSSES 693
                                       H +P++P KP  L   R +    S  +    S
Sbjct: 712 RYSSVEFSSIVPTAKNTTAKDIEQPIRVHHKPKRPTKPPHLKADRIIKHGSSTTENPRHS 771

Query: 694 MEPNLETLTEEFNKRFPN 711
            +  +E L ++F +RFP+
Sbjct: 772 SDLEIEELEKDFQRRFPS 789

>KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {ON}
           Anc_2.284 YNL020C
          Length = 369

 Score =  470 bits (1210), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 222/312 (71%), Positives = 256/312 (82%), Gaps = 1/312 (0%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60
           MNQP I TY  G  L VG H   I+KY+TSGG+AQ+Y  +ISPPDS   S+I CLKR+IV
Sbjct: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60

Query: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120
           PDK SLNT RAEVDAMKLLRN  HVVSYIDS+A+KS  +NG+YEV LLME+C  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180
           MNTRLQNRL E E+L+I SQV QG+AAMH+L+PPLLHRDIKIENVLIS S +YK+CDFGS
Sbjct: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180

Query: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240
           V G+IRPP + QE  +VQHD+LKNTTAQYR+PEMID  R LPIDEKSDIWA+GVFLYKLC
Sbjct: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240

Query: 241 YYTTPFEK-AGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRL 299
           YYTTPFEK  GEAAIL +RYEY  +P YS+ LK+LI  ML   P QRPNI QV+EE+S++
Sbjct: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300

Query: 300 QGIPCPIKNFYL 311
           Q +PCPI NFYL
Sbjct: 301 QNVPCPIVNFYL 312

>KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 777

 Score =  484 bits (1247), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 223/317 (70%), Positives = 260/317 (82%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60
           MNQP I  Y  G  L VG H   +LKYL SGG+A VY  +ISPPD     ++ CLKR++V
Sbjct: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60

Query: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120
           PDKASLNT RAEVD+MK LR    +VSYIDS+A KS ++ G YEV LLME+C+ GGLIDF
Sbjct: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180
           MNTRLQNRLQEFEILNIMSQV+QGVAAMH+L+PPL+HRDIKIENVL+S + E+KLCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180

Query: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240
           V GVIR P + +EFN+VQ+DI+KNTTAQYR PEMIDL R LPIDEKSDIWALGVFLYK C
Sbjct: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240

Query: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300
           YYTTPFEK GE+AIL S++E+ AYP YSD +KNLI +ML   P +RPNICQV+EEVSR+Q
Sbjct: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300

Query: 301 GIPCPIKNFYLERAIHR 317
           GIPCPIKNFYL R + +
Sbjct: 301 GIPCPIKNFYLLRMMDK 317

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 59/127 (46%), Gaps = 11/127 (8%)

Query: 591 RMKNLIDNADNIPINKIASDYGKYTKSSDNFGKDSGEEMNDKENIKTANSGTRNQXXXXX 650
           R+K+LI NAD+IP    A+ YGKYT    + G+ +    + K N    +S          
Sbjct: 654 RVKDLI-NADDIPNRSSATGYGKYT----DIGRKTDISDHHKSNANRKSSTVITPVHEAP 708

Query: 651 XXXXXXXXXXAHLRPQKPPKPTFLAGKR-KLDKNKSDVK---TSSESMEPNLETLTE--E 704
                     AHL+P  PPKP  L  K  +    KS+VK   +  +S+    ++  E  E
Sbjct: 709 KSKPAPPPKPAHLKPNLPPKPKHLKAKSFRTSPAKSEVKEQDSDQDSVGSPFQSRKEMKE 768

Query: 705 FNKRFPN 711
           F +RFP+
Sbjct: 769 FERRFPS 775

>Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {ON}
           YNL020C (REAL)
          Length = 639

 Score =  474 bits (1221), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 218/314 (69%), Positives = 256/314 (81%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60
           MNQP I TY  G  L VG H   I+KYLTSGG+AQVY A ISPPD  + S+I CLKR+IV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALISPPDPHSHSNIACLKRVIV 60

Query: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120
           PDK SLNT RAEVDAM+LLRN  +VVSYIDS+AAK+ LHNG+YEV +LME+C  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLRNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180
           MNTRLQNRL EFEIL IMSQVTQGVAAMH+L+PPL+HRDIKIENVLIS + EYKLCDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240
           VCGVIRPP + QE ++VQ DI KNTTAQYR+PEM+D+ R LPIDEKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300
           YYTTPFEK GE AIL   +E+  YP YS+ L++LIR +L   P QRPN+ Q+L+ +S +Q
Sbjct: 241 YYTTPFEKGGEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVYQLLKRISIMQ 300

Query: 301 GIPCPIKNFYLERA 314
            +PCPI +  + +A
Sbjct: 301 NVPCPISDIQVPQA 314

>Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {ON}
           YNL020C (REAL)
          Length = 632

 Score =  471 bits (1211), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 215/308 (69%), Positives = 255/308 (82%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60
           MNQP I TY  G  L VG H   I+KYLTSGG+AQVY A ISPPD  T S++ CLKR+IV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60

Query: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120
           PDK SLNT RAEVDAMKLLRN  +VVSYIDS+AAK+ LHNG+YEV +LME+C  GGLIDF
Sbjct: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180
           MNTRLQNRL E EIL IM QVTQGVAAMH+L+PPL+HRDIKIENVLIS   EYKLCDFGS
Sbjct: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180

Query: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240
           VCGVIRPP + QE ++V+ D+LKNTTAQYR+PEM+D+ R LPIDEKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300
           YYTTPFEK GE AIL+ ++E+L YP+YS+ L+NLI  +L   PSQRPN+ Q+L++++ +Q
Sbjct: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300

Query: 301 GIPCPIKN 308
             P PI++
Sbjct: 301 NAPYPIRD 308

>YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON}
           ARK1Serine/threonine protein kinase involved in
           regulation of the cortical actin cytoskeleton; involved
           in control of endocytosis
          Length = 638

 Score =  470 bits (1210), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 215/314 (68%), Positives = 255/314 (81%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60
           MNQP I TY  G  L VG H   I+KYLTSGG+AQVY A I+PPD  + S + CLKR+IV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60

Query: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120
           PDK SLNT RAEVDAM+LL+N  +VVSYIDS+AAK+ LHNG+YEV +LME+C  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180
           MNTRLQNRL EFEIL IMSQVTQGVAAMH+L+PPL+HRDIKIENVLIS + EYKLCDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240
           VCG+IRPP + QE ++VQ DILKNTTAQYR+PEMID  R LPIDEKSDIWALG+FLYKLC
Sbjct: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300
           YYTTPFEK G+ AIL  ++E+  YP+YS+ LK LIR +L   P  RPN+ Q+L+ +S +Q
Sbjct: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300

Query: 301 GIPCPIKNFYLERA 314
            +PCPI +  + +A
Sbjct: 301 NVPCPINDIQVVQA 314

>CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095w PRK1
          Length = 688

 Score =  469 bits (1206), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 218/320 (68%), Positives = 255/320 (79%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60
           MNQP++     G  L VG H   ILKYLTSGG+AQ+Y  +I       GS++ CLKR+ V
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60

Query: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120
           PDK SLN  RAEVDAMKLL N  HVVSYIDS+A +S  ++G YEV LLME+C  GGLIDF
Sbjct: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180
           MNTRLQNRL E EIL+IMSQ TQG+A MH+L PPLLHRDIKIENVL+S  G YK+CDFGS
Sbjct: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180

Query: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240
           V GVIRPP +QQE  +VQHDI+KNTTAQYR PEM+DL R LPIDEK+DIWALGVFLYKLC
Sbjct: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240

Query: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300
           YYTTPFEK GE AILH+R+++ ++P+YSD LKNLI+ ML   PS RPN+CQVLEEVSR+Q
Sbjct: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300

Query: 301 GIPCPIKNFYLERAIHRSTL 320
            +PCPI+NFYL RA+ +  L
Sbjct: 301 NVPCPIRNFYLLRAMEKVKL 320

>ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL095W (PRK1) and
           YNL020C (ARK1)
          Length = 750

 Score =  469 bits (1207), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 214/316 (67%), Positives = 252/316 (79%), Gaps = 1/316 (0%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60
           MNQ        GI L VG H   I++YLTSGG+AQ+Y  ++  P    GS + CLKR+ V
Sbjct: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGS-LACLKRVHV 59

Query: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120
           PDK SLNT RAEVDAMK+L+   HVVSYIDS+AAKS  H+G YEV LLME+C  GGLIDF
Sbjct: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180
           MN+RLQ RL EFE+L IMS V QG+ AMH+L PPL+HRDIKIENVLIS  G++K+CDFGS
Sbjct: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179

Query: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240
           V GVIRPP +  EFN+VQHDILKNTTAQYRAPEMIDL R LP+DEKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239

Query: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300
           Y+TTPFEK GE AIL +++++ +YP Y+D LKNLI +ML+  P QRPNICQVLEEVSR+Q
Sbjct: 240 YFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQ 299

Query: 301 GIPCPIKNFYLERAIH 316
           G+PCP+ NFYLER  H
Sbjct: 300 GVPCPLPNFYLERMKH 315

>KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {ON}
           Anc_2.284 YNL020C
          Length = 592

 Score =  462 bits (1189), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 212/312 (67%), Positives = 258/312 (82%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60
           MNQP+I TYPQG +L VG H   I+KYLT+GG+AQ+YQ  ISP D  +G++I CLKR+IV
Sbjct: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60

Query: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120
           PDK SLN  RAEVDAMKLLRN   VVSYIDS+AAKS   NG YEV LLME+C  GGLI+F
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180
           +N+RLQNRL+E E++NIM  V+QGVAAMH+L+PPL+HRDIKIENVL+S + E+KLCDFGS
Sbjct: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180

Query: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240
           V G IRPP++ QE   VQ+DI++NTTAQYR+PEMID+SR  PIDEKSDIWALGVFLYK+C
Sbjct: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300
           YYTTPFEK+GEA IL SRYE+ A+P YSD L++LI  +LA QP+ RPNI  V++E+S ++
Sbjct: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300

Query: 301 GIPCPIKNFYLE 312
            I CPI NFYL+
Sbjct: 301 NISCPIINFYLK 312

>Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {ON}
           YNL020C (REAL)
          Length = 637

 Score =  462 bits (1190), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 211/309 (68%), Positives = 252/309 (81%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60
           MNQP I TY  G  L VG H   I+KYLTSGG+AQVY   ISPPD  T +++ CLKR+IV
Sbjct: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60

Query: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120
           PDK SLNT RAEVDAM+LL+N  +VVSYIDS+AAK+ L NG+YEV +LME+C  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180
           MNTRLQNRL EFEIL I+SQVTQGVAAMH+L+PPL+HRDIKIENVLIS + EYKLCDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180

Query: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240
           VCG+IR P + QE ++VQ DILKNTTAQYR+PEMID+ R LPIDEKSDIWALG+FLYKLC
Sbjct: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300
           YYTTPFEK GE AIL  ++E+  YP+YS+ LK+LIR +L   P  RP++ Q+L+ +S +Q
Sbjct: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300

Query: 301 GIPCPIKNF 309
            +PCPI + 
Sbjct: 301 NVPCPINDI 309

>Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii ADL217W
          Length = 748

 Score =  464 bits (1193), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 211/317 (66%), Positives = 258/317 (81%), Gaps = 1/317 (0%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60
           MNQ    ++  G  L VG H   ++KYLTSGG+AQ+Y  ++  PDS+   D+ CLKR+ V
Sbjct: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKV-KDVACLKRVHV 59

Query: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120
           PDK SLNT RAEVDAMKLLR   H+VSYIDS+A+KS L+NG+YEV+LLME+C+ GGLI F
Sbjct: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180
           MNTRLQ+RL+EFE+L IM+QV QG+ AMH+L+PPL+HRDIKIENVLI+ +G+ K+CDFGS
Sbjct: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179

Query: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240
           VCGVIRPP +  E ++VQHDILKNTTAQYRAPEMIDL R   +DEKSDIWALGVFLYKLC
Sbjct: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300
           YYTTPFEK GE AIL + +++ +YP YS+ LKNLI +MLA  P  RPN CQVLEEV R+Q
Sbjct: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299

Query: 301 GIPCPIKNFYLERAIHR 317
           G PCP+KNFYLER++ +
Sbjct: 300 GQPCPVKNFYLERSLKQ 316

>Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa]
           {ON} complement(102096..104201) [2106 nt, 702 aa]
          Length = 701

 Score =  458 bits (1178), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 208/321 (64%), Positives = 261/321 (81%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60
           MNQ  +P Y     + VG H A I+KYL SGGYAQVY A ++P D    ++I CLKR++V
Sbjct: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60

Query: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120
           PDK SLN  RAEVDA+K+LRN  +VVSYIDS+A+K   H G+YEV +LME+C+ G LIDF
Sbjct: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180
           +NTRL+NRL+E EIL+IM+QV  GVA MH L+P L+HRDIKIEN+LIS +GEYK+CDFGS
Sbjct: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180

Query: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240
           VCGVIRPP S +E  ++QHDI+KNTTAQYR+PEM+DL++   I+EKSDIWALGVFL+KLC
Sbjct: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240

Query: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300
           YYTTPFEK GE AIL S+++Y AYP YSD+LKN+IR++L+  P +RPNICQ++EE+SRLQ
Sbjct: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300

Query: 301 GIPCPIKNFYLERAIHRSTLM 321
           GI  P+KNFYL RA+  S+LM
Sbjct: 301 GIVPPMKNFYLSRALETSSLM 321

>KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {ON}
           Anc_2.284 YNL020C
          Length = 788

 Score =  431 bits (1109), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 204/328 (62%), Positives = 252/328 (76%), Gaps = 10/328 (3%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60
           MNQP IP YP G  ++VG H A ILKYLTSGG+AQ+Y  +ISP D  T S+I CLKR+IV
Sbjct: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60

Query: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120
           P+K+ LN  R EVDAMKLL+N  HVVSYIDSNAAKS   NG+YEV LLME+C  G L+DF
Sbjct: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180
           MNT+L+ RLQE E+LNIM+QV QG+AAMH L PPL+HRDIKIENVLIS  G +K+CDFGS
Sbjct: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180

Query: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYK-- 238
           VCG+IRPP + QE  +VQHD++KNTTAQYR+PEMIDL +  PI+ K  I  LG +     
Sbjct: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERK--IRHLGSWCVALQ 238

Query: 239 --LCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEV 296
             L +YT  F +  E AIL+ RY+Y AYP YSD LKN++R++L+  P +RPNICQ+LEE+
Sbjct: 239 IMLLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296

Query: 297 SRLQGIPCPIKNFYLERAIHRS--TLMP 322
           S++Q IPCPI NFYLER+ H+   ++MP
Sbjct: 297 SKIQNIPCPIDNFYLERSRHQGAVSVMP 324

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 20/26 (76%)

Query: 591 RMKNLIDNADNIPINKIASDYGKYTK 616
           R+ NL+ NA++ P+ K A+ YGKYTK
Sbjct: 641 RVLNLLKNAEDSPVKKTAAGYGKYTK 666

>TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON}
           Anc_2.284 YNL020C
          Length = 1443

 Score =  447 bits (1151), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 202/317 (63%), Positives = 248/317 (78%), Gaps = 6/317 (1%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSD----IVCLK 56
           MNQP+IP Y +G  L +G H   I KYL  GG+AQVY  ++   DS    +    + CLK
Sbjct: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVI--DSSNARNELGTMACLK 58

Query: 57  RLIVPDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGG 116
           R+IVPDK+ LNT RAEVDAMKLL+   ++VSYIDS+A +S L  G YEV LLME+C+ GG
Sbjct: 59  RVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGG 118

Query: 117 LIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLC 176
           +IDF+NTRL +RLQEFEIL IMS V QGVAAMH L+PPL+HRDIKIENVLIS +G+YK+C
Sbjct: 119 VIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKIC 178

Query: 177 DFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFL 236
           DFGS C V+RPP + QE  F+ HDI+ NTTAQYR+PEMID     PIDEKSDIWALGVFL
Sbjct: 179 DFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFL 238

Query: 237 YKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEV 296
           YKLCYYTTPFEK GE AIL+ ++++ +YP YSD+++N+I +ML   P +RPNICQVLE+V
Sbjct: 239 YKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 298

Query: 297 SRLQGIPCPIKNFYLER 313
           S+LQG+PCPI+NF L R
Sbjct: 299 SKLQGVPCPIENFMLTR 315

>CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} similar
           to uniprot|P53974 Saccharomyces cerevisiae YNL020c ARK1
           or uniprot|P40494 Saccharomyces cerevisiae YIL095w PRK1
          Length = 622

 Score =  423 bits (1088), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 194/311 (62%), Positives = 241/311 (77%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60
           MN P IP Y  G ++ VG H   ILKYLTSGGYAQ+Y A+I P D   G+++  LKR+IV
Sbjct: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60

Query: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120
           PDK+ LNT RAEVDAMK L++  ++VSYIDS+AAKS   +G YEV L+ME+C+ GGLIDF
Sbjct: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180
           MNTRLQNRL E EIL I   ++QGVAAMH+L+PPL+HRDIKIENVLISN  +YKLCDFGS
Sbjct: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180

Query: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240
           V G IRPP + +E  +V+HDI+ +TTAQYRAPEM+DL++   +++KSDIWALGVFLYKLC
Sbjct: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300
           YYTTPFE+ GEA IL+   E+  YPHYSD +K LI  MLA  P  RPNI Q+++ VS+L 
Sbjct: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300

Query: 301 GIPCPIKNFYL 311
            + CPI N ++
Sbjct: 301 NVNCPIPNIHV 311

>TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {ON}
           Anc_2.284 YNL020C
          Length = 707

 Score =  401 bits (1031), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 183/307 (59%), Positives = 236/307 (76%)

Query: 9   YPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNT 68
           Y +G  LQV  H   I  YLTSGG+AQVY A+I+        ++ CLKR+IVP+K SLN 
Sbjct: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNI 68

Query: 69  PRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNR 128
            RAEVDAMK+L+N  ++VSYIDS+A +      +Y VLLLME+C+  GL+DFMN RL+ R
Sbjct: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNLRLKER 128

Query: 129 LQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPP 188
           L+E EIL IM+ V+QGV  MH L+PPLLHRDIKIENVL+S  G +KLCDFGSV GV+R P
Sbjct: 129 LKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP 188

Query: 189 TSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEK 248
           TS +EF ++Q+DILKNTTAQYR+PEM++L+   PI+EKSDIWALG+ LYKLCYYTTPFE+
Sbjct: 189 TSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE 248

Query: 249 AGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQGIPCPIKN 308
            G  AI+  ++ Y AYP Y+D+LKN+IR++L+  P QRPNICQ+LEE+ R+Q    P+ N
Sbjct: 249 HGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPLPN 308

Query: 309 FYLERAI 315
           FY++RA+
Sbjct: 309 FYVQRAM 315

>KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa]
           {ON} Anc_3.273 YBR059C
          Length = 1091

 Score =  310 bits (795), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 160/323 (49%), Positives = 213/323 (65%), Gaps = 22/323 (6%)

Query: 6   IPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISP----------------PDSRTG 49
           I  +  G S+ VG H   I+KYLT GG+AQ+Y  K++                  + + G
Sbjct: 26  IEKFSAGESVAVGSHGVEIVKYLTEGGFAQIYLVKLTEYLNEFDAIDIQNQRQQQELKIG 85

Query: 50  SDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLM 109
            D+VCLKR++V D+A L+  + EV+ MK LR   +VV Y DSNA ++   NG +EV LLM
Sbjct: 86  -DLVCLKRVMVYDEAGLSEMKNEVNVMKQLRGKPNVVQYYDSNATRNRGANGGFEVFLLM 144

Query: 110 EFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISN 169
           E+C    L+D+MN RL  +L E EILNIM  +T GV+ +H L+ PL+HRDIKIENVL+ +
Sbjct: 145 EYCPNKSLLDYMNQRLTTKLTESEILNIMYDITLGVSQLHFLDNPLIHRDIKIENVLVDH 204

Query: 170 SGEYKLCDFGSVCGVIRPP--TSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKS 227
           +  +KLCDFGS    I PP  T+ Q+ + + HDI  +TT QYR+PEMIDL R LP++EK+
Sbjct: 205 NNRFKLCDFGSTN--ICPPIATTNQDISVLTHDIYVHTTPQYRSPEMIDLFRCLPVNEKA 262

Query: 228 DIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRP 287
           DIWALGVFLYKL +YTTPFE  G+ AILHS+YE +   HYS+ L NLI +MLA  P+ RP
Sbjct: 263 DIWALGVFLYKLLFYTTPFELTGQFAILHSKYE-IPQSHYSERLLNLIVVMLAENPNLRP 321

Query: 288 NICQVLEEVSRLQGIPCPIKNFY 310
           NI QVL E+  +  +  PI + Y
Sbjct: 322 NIYQVLSEICSILNVEVPIPDIY 344

>KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {ON}
           Anc_3.273 YBR059C
          Length = 912

 Score =  303 bits (777), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 159/320 (49%), Positives = 201/320 (62%), Gaps = 22/320 (6%)

Query: 12  GISLQVGVHHATILKYLTSGGYAQVYQAKI--------SPPDSRTGSDI----------- 52
           G  + VG H   I+KYL  GG+AQ+Y            + PDS   S+I           
Sbjct: 22  GAVVAVGRHKVEIIKYLAEGGFAQIYSVNFIEYLNEFSNEPDSTEDSNIDEFQQFKLEPG 81

Query: 53  --VCLKRLIVPDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLME 110
              CLKR++VPD+  LN  R EV+ M+ L+   ++V Y DSNA++    N  +EVLLLME
Sbjct: 82  NLACLKRVMVPDENGLNELRNEVNVMRKLKGTPNIVQYYDSNASRRHDGNPGFEVLLLME 141

Query: 111 FCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNS 170
            C    L+D+MN RL  +L E EIL IM  VT G++ MH L+ PL+HRDIKIENVL+ +S
Sbjct: 142 LCPNNSLLDYMNQRLTTKLSEKEILKIMYDVTLGISQMHYLQKPLIHRDIKIENVLVDSS 201

Query: 171 GEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIW 230
             +KLCDFGS        TS QE   +  +I  +TT QYR+PEMIDL R+LPIDEKSDIW
Sbjct: 202 NNFKLCDFGSTSACFPIVTSHQEIAVLTQNIYVHTTPQYRSPEMIDLYRNLPIDEKSDIW 261

Query: 231 ALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNIC 290
           ALGVFLYKL +YTTPFE  G+ AILHS+YE +   +YS  L NLI +MLA  P+ RPNI 
Sbjct: 262 ALGVFLYKLLFYTTPFEMTGQFAILHSKYE-IPPNNYSSRLINLIIIMLAENPNLRPNIY 320

Query: 291 QVLEEVSRLQGIPCPIKNFY 310
           QV+ +V    GI  PIK+ Y
Sbjct: 321 QVMHQVCITIGIEPPIKDKY 340

>CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P38080 Saccharomyces cerevisiae
           YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 1027

 Score =  303 bits (777), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 151/320 (47%), Positives = 202/320 (63%), Gaps = 11/320 (3%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAK----------ISPPDSRTGS 50
           +N P+   YP G  + VG H   I+ YL  GG+AQ+Y  K          +    + T  
Sbjct: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71

Query: 51  DIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLME 110
           DI CLKR+IV D+  LN  R EV+ MK L++  ++V Y DSNA++       +EVLLLME
Sbjct: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131

Query: 111 FCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNS 170
            C    L+D+MN RL+ +L E EIL IM  V+ G++ MH L+ PL+HRDIKIENVL+  +
Sbjct: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191

Query: 171 GEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIW 230
             +KLCD GS      P  S Q+   +  +I  +TT QYRAPEMIDL R+LPI+EKSDIW
Sbjct: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251

Query: 231 ALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNIC 290
           ALG+FLYKL +YTTPFE  G+ AILHS+Y++     YS  + NLI +MLA  P+ RPNI 
Sbjct: 252 ALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPN-KYSSKIINLIIIMLAENPNLRPNIF 310

Query: 291 QVLEEVSRLQGIPCPIKNFY 310
           QV+  +  +  +P PI++ Y
Sbjct: 311 QVVYHICSIMNLPVPIEDRY 330

>SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 858

 Score =  299 bits (765), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 152/307 (49%), Positives = 197/307 (64%), Gaps = 9/307 (2%)

Query: 12  GISLQVGVHHATILKYLTSGGYAQVYQAKI--------SPPDSRTGSDIVCLKRLIVPDK 63
           G  + VG H   I+KYL  GG+A +Y  K         +P  S    D+ CLKR++V D+
Sbjct: 35  GTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDE 94

Query: 64  ASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNT 123
             LN  R EV+ MK L+N D++V Y DSNA++    +  YEVLLLME C    L+D+MN 
Sbjct: 95  NGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQ 154

Query: 124 RLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCG 183
           RL  +L E E+L IM  VT+ VA MH L  PL+HRDIKIENVL+ +   +KLCDFGS   
Sbjct: 155 RLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSS 214

Query: 184 VIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYT 243
                T+ Q+   + ++I  +TT QYRAPEMIDL R LPIDEKSDIWALG+FLYKL +YT
Sbjct: 215 CFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYT 274

Query: 244 TPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQGIP 303
           TPFE  G+ AILHS+Y+  A  +YS  L NLI +MLA  P+ RPNI QV+ +V  +  + 
Sbjct: 275 TPFELTGQFAILHSKYDIPAN-NYSSKLINLIIIMLAENPNLRPNIYQVIYQVCAIMKVD 333

Query: 304 CPIKNFY 310
            P ++ Y
Sbjct: 334 VPFEDKY 340

>NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]
           {ON} Anc_3.273
          Length = 1095

 Score =  298 bits (763), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 156/323 (48%), Positives = 201/323 (62%), Gaps = 17/323 (5%)

Query: 3   QPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKI-----------SPPDSRTGSD 51
           +P+   Y  G  + VG H   I+KY+  GG+AQ+Y  K              P  + G D
Sbjct: 16  KPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMG-D 74

Query: 52  IVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNG--AYEVLLLM 109
           + CLKR++V D+  LN  R EV+ MK L+   ++V Y DSNA++   HNG   +EVLLLM
Sbjct: 75  VACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRR--HNGFPGFEVLLLM 132

Query: 110 EFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISN 169
           E C    L+D+MN RL  +L E EIL IM  VT  V+ MH L  PLLHRDIKIENVL+  
Sbjct: 133 ELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDA 192

Query: 170 SGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDI 229
              +KLCDFGS        T+ Q+   +  +I  +TT QYR+PEMIDL R LPIDEKSDI
Sbjct: 193 QNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDI 252

Query: 230 WALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNI 289
           WALG+FLYKL ++TTPFE  G+ AILHS+YE+    +YS  L NLI +MLA  P+ RPNI
Sbjct: 253 WALGIFLYKLLFFTTPFELTGQFAILHSKYEF-PKNNYSSKLINLIIIMLAENPNLRPNI 311

Query: 290 CQVLEEVSRLQGIPCPIKNFYLE 312
            QVL  +  + G+  PI++ Y E
Sbjct: 312 YQVLHNICSISGMKVPIEDQYAE 334

>Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)
           [2517 nt, 839 aa]
          Length = 838

 Score =  293 bits (749), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 150/312 (48%), Positives = 198/312 (63%), Gaps = 10/312 (3%)

Query: 8   TYPQGISLQVGVHHATILKYLTSGGYAQVYQAKI------SPPDSR---TGSDIVCLKRL 58
           +Y  G  + VG+H   ++KYL  GG+A++Y  K         P+ +      D +CLKR+
Sbjct: 28  SYVPGTIVIVGIHKVEVVKYLAEGGFAKIYVVKFLEYLSTVDPNGKEVLQNGDQLCLKRV 87

Query: 59  IVPDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLI 118
           +V D   LN  R EV+ M+ L+    VV Y DSNA++       YEVLLLME C+   L+
Sbjct: 88  LVQDDNGLNEMRNEVEVMRKLKGAPCVVQYYDSNASRRIDGAPGYEVLLLMELCSNNSLL 147

Query: 119 DFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDF 178
           D+MN RL  +L E EIL IM  VT  VA MH L  PL+HRDIKIENVL+ +   +KLCDF
Sbjct: 148 DYMNQRLATKLSEDEILKIMFDVTLAVAQMHYLPSPLIHRDIKIENVLVDSKNNFKLCDF 207

Query: 179 GSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYK 238
           GS    +   +S Q+   +  +I  +TT QYR+PEMIDL R LP++EKSDIWALGVFLYK
Sbjct: 208 GSTSTCLPIVSSHQDIAILTQNIYVHTTPQYRSPEMIDLYRCLPVNEKSDIWALGVFLYK 267

Query: 239 LCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSR 298
           L +YTTPFE+ G+ AILHS+YE+    +YS  L NLI +MLA  P+ RPNI QVL ++  
Sbjct: 268 LMFYTTPFERTGQFAILHSKYEF-PLNNYSSKLINLIIVMLAENPNLRPNIYQVLNQICY 326

Query: 299 LQGIPCPIKNFY 310
           + GI  P+ + Y
Sbjct: 327 ISGIKNPMDDAY 338

>Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON}
           (72364..75669) [3306 nt, 1102 aa]
          Length = 1101

 Score =  296 bits (758), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 151/320 (47%), Positives = 198/320 (61%), Gaps = 12/320 (3%)

Query: 2   NQPD-IPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGS---------- 50
           N+P  +  +  G ++ VG     I+KYLT GG+AQ+Y  K     +   S          
Sbjct: 17  NKPSAVEKFANGSTVVVGNKKVEIVKYLTEGGFAQIYIVKFLENSNEFDSNNSNIPLKIG 76

Query: 51  DIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLME 110
           D+ CLKR++V D+  LN  R EV+ MKLL+   ++V Y DSNA++       +EVLLLME
Sbjct: 77  DLACLKRVLVQDENGLNEMRNEVEVMKLLKGAPNIVQYFDSNASRRKDGTNGFEVLLLME 136

Query: 111 FCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNS 170
            C    L+DFMN RL  +L E EIL IM  VT  VA MH+L PPL+HRDIKIENVL+ + 
Sbjct: 137 LCPNKSLLDFMNQRLTTKLSEKEILTIMHDVTLAVAQMHTLSPPLIHRDIKIENVLVDSQ 196

Query: 171 GEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIW 230
             +KL DFGS        ++ Q+   +  DI  +TT QYR+PEMIDL + LPIDEKSDIW
Sbjct: 197 NGFKLADFGSTSKCFPAVSAHQDIAILSQDIFMHTTPQYRSPEMIDLYKCLPIDEKSDIW 256

Query: 231 ALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNIC 290
           ALG+FLYKL +Y TPFE  G+ AILHS+Y++    +YS  L NLI +ML+  P+ RPNI 
Sbjct: 257 ALGIFLYKLLFYITPFEMTGQFAILHSKYDF-PQTNYSSRLINLIIIMLSENPNLRPNIY 315

Query: 291 QVLEEVSRLQGIPCPIKNFY 310
           QVL E+  + G    I + Y
Sbjct: 316 QVLHEICSISGTRLEITDKY 335

>TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1061

 Score =  295 bits (754), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 152/316 (48%), Positives = 192/316 (60%), Gaps = 15/316 (4%)

Query: 9   YPQGISLQVGVHHATILKYLTSGGYAQVYQAKI--------SPPDSRTG------SDIVC 54
           YP G  + VG H   ++KY+  GG+AQ+Y  K         S P            DI C
Sbjct: 99  YPAGTPVAVGSHKVEVIKYIAEGGFAQIYTVKFIERLNEFASLPGGNQNQKPLQPGDIAC 158

Query: 55  LKRLIVPDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAE 114
           LKR++V D   LN  R EV+ M+ L+    VV Y DSNA+        YEVLLLMEFC  
Sbjct: 159 LKRVLVNDDNGLNEMRNEVNVMQKLQGAPCVVQYYDSNASHRSDSAPGYEVLLLMEFCPN 218

Query: 115 GGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYK 174
             L+D+MN RL  RL E EI+ IM   T G+A +H L+ PL+HRDIKIENVL+     +K
Sbjct: 219 NSLLDYMNDRLATRLSEKEIMKIMYDTTLGIAQLHYLKTPLIHRDIKIENVLVDQENNFK 278

Query: 175 LCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGV 234
           LCDFGS        T+ ++      +I  NTT QYR+PEMIDL R+ PIDEKSDIWALGV
Sbjct: 279 LCDFGSTSICFPIVTNHRDIAIFTQNIYVNTTPQYRSPEMIDLYRYQPIDEKSDIWALGV 338

Query: 235 FLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLE 294
           FLYKL ++TTPFE+ G+ AILHS+YE+    +YS  L NLI +MLA  PS RPNI QVL+
Sbjct: 339 FLYKLLFFTTPFERTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPSVRPNIYQVLQ 397

Query: 295 EVSRLQGIPCPIKNFY 310
            +  + G   P+ + Y
Sbjct: 398 YLCSINGWKVPLNDKY 413

>NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON}
           Anc_3.273
          Length = 1157

 Score =  295 bits (755), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 155/328 (47%), Positives = 200/328 (60%), Gaps = 29/328 (8%)

Query: 9   YPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPP-----DSRTG-------------- 49
           +P G  + VG H   I+KY+  GG+AQ+Y  K         DS T               
Sbjct: 24  FPAGTQVAVGSHKVEIIKYIAEGGFAQIYAVKYVESLNEFEDSNTDENAHLSGDRQAPNP 83

Query: 50  -----SDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGA-- 102
                 DI CLKR++V D+  LN  R EV+ MK L+   +VV Y DSNA++   HNGA  
Sbjct: 84  MILKLGDIACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRR--HNGASG 141

Query: 103 YEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKI 162
           +EVLLLME C    L+D+MN RL  +L E EIL IM  +T  V+ MH L+ PLLHRDIKI
Sbjct: 142 FEVLLLMELCPNKSLLDYMNQRLTTKLTEHEILKIMYDITFAVSHMHYLKIPLLHRDIKI 201

Query: 163 ENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLP 222
           ENVL+     +KLCDFGS    +   T+ Q+   +  +I  +TT QYR+PEMIDL R LP
Sbjct: 202 ENVLVDAQNNFKLCDFGSTSTRLPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLP 261

Query: 223 IDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQ 282
           IDEKSDIWALG+FLYKL ++ TPFE  G+ AILHS+YE+    +YS  L NLI +MLA  
Sbjct: 262 IDEKSDIWALGIFLYKLLFFITPFEMTGQFAILHSKYEF-PKNNYSSKLINLIIIMLAEN 320

Query: 283 PSQRPNICQVLEEVSRLQGIPCPIKNFY 310
           P+ RPNI QVL+ +  +  +  PI++ Y
Sbjct: 321 PNLRPNIYQVLDNICSMMNVEVPIEDIY 348

>KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}
           Anc_3.273 YBR059C
          Length = 949

 Score =  291 bits (746), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 150/323 (46%), Positives = 202/323 (62%), Gaps = 20/323 (6%)

Query: 6   IPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAK------------------ISPPDSR 47
           I  + +G +L VG H   I+ YLT GG+AQ+Y  K                  IS    +
Sbjct: 28  IEKFEKGQNLAVGTHKVEIVDYLTEGGFAQIYVVKFIEVLNEFDNEDNGSNVRISNYSLK 87

Query: 48  TGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLL 107
            G D+ CLKR++V D+  LN  R EV+ MK LR   ++V Y DSNA +S   N  YEVLL
Sbjct: 88  LG-DVACLKRVLVYDEVGLNEMRNEVNVMKKLRGCPNIVQYYDSNATRSHNGNPGYEVLL 146

Query: 108 LMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLI 167
           LME C+   L+++MN RL  +L E E+L IM  VT GVA MH L+ PL+HRDIKIENVL+
Sbjct: 147 LMELCSNNSLLNYMNQRLATQLSEKEVLKIMYDVTSGVAQMHYLKTPLIHRDIKIENVLV 206

Query: 168 SNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKS 227
            ++  +KLCDFGS        T+ Q+   +  ++  +TT QYR+PEMIDL R+LPI+EKS
Sbjct: 207 DSNNNFKLCDFGSATTCPPVATTHQDIALLGQNVYVHTTPQYRSPEMIDLYRYLPINEKS 266

Query: 228 DIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRP 287
           DIWALGVFLYKL +YTTPFE  G+ A+LHS+++  A   YS  + NL+ +ML+   + RP
Sbjct: 267 DIWALGVFLYKLLFYTTPFETTGQFAMLHSKFDIPA-NKYSSKIINLVIIMLSENLNLRP 325

Query: 288 NICQVLEEVSRLQGIPCPIKNFY 310
           NI QV+  + +L  +  PI + Y
Sbjct: 326 NIYQVMHYICQLIQVDTPILDIY 348

>KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.273
           YBR059C
          Length = 913

 Score =  286 bits (733), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 150/326 (46%), Positives = 200/326 (61%), Gaps = 24/326 (7%)

Query: 6   IPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKI-----------SP--PDSRTGSDI 52
           +  Y  G  + VG H   IL+Y+  GG+AQ+Y  K            SP   D     D+
Sbjct: 15  VEKYQPGKVIVVGSHRVEILQYIAEGGFAQIYSVKFLEYANEFDREESPGSKDQLQVGDL 74

Query: 53  VCLKRLIVPDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGA--------YE 104
            CLKR+IV D+  LN  R EV+ MK L    ++V Y DSNA++  L NG         +E
Sbjct: 75  ACLKRVIVQDQNGLNELRNEVNVMKKLVGAPNIVQYYDSNASR--LRNGTDSQPQENKFE 132

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIEN 164
           VLLLME C    L+D+MN RL  +L E EIL +M  V+  +A MH L  PL+HRDIKIEN
Sbjct: 133 VLLLMELCPNKSLLDYMNLRLATKLSEQEILEVMYDVSLAIAQMHYLRKPLIHRDIKIEN 192

Query: 165 VLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPID 224
           VL+     +KLCDFGS         + ++  ++  +I  +TT QYR+PEMIDL R LPID
Sbjct: 193 VLVDQKNRFKLCDFGSTSTCFPMVVTHRDIAYLTQNIYVHTTPQYRSPEMIDLYRCLPID 252

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPS 284
           EKSDIWALG+FLYKL ++TTPFE+ G+ AILHS++E+    +YS  L NLI +ML+  P+
Sbjct: 253 EKSDIWALGIFLYKLLFFTTPFERTGQFAILHSKFEF-PQNNYSFKLINLIIVMLSENPN 311

Query: 285 QRPNICQVLEEVSRLQGIPCPIKNFY 310
            RPNI QVL ++ +L+ +P PI + Y
Sbjct: 312 LRPNIYQVLHQICQLKQVPIPIADKY 337

>TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3.273
           YBR059C
          Length = 1054

 Score =  288 bits (736), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 155/323 (47%), Positives = 197/323 (60%), Gaps = 32/323 (9%)

Query: 2   NQP-DIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKI-------------SPPDSR 47
           N+P  I  Y QG  L VG+    ILKYLT GG+AQ+Y  +              +  +SR
Sbjct: 32  NRPGSIEKYKQGTILTVGIRRIEILKYLTEGGFAQIYTVRFIEYLNEFDNDDAENDNNSR 91

Query: 48  TGS--DIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAK---------- 95
                D+ CLKR++VPD+  L+  R EVD MK L N  ++V Y DSNA+K          
Sbjct: 92  NLKIGDVACLKRVLVPDENGLSEMRNEVDVMKKLVNCPNIVQYYDSNASKIKDNSNIDTT 151

Query: 96  -----SGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHS 150
                +   +  +E+LLLME+C    L+DFMN RL  +L E EIL  M+ +T  V  MH 
Sbjct: 152 NNNDNNKNTDLGFEILLLMEYCPNKSLLDFMNQRLTTKLTENEILKAMTDITTAVLQMHY 211

Query: 151 LEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYR 210
           L  PL+HRDIKIENVL+ ++  +KL DFGS   +  P T+ Q+   +  DI  NTT QYR
Sbjct: 212 LAQPLIHRDIKIENVLVDSNNNFKLADFGSTTKIQPPITTHQDIAILNKDIYMNTTPQYR 271

Query: 211 APEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDN 270
           +PEMIDL + LPIDEKSDIWALGV LYKL +YTTPFE  G+ AILHS+YE+ A  +YS  
Sbjct: 272 SPEMIDLYKCLPIDEKSDIWALGVLLYKLLFYTTPFELTGQFAILHSKYEFPA-NNYSSK 330

Query: 271 LKNLIRLMLANQPSQRPNICQVL 293
             NLI +MLA  P+ RPNI QVL
Sbjct: 331 FINLIIIMLAENPNLRPNIFQVL 353

>TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {ON}
           Anc_3.273 YBR059C
          Length = 788

 Score =  283 bits (723), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 147/314 (46%), Positives = 196/314 (62%), Gaps = 10/314 (3%)

Query: 6   IPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAK---------ISPPDSRTGSDIVCLK 56
           I TY  G  ++VG+H   I+KYL  GG+A++Y AK         I+        D++CLK
Sbjct: 96  IDTYVPGHIVEVGIHKVEIIKYLAEGGFAKIYVAKFLQYIKQIDINKIQVLQPGDLICLK 155

Query: 57  RLIVPDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGG 116
           R++V D   LN  R EV  MK L    ++V   DSNA++       YEVLLLME C+   
Sbjct: 156 RVLVTDDNGLNEMRNEVSVMKKLIGAPNIVQLYDSNASRRTDGIAGYEVLLLMELCSNKS 215

Query: 117 LIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLC 176
           L+D+MN RL  +L E EIL IM  VT  VA MH L  PL+HRDIKIENVL+ +   +KLC
Sbjct: 216 LLDYMNQRLAVKLTEPEILKIMFDVTLAVAQMHYLPIPLIHRDIKIENVLVDSQNNFKLC 275

Query: 177 DFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFL 236
           DFGS    +   T+ ++   +  ++  +TT QYR+PEMID+ R + I+EKSDIWALG+FL
Sbjct: 276 DFGSTSTCMPIATTHRDMAALTQNLYVHTTPQYRSPEMIDVYRCIHINEKSDIWALGIFL 335

Query: 237 YKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEV 296
           YKL +Y TPFE+ G+ AILHS+YE+  +  YS  L NLI +MLA  P+ RPNI QVL  +
Sbjct: 336 YKLLFYITPFERTGQFAILHSKYEFPQH-SYSMKLINLIIIMLAENPNLRPNIYQVLAYI 394

Query: 297 SRLQGIPCPIKNFY 310
            ++  I  PI + Y
Sbjct: 395 CKIINIKTPIDDIY 408

>KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 814

 Score =  283 bits (724), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 146/304 (48%), Positives = 191/304 (62%), Gaps = 11/304 (3%)

Query: 17  VGVHHATILKYLTSGGYAQVYQAKI--------SPPDSR--TGSDIVCLKRLIVPDKASL 66
           VG H   IL++L  GG+A +Y+ K         +  DS+     DI CLKR+IVPD+  L
Sbjct: 37  VGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGL 96

Query: 67  NTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQ 126
           N  R EV+ MK LR   ++V Y DSNA++    +  +E+LLLME C +  L+D+MN +L 
Sbjct: 97  NELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLA 156

Query: 127 NRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIR 186
            +L E EIL IM  V+  +A MH L  PL+HRDIKIENVL+     +KLCDFGS      
Sbjct: 157 TKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFP 216

Query: 187 PPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPF 246
             ++ Q+   + ++I  +TT QYR+PEMIDL R LPI+EKSDIWALG+FLYKL +YTTPF
Sbjct: 217 IVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 276

Query: 247 EKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQGIPCPI 306
           E  G+ AILHS+YE +    YS  L NLI +MLA  PS RPNI QV+  V  +     P 
Sbjct: 277 ELTGQFAILHSKYE-IPQNGYSSKLINLIIIMLAENPSLRPNIYQVMHHVCSILKCDVPF 335

Query: 307 KNFY 310
            + Y
Sbjct: 336 TDKY 339

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score =  285 bits (730), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 148/317 (46%), Positives = 192/317 (60%), Gaps = 12/317 (3%)

Query: 4   PDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKI----------SPPDSRTGSDIV 53
           P +  +  G  + VG H   ++ YL  GG+AQ+Y  K           S    + G D+ 
Sbjct: 17  PTMERFLPGAVVAVGTHRVEVVNYLAEGGFAQIYVVKFLEYLNEFENKSKVPMKVG-DVA 75

Query: 54  CLKRLIVPDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCA 113
           CLKR++V D+  L+  R EV+ MK L    ++V Y DSNA +    N  +EVLLLME C 
Sbjct: 76  CLKRVLVQDENGLSEMRNEVEVMKQLMGAQNIVQYYDSNACRRHNGNAGFEVLLLMELCP 135

Query: 114 EGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEY 173
              L+D+MN RL  +L E EIL IM  V+  V+ MH L+ PL+HRDIKIENVL+     +
Sbjct: 136 NKSLLDYMNQRLATKLTEKEILKIMYDVSLAVSQMHYLKNPLIHRDIKIENVLVDAQNSF 195

Query: 174 KLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALG 233
           KLCDFGS        T+ QE   +  +I  +TT QYR PEMIDL R LPI+EKSDIWALG
Sbjct: 196 KLCDFGSTSQCFPVVTTHQEIAILTQNIYVHTTPQYRCPEMIDLYRCLPINEKSDIWALG 255

Query: 234 VFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVL 293
           +FLYKL ++ TPFE  G+ AILHS+YE+    HYS  L NLI +MLA  P  RPNI QVL
Sbjct: 256 IFLYKLLFFITPFEMTGQFAILHSKYEFPPN-HYSSQLINLIIIMLAENPFVRPNIYQVL 314

Query: 294 EEVSRLQGIPCPIKNFY 310
             +  + G+  PI++ Y
Sbjct: 315 NHICTMIGVEVPIEDKY 331

>Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {ON}
           similar to Ashbya gossypii AGR027C
          Length = 894

 Score =  282 bits (721), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 143/307 (46%), Positives = 194/307 (63%), Gaps = 9/307 (2%)

Query: 12  GISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTG--------SDIVCLKRLIVPDK 63
           G  L VGVH   I++YL  GG+A +Y+       +            DI CLKR+ V D+
Sbjct: 31  GSILLVGVHRVEIIEYLAEGGFAHIYKVSFIEYTNELDRHHSVLQRGDIACLKRVQVNDE 90

Query: 64  ASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNT 123
             LN  R EV+ MK L+   +VV Y DSNA++       +EVLLLME C+ G L+D+MN 
Sbjct: 91  NGLNELRNEVEVMKKLKGCGNVVQYYDSNASRHTDGTPGFEVLLLMELCSNGSLLDYMNQ 150

Query: 124 RLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCG 183
           RL  +L E E+L IM  +T+G++ MH L  PL+HRDIKIENVL+ ++  +KLCDFGS   
Sbjct: 151 RLATKLSEREVLKIMYDITKGISHMHFLRTPLIHRDIKIENVLVDSANNFKLCDFGSTST 210

Query: 184 VIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYT 243
            +   ++ QE   + ++I  +TT QYR+PEMIDL R L I+EKSDIWALG+FLYKL +YT
Sbjct: 211 CLPAVSTHQEIAMLTNNIYVHTTPQYRSPEMIDLYRCLAINEKSDIWALGIFLYKLLFYT 270

Query: 244 TPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQGIP 303
           TPFE  G+ AILHS+Y+ +   ++S  L NLI +MLA  P  RPNI Q+L  +  +    
Sbjct: 271 TPFELTGQFAILHSKYD-IPQNNFSSKLINLIIVMLAENPYIRPNIYQILYHICSIMECD 329

Query: 304 CPIKNFY 310
            PI++ Y
Sbjct: 330 VPIEDHY 336

>AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR059C
           (AKL1)
          Length = 961

 Score =  283 bits (723), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 146/312 (46%), Positives = 191/312 (61%), Gaps = 19/312 (6%)

Query: 12  GISLQVGVHHATILKYLTSGGYAQVY-------------QAKISPPDSRTGSDIVCLKRL 58
           G ++ VGVH   +++YL  GG+A +Y             Q +I  P      D VCLKR+
Sbjct: 32  GSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQP-----GDTVCLKRV 86

Query: 59  IVPDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLI 118
            V D+  LN  R EV+ MK LRN  ++V Y DSNA++ G     YEVLLLME C  G L+
Sbjct: 87  RVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLL 146

Query: 119 DFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDF 178
           D+MN RL  +L E E+L IM  +T G++ MH    PL+HRDIKIENVL+     +KLCDF
Sbjct: 147 DYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDF 206

Query: 179 GSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYK 238
           GS    +    S QE   + ++I  +TT QYR+PEMIDL R LPI+EKSDIWALG+FLYK
Sbjct: 207 GSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYK 266

Query: 239 LCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSR 298
           L +YTTPFE  G+ AILHS+YE +    +S  L NL+ +MLA  P  RPN+ QV+  +  
Sbjct: 267 LLFYTTPFELTGQFAILHSKYE-IPRNSFSSKLINLVIIMLAENPYLRPNVYQVMYHICS 325

Query: 299 LQGIPCPIKNFY 310
           +      I + Y
Sbjct: 326 MMECEVKIDDLY 337

>KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} similar
           to uniprot|P38080 Saccharomyces cerevisiae YBR059C AKL1
           Ser-Thr protein kinase
          Length = 901

 Score =  280 bits (715), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 143/308 (46%), Positives = 192/308 (62%), Gaps = 10/308 (3%)

Query: 12  GISLQVGVHHATILKYLTSGGYAQVYQAKI---------SPPDSRTGSDIVCLKRLIVPD 62
           G  + VG H   I+KYL  GG+A +Y  K          +P  +    +  CLKR++V D
Sbjct: 32  GSQVIVGNHRVEIVKYLAEGGFAHIYVVKFVEYANELEQAPSITLKVGETACLKRVLVTD 91

Query: 63  KASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMN 122
           +  LN  R EV  MK L    ++V Y DS+A++S      +EV+LLME C    L+D+MN
Sbjct: 92  ENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRSRDGVPGFEVMLLMELCPNNSLLDYMN 151

Query: 123 TRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVC 182
            RL  +L E EIL IM  VT+ +A MH L  PL+HRD+KIENVL+     +KLCDFGS  
Sbjct: 152 QRLTTKLSEQEILKIMFDVTRALAQMHYLPIPLIHRDVKIENVLVDGDNNFKLCDFGSTS 211

Query: 183 GVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYY 242
             +    + QE   + ++I  +TT QYR+PEMIDL R LPIDEKSDIWALG+FLYKL +Y
Sbjct: 212 TCLPVANTHQEIAVLTNNIYIHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFY 271

Query: 243 TTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQGI 302
           TTPFE  G+ AILHS+YE+    +YS  L NLI +MLA  P+ RPNI Q+++ +  +  +
Sbjct: 272 TTPFELTGQFAILHSKYEF-PINNYSSKLINLIIIMLAENPNLRPNIYQIMDNLCSIMKV 330

Query: 303 PCPIKNFY 310
             PI++ Y
Sbjct: 331 ENPIEDKY 338

>Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {ON}
           YBR059C (REAL)
          Length = 1108

 Score =  281 bits (720), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 147/323 (45%), Positives = 196/323 (60%), Gaps = 10/323 (3%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAK----ISPPDSRTG-----SD 51
           M  P +  +  G  + VG H   ++ YL  GG+AQ+Y  K    ++  D+         D
Sbjct: 14  MGHPAVERFTPGHIVCVGTHKVEVINYLAEGGFAQIYMVKFVEYLNEFDNAASVPLKIGD 73

Query: 52  IVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEF 111
           + CLKR++V D+  LN  R EV+ MK L+   +VV Y DSNA++       +EVLLLME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSG 171
           C    L+D+MN RL  +L E EI+ IM  V   ++ MH L  PL+HRDIKIENVL+  + 
Sbjct: 134 CPNKSLLDYMNQRLSTKLTESEIVKIMYDVVLSISQMHYLPVPLIHRDIKIENVLVDANN 193

Query: 172 EYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWA 231
            +KL DFGS        T+ Q+   +  +I  +TT QYR+PEMIDL R LPI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQ 291
           LG+FLYKL ++TTPFE  G+ AILHS+YE+     YS  L NLI +MLA  P+ RPNI Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEF-PVNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VLEEVSRLQGIPCPIKNFYLERA 314
           VL  +  +  I  PI++ Y E A
Sbjct: 313 VLYHLCEILNIEVPIEDKYTEGA 335

>ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 1115

 Score =  281 bits (720), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 146/320 (45%), Positives = 192/320 (60%), Gaps = 12/320 (3%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKI----------SPPDSRTGS 50
           + +P +  Y  G  + VG     I+ ++  GG+AQ+Y  K           S    + G 
Sbjct: 14  VTKPVVDGYAPGTVVAVGNQQVEIISFIAEGGFAQIYSVKYIKFLGEFNNGSKAPLQPG- 72

Query: 51  DIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLME 110
           DI CLKR++VPD+  L+  R EV+ MK LR    ++ Y DSNA++       YEVLLLME
Sbjct: 73  DIACLKRVLVPDENGLSEMRNEVEVMKQLRGAKAIIQYYDSNASRRTSGQVGYEVLLLME 132

Query: 111 FCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNS 170
            C    L+D+MN RL  RL E EIL +M   T  ++ MH L  PL+HRDIKIENVL+   
Sbjct: 133 LCPNNSLLDYMNQRLATRLTEKEILKVMYDTTLAISQMHYLPIPLIHRDIKIENVLVDAQ 192

Query: 171 GEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIW 230
             +KLCDFGS        T+ Q+   +  +I  NTT QYR+PEMIDL R LPI+EKSDIW
Sbjct: 193 NNFKLCDFGSTSTCFPLVTTHQDIAILTQNIYVNTTPQYRSPEMIDLYRCLPINEKSDIW 252

Query: 231 ALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNIC 290
           ALG+FLYKL ++ TPFE  G+ +ILHS+YE+ A   YS  L NLI +MLA  P  RPNI 
Sbjct: 253 ALGIFLYKLLFFITPFEMTGQFSILHSKYEFPAN-KYSSKLINLIIIMLAENPYVRPNIY 311

Query: 291 QVLEEVSRLQGIPCPIKNFY 310
           QV+  +  + G   PI++ Y
Sbjct: 312 QVMHHICSVIGCEVPIEDKY 331

>Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {ON}
           YBR059C (REAL)
          Length = 1107

 Score =  280 bits (715), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 148/323 (45%), Positives = 194/323 (60%), Gaps = 10/323 (3%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAK----ISPPDSRTG-----SD 51
           M  P +  Y  G  + VG H   I+ YL  GG+AQ+Y  K    ++  D+         D
Sbjct: 14  MGHPAVERYTPGKIVCVGTHKVEIVNYLAEGGFAQIYAVKFLEYLNEFDNTASLPLKIGD 73

Query: 52  IVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEF 111
           + CLKR++V D+  LN  R EV+ MK L+   +VV Y DSNA++       +EVLLLME 
Sbjct: 74  VACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSG 171
           C    L+D+MN RL  +L E EI+ IM  V   ++ MH L  PL+HRDIKIENVL+    
Sbjct: 134 CPNKSLLDYMNQRLSTKLSESEIVKIMYDVALSISEMHYLPVPLIHRDIKIENVLVDAEN 193

Query: 172 EYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWA 231
            +KL DFGS        T+ Q+   +  +I  +TT QYR+PEMIDL R LPI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTSFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQ 291
           LG+FLYKL ++TTPFE  G+ AILHS+YE+     YS  L NLI +MLA  P+ RPNI Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEF-PVNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VLEEVSRLQGIPCPIKNFYLERA 314
           VL  +  +     PI++ Y E A
Sbjct: 313 VLYHICDILNAEVPIEDKYSEGA 335

>Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {ON}
           YBR059C (REAL)
          Length = 1090

 Score =  279 bits (713), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 147/321 (45%), Positives = 194/321 (60%), Gaps = 10/321 (3%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAK----ISPPDSRTG-----SD 51
           M  P +  Y  G  + VG H   I+ YL  GG+AQ+Y  K    ++  D+         D
Sbjct: 14  MGHPAVERYTPGDIVCVGTHKVEIVNYLAEGGFAQIYVVKFLEYLNEFDNAASVPLKIGD 73

Query: 52  IVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEF 111
           + CLKR++V D+  LN  R EV+ MK L+   +VV Y DSNA++       +EVLLLME 
Sbjct: 74  LACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSG 171
           C    L+D+MN RL  +L E EI+ IM  V   ++ MH L  PL+HRDIKIENVL+    
Sbjct: 134 CPNKSLLDYMNQRLSTKLTETEIVKIMYDVALSISQMHYLPVPLIHRDIKIENVLVDAKD 193

Query: 172 EYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWA 231
            +KL DFGS        T+ Q+   +  +I  +TT QYR+PEMIDL R LPI+EKSDIWA
Sbjct: 194 SFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQ 291
           LG+FLYKL ++TTPFE  G+ AILHS+YE+     YS  L NLI +MLA  P+ RPNI Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEF-PVNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VLEEVSRLQGIPCPIKNFYLE 312
           VL  +  +  +  PI++ Y E
Sbjct: 313 VLCHLCDILNVEVPIEDKYAE 333

>YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON}
           AKL1Ser-Thr protein kinase, member (with Ark1p and
           Prk1p) of the Ark kinase family; involved in endocytosis
           and actin cytoskeleton organization
          Length = 1108

 Score =  279 bits (713), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 146/323 (45%), Positives = 194/323 (60%), Gaps = 10/323 (3%)

Query: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAK----ISPPDSRTG-----SD 51
           M  P +  Y  G  + VG H   ++ YL  GG+AQ+Y  K    ++  D+         D
Sbjct: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73

Query: 52  IVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEF 111
           + CLKR++V D+  LN  R EV+ MK L+   ++V Y DSNA++       +EVLLLME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSG 171
           C    L+D+MN RL  +L E EI+ IM  V   ++ MH L   L+HRDIKIENVL+    
Sbjct: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193

Query: 172 EYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWA 231
            +KL DFGS        T+ Q+   +  +I  +TT QYR+PEMIDL R LPI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQ 291
           LGVFLYKL ++TTPFE  G+ AILHS+YE+     YS  L NLI +MLA  P+ RPNI Q
Sbjct: 254 LGVFLYKLLFFTTPFEMTGQFAILHSKYEF-PVNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VLEEVSRLQGIPCPIKNFYLERA 314
           VL  +  +  +  PI++ Y E A
Sbjct: 313 VLYHLCEILNVEVPIEDKYAEGA 335

>Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059C
           (AKL1) - Serine-threonine protein kinase [contig 32]
           FULL
          Length = 935

 Score =  275 bits (704), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 141/308 (45%), Positives = 191/308 (62%), Gaps = 10/308 (3%)

Query: 12  GISLQVGVHHATILKYLTSGGYAQVYQAKI---------SPPDSRTGSDIVCLKRLIVPD 62
           G  + VG H   I+KYL  GG+A +Y  +           P       D+ CLKR++V D
Sbjct: 74  GSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTD 133

Query: 63  KASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMN 122
           +  LN  R EV  MK L    ++V Y DS+A+++   +  +EV LLME C    L+D+MN
Sbjct: 134 ENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMN 193

Query: 123 TRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVC 182
            RL  +L E EIL IM  VT+ +A MH L  PL+HRD+KIENVL+  +  +KLCDFGS  
Sbjct: 194 QRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTS 253

Query: 183 GVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYY 242
                  + QE   + ++I  +TT QYR+PEMIDL R LPI+EKSDIWALG+FLYKL +Y
Sbjct: 254 TCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFY 313

Query: 243 TTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQGI 302
           TTPFE  G+ AILHS+YE+    +YS  L NLI +MLA  P+ RPNI QV++ +  +  +
Sbjct: 314 TTPFELTGQFAILHSKYEF-PVNNYSSKLINLIIIMLAENPNLRPNIYQVMDNLCSILKV 372

Query: 303 PCPIKNFY 310
             P+++ Y
Sbjct: 373 KNPLEDKY 380

>CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 991

 Score =  276 bits (705), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 148/322 (45%), Positives = 195/322 (60%), Gaps = 21/322 (6%)

Query: 3   QPDIP-TYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDS--------------R 47
           QP I   +P G  + VG H   ++ YL  GG+AQ+Y  K     +              +
Sbjct: 89  QPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLK 148

Query: 48  TGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAK----SGLHNGAY 103
            GS   CLKR++V D+  LN  R+EV+ MK L+   ++V Y DSNA++    SG     +
Sbjct: 149 PGSP-ACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGF 207

Query: 104 EVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIE 163
           EVLLLME C    L+D+MN RL  +L E EI  IM  +T  VA MH L  PL+HRDIKIE
Sbjct: 208 EVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIE 267

Query: 164 NVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPI 223
           NVL+  +  +KLCDFGS        TS Q+   +  D+  +TT QYR+PEMIDL +++PI
Sbjct: 268 NVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPI 327

Query: 224 DEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQP 283
           +EKSDIWALGVFLYKL ++TTPFE+ G+ A+LHS++E+     YS  L NLI +MLA  P
Sbjct: 328 NEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPN-SYSSKLINLIIVMLAENP 386

Query: 284 SQRPNICQVLEEVSRLQGIPCP 305
           S RPNI QVL  +S +     P
Sbjct: 387 SLRPNIYQVLYYLSEVTNREVP 408

>TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1361

 Score =  276 bits (706), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 138/316 (43%), Positives = 192/316 (60%), Gaps = 12/316 (3%)

Query: 6   IPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKI-----------SPPDSRTGSDIVC 54
           I  Y  G  + VG H   I  YL  GG+AQ+Y+ K               +S    DI C
Sbjct: 32  IEKYKPGKLISVGAHQVKIEDYLAEGGFAQIYKVKFIDYLNEFENKKDQLNSLKSGDIAC 91

Query: 55  LKRLIVPDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAE 114
           LKR++V D+  LN  R EV+ MKLL+   ++V Y DSNA +       YE+LLLME C  
Sbjct: 92  LKRVLVNDENGLNEMRNEVEVMKLLQGCPNIVQYYDSNALRRNDGLNGYEILLLMELCPN 151

Query: 115 GGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYK 174
             L+D+MN RL+ +L E EI+ IM   T  V+ MH L+ PL+H+DIK+EN+L+ ++  +K
Sbjct: 152 NSLLDYMNQRLKTKLNETEIVKIMYDTTLAVSQMHYLDKPLIHKDIKVENILVDSNNNFK 211

Query: 175 LCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGV 234
           LCDFGS        TS  +   +  +I  +TT QYR+PEMIDL R LPI+E SDIWALGV
Sbjct: 212 LCDFGSTSPCYEIVTSHHDIAVLTQNIYMHTTPQYRSPEMIDLYRCLPINETSDIWALGV 271

Query: 235 FLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLE 294
           FLYKL ++ TPFE+ G+ +ILH++++ +   +Y   L NLI +ML+   + RPNI QV+ 
Sbjct: 272 FLYKLLFFITPFERTGQFSILHAKFD-IPVNNYHPKLINLIIIMLSENLNLRPNIYQVMY 330

Query: 295 EVSRLQGIPCPIKNFY 310
           E+  +   P PI++ Y
Sbjct: 331 EICSITNTPLPIEDKY 346

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score =  105 bits (263), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 92/325 (28%), Positives = 156/325 (48%), Gaps = 61/325 (18%)

Query: 2   NQPDIPTYPQ-GISLQVGVHHATI-----------LKYLTSGGYAQVYQAKISPPDSRTG 49
           N+PDIP  P+  IS +    H TI           L  +  G ++ VY  K++ P   T 
Sbjct: 18  NEPDIPDTPRLTISRKRKDSHTTIHVPYLAGPYKQLNKIGKGSHSIVY--KVTHP---TS 72

Query: 50  SDIVCLKRLIVPDKASLNTPR-----AEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYE 104
              + LK+L + D   L T R      E++  KL+    +++S ID     + ++     
Sbjct: 73  DATLALKKLPIND-YKLKTNRRSTILKEIEIHKLVNGHKNIISMIDHFEIDATMY----- 126

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIEN 164
             +++E C  G L D +  R +  L+E+E   +M Q+   V  +H  E  ++H D+K+ N
Sbjct: 127 --MVLELCGAGSLYDII-CRSKRSLREWEAKRLMIQLCGAVDWIH--EKNIVHADLKLSN 181

Query: 165 VLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNT-----TAQYRAPEMID--- 216
           +LI +S   +LCDFG               +FV  DI  N+     T  Y +PE+I    
Sbjct: 182 ILIDSSNNLQLCDFGH--------------SFVSTDIDNNSINKFGTPNYLSPEIISNFI 227

Query: 217 LS--RHLPIDEKSDIWALGVFLYKLCYYTTPFE----KAGEAAILHSRYEYLAYPHYSDN 270
           LS  + L   ++SDIW++G+ LY + +  TPFE    ++    I+  +Y ++     S+ 
Sbjct: 228 LSDKKDLYFPKESDIWSIGIVLYAMIFDKTPFEATTLRSTYENIVECKYGFVENKRVSNK 287

Query: 271 LKNLIRLMLANQPSQRPNICQVLEE 295
           +K LI+ +L  QP +R  I +++ +
Sbjct: 288 VKKLIQNILKIQPLERKTIVEIVSD 312

>SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 364

 Score = 98.6 bits (244), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 87/360 (24%), Positives = 157/360 (43%), Gaps = 72/360 (20%)

Query: 6   IPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVP--DK 63
            P   +  S+ +   H  I + L  GG++ VY  +     SR  +D+  LK++  P  + 
Sbjct: 12  FPCCGRNSSVLINGQHYAIQRLLGEGGFSFVYLVQ-----SRENNDLFALKKIHCPFGNI 66

Query: 64  ASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNT 123
            S++    EV++ K  R+  ++   + S   +    +G+  V +L+ +   G L+D +NT
Sbjct: 67  ESVSEAMREVNSYKKFRS-PYITHCVSSQVLQE--QDGSKTVFILLPYFPTGSLLDKINT 123

Query: 124 RLQN--RLQEFEILNIMSQVTQGVAAMH-------------------------------- 149
            L +   + E EI+ I+  V +G+  MH                                
Sbjct: 124 HLLDGTTISEEEIVRILVSVARGLRTMHNPAGQEDSIEDQTSVNTDLQYRDTVSMTYNED 183

Query: 150 ------SLEPPLL---------------HRDIKIENVLISNSGEYKLCDFGSVCGVIRPP 188
                 SLE  +L               H+DIK  N++ S+ G   +CD GS        
Sbjct: 184 LRLLNDSLELDVLSGNTSSFMASTTAYSHKDIKPANIMFSSDGLPVICDLGSCSRAHVDI 243

Query: 189 TSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEK 248
           +S+ +    Q    ++ T  +R+PE+++++ +  IDEK DIW+LG  LY +C+  +PFE+
Sbjct: 244 SSRSQLVEFQEWCNEHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCMCFGISPFER 303

Query: 249 AGEA-------AILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQG 301
             +        AI   ++      +YS  L  +I+  +     +RP+I ++L  +  LQG
Sbjct: 304 EEQLSGASMTYAIATGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSIDELLARLQDLQG 363

>TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON}
           Anc_6.262 YPL236C
          Length = 372

 Score = 92.4 bits (228), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 82/340 (24%), Positives = 152/340 (44%), Gaps = 65/340 (19%)

Query: 23  TILKYLTSGGYAQVYQAKISPPDSRTGS-------DIVCLKRLIVP--DKASLNTPRAEV 73
           TI + L  G  + VY  +     + TGS       ++  LKR+  P  +  S++    EV
Sbjct: 34  TIRRLLGEGTLSFVYLVQRLGSKTATGSISLGNAPELYALKRIRCPFGNIESISAAMKEV 93

Query: 74  DAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRL--QNRLQE 131
           D  K  ++  ++++ +DS   +    +G+  + +L+ +   G L D +N  L     + E
Sbjct: 94  DNYKRFQS-PYIITLVDSQVVQE--KDGSKTLCILLPYFPLGSLQDMVNRNLLKGTFVSE 150

Query: 132 FEILNIMSQVTQGVAAMH-----------------SL-----------EPPL-------- 155
            E + IM  + +G+  +H                 SL           + PL        
Sbjct: 151 AECIRIMIGIARGLRCLHDPSARETSDAETMRDTVSLSYSDEAAFLLDDTPLELDVLSSH 210

Query: 156 --------LHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTA 207
                   +HRDI++ N+L S+ G   + D GS C      +++ + N +Q  +  N + 
Sbjct: 211 NTVNTRSYVHRDIRLANILFSSEGLPVVSDLGSCCKADITVSTKHQLNELQDWVTANCSF 270

Query: 208 QYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEA-------AILHSRYE 260
            Y APE++++  +  ID K+DIW++G   Y + +  +PFE+  +        AI   +Y 
Sbjct: 271 PYTAPELLNVKLNSTIDCKADIWSVGCTCYAMLFGMSPFERELQVSGASLTYAIGCGKYT 330

Query: 261 YLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300
           +     YS++L  +I+  L   P+ RP+I ++L+ +  LQ
Sbjct: 331 FPKQTRYSESLLAVIKSCLQVDPTARPDINELLDTLQDLQ 370

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score = 93.6 bits (231), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 80/297 (26%), Positives = 132/297 (44%), Gaps = 70/297 (23%)

Query: 17  VGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAM 76
           V + +  I+K +  G + +VY A     + R     V LK        + N P   V  +
Sbjct: 32  VDIGNYKIVKLIGEGSFGKVYLA-----NHRLTHQKVVLK------TGNKNDPNV-VREV 79

Query: 77  KLLRNFD--HVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEI 134
              R FD  H+    +    +S       +V + +E+C    L +++   +Q+R+   E 
Sbjct: 80  FYHRQFDFPHITKLYEVIVTES-------KVWMALEYCPGKELYEYL--LMQHRISLEES 130

Query: 135 LNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFG------------SVC 182
             + +Q+   V   HSL+   +HRD+K+EN+L+   G  K+ DFG            +VC
Sbjct: 131 GKLFAQIVSAVYYAHSLQ--CVHRDLKLENILLDKKGRAKITDFGFTRECATKTMLETVC 188

Query: 183 GVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYY 242
           G                      T  Y APE+I+   +     K DIW+LGV LY + + 
Sbjct: 189 G----------------------TTVYMAPELIERKSYDGF--KIDIWSLGVILYTMIHG 224

Query: 243 TTPFEKAGEAAILHSRYEYL-AYPHYSDNL-----KNLIRLMLANQPSQRPNICQVL 293
           T PF++  E     ++++ +   P Y+D++     K+LI  +L   PSQRP + QVL
Sbjct: 225 TMPFDEEDETK---TKWKIINEEPFYNDDVVSKDAKDLISQLLCKDPSQRPQLSQVL 278

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 91.7 bits (226), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 74/277 (26%), Positives = 126/277 (45%), Gaps = 41/277 (14%)

Query: 28  LTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPR------AEVDAMKLLRN 81
           L  GG+A+ +  K        G    C     +  K S+ T R      +E+   + LR 
Sbjct: 99  LGEGGFARCFHIK-----DDVGISFACK----IVSKKSIKTERTKFKLLSEIQIHQNLR- 148

Query: 82  FDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQV 141
           + H+V ++D              V +L+E C  G L+D +  R    L E E+  + +QV
Sbjct: 149 YSHIVKFMDC-------FEDELNVYILLELCPNGSLMDLLKKR--KILTEAEVKFMTTQV 199

Query: 142 TQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDI 201
              +  MHS    ++HRD+K+ NV    +   K+ DFG    +     S++++       
Sbjct: 200 CGAINYMHS--NNIIHRDLKLGNVFFDKNFNIKIGDFGLAATL--SNVSEKKYTMC---- 251

Query: 202 LKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILH----S 257
               T  Y APE+I LS+ +    ++DIW+LG+ +Y +     PF+      I       
Sbjct: 252 ---GTPNYIAPEVI-LSKQIGHSFEADIWSLGIMIYAMVLGKPPFQAKDVTTIYEKIKLC 307

Query: 258 RYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLE 294
           +YE+    + ++++K LI+ +L   PSQRP I  +L+
Sbjct: 308 QYEFPPDKYITNDVKVLIQDLLVLDPSQRPRIMDILK 344

>ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakly
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1262

 Score = 90.5 bits (223), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 63/182 (34%), Positives = 87/182 (47%), Gaps = 20/182 (10%)

Query: 113  AEGGLIDFMN-TRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSG 171
             E G ID  +   L+  + E+E   I  QV   +  +HS    ++HRDIK ENV++ + G
Sbjct: 1091 GETGCIDLFDLIELKTNMTEYEAKLIFRQVVSAIRHLHS--QGIVHRDIKDENVVVDSKG 1148

Query: 172  EYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEK-SDIW 230
              KL DFGS   V   P           D+   T   Y APE++      P D K  DIW
Sbjct: 1149 FVKLIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLSGE---PFDGKPQDIW 1194

Query: 231  ALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNIC 290
            A+GV LY + +   PF    E  IL    ++      S+   NLI+++L   PSQRP I 
Sbjct: 1195 AIGVLLYTIVFKENPFYNIDE--ILEVNLKFHGTKGVSEECINLIKMILNKNPSQRPTID 1252

Query: 291  QV 292
            +V
Sbjct: 1253 EV 1254

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 81/287 (28%), Positives = 132/287 (45%), Gaps = 54/287 (18%)

Query: 19  VHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKL 78
           V +  ILK +  G + +VY A   P   +     VCLK     DK   N  R EV   + 
Sbjct: 38  VGNYKILKQVGEGSFGKVYLALHRPTHRK-----VCLK---TSDKNDPNIVR-EVFYHRQ 88

Query: 79  LRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIM 138
             +F ++    +    ++       +V + +E+C    L D + +   +R+   E   + 
Sbjct: 89  F-DFPYITKLYEVIVTET-------KVWMALEYCPGKELYDHLLS--LHRISLLECAELF 138

Query: 139 SQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQ 198
           +Q++  V   HS+    +HRD+K+EN+L+  +G  KL DFG                F +
Sbjct: 139 AQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFG----------------FTR 180

Query: 199 HDILKNT------TAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEA 252
             + K T      T  Y APE+I+  R      K DIW+LGV LY L   + PF+   E 
Sbjct: 181 ECMTKTTLETVCGTTVYMAPELIE--RRTYDGFKIDIWSLGVILYTLITGSLPFDDDDE- 237

Query: 253 AILHSRYEYL-AYPHYS-----DNLKNLIRLMLANQPSQRPNICQVL 293
             + ++++ +   P+Y      D+ K+LI  +LA  P +RP++ QVL
Sbjct: 238 --VKTKWKIVNEEPNYDSTLIPDDAKDLISRLLAKNPKERPSLPQVL 282

>Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236C -
           Hypothetical ORF [contig 165] FULL
          Length = 346

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 83/327 (25%), Positives = 138/327 (42%), Gaps = 61/327 (18%)

Query: 24  ILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFD 83
           I K L  GG + VY       +S+ G ++  LK+   P      +  +   AMK + N+ 
Sbjct: 28  IQKLLGEGGLSFVYLV-----ESKEG-ELFALKKTRCP----FGSIGSISPAMKEVANYQ 77

Query: 84  -----HVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQN--RLQEFEILN 136
                ++   +DS   +    +G+  V +L+ + A+G L D +N  L +  ++ E +IL 
Sbjct: 78  RFSSPYIAQIVDSQVVQE--KDGSKTVYVLLPYFAKGSLQDLINRHLLDCTQMSELDILR 135

Query: 137 IMSQVTQGVAAMHSLEP-------------------PLL----------------HRDIK 161
           +   + +G+  +H   P                    LL                HRD+K
Sbjct: 136 MALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLELDTFGESQQSYAHRDVK 195

Query: 162 IENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHL 221
             N++IS      + D GS         S+Q     Q     N T  Y APE++D+  + 
Sbjct: 196 PSNIMISPEDLPVISDLGSCSRARIDINSRQALLRFQEWSSDNCTLSYAAPEILDVKLNS 255

Query: 222 PIDEKSDIWALGVFLYKLCYYTTPFEKAGEA-------AILHSRYEYLAYPHYSDNLKNL 274
            I EK DIW+ G  +Y +C+  +PFE+  +        AI   +Y       YS +L  L
Sbjct: 256 VITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKYTVPRGTSYSSSLIEL 315

Query: 275 IRLMLANQPSQRPNICQVLEEVSRLQG 301
           I   L+  P QRP++ +++  +  LQG
Sbjct: 316 IGKCLSVNPEQRPSVNELIALLMELQG 342

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 84/294 (28%), Positives = 127/294 (43%), Gaps = 66/294 (22%)

Query: 19  VHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKL 78
           V +  ILK +  G + +VY A       R     V LK        S N P   V  +  
Sbjct: 34  VGNYRILKIVGEGSFGKVYLA-----SHRLTHQKVVLKM------GSKNDPNV-VREVFY 81

Query: 79  LRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIM 138
            R FD+V  YI          N    V + +E+C    L +++   ++ R+   E  ++ 
Sbjct: 82  HRQFDYV--YITKLYEVIVTENS---VWMALEYCPGKELYEYL--LIKKRIPLDECSHLF 134

Query: 139 SQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFG------------SVCGVIR 186
           SQ+   V   HS++   +HRD+K+EN+L+   G+ KL DFG            +VCG   
Sbjct: 135 SQIVGAVFYAHSMK--CVHRDLKLENILLDKKGQAKLTDFGFTRECATKGILETVCG--- 189

Query: 187 PPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPF 246
                              T  Y APE+I+  R      K D W+LG+ LY + +   PF
Sbjct: 190 -------------------TTVYMAPELIE--RKPYEGYKIDTWSLGIILYTMIHGAMPF 228

Query: 247 EKAGEAAILHSRYEYL-AYPHYSDNL-----KNLIRLMLANQPSQRPNICQVLE 294
           +   E   + ++Y  +   P Y DN      K+LI  +L   PSQRP++ QVL+
Sbjct: 229 D---EEDDIKTKYRIVNNEPFYDDNFIDANGKDLIMQLLQKDPSQRPSLTQVLQ 279

>KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7.86
            YAL017W
          Length = 1055

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 87/314 (27%), Positives = 137/314 (43%), Gaps = 54/314 (17%)

Query: 1    MNQPDIPTYPQGISLQVGVHHAT-------ILKYLTSGGYAQVYQAKISPPDSRTGSDIV 53
            ++QP+ PT P GI+   G+   T       +L+ L  G Y  V+        ++    +V
Sbjct: 768  LSQPEPPTLPNGIN-PFGIERRTKRMADFVVLQKLGDGAYGHVHLCM-----NKKTKHLV 821

Query: 54   CLKRLIVPDKASLNTPRAEVDAMKLLRNFDHVVS--YIDSNAAKSGLHNGAYEVL----- 106
             +K +I          R  +D     R F  + S  YI S    +  H+   +++     
Sbjct: 822  IIKAII--------KERILIDTWVRDREFGTIPSEIYIMS-KFNAHPHDNITQIMDFFED 872

Query: 107  -----LLMEFCAEGGLIDFMN-TRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDI 160
                 + +E   E G ID  +   L+  + EFE   I  Q+  G+  +H  +  ++HRDI
Sbjct: 873  DDYYYIELESHGETGSIDLFDLIELKTNMTEFEAKLIFKQIVSGIKYLH--DQGIVHRDI 930

Query: 161  KIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRH 220
            K ENV++ ++G  KL DFGS       P       FV        T  Y APE++  +  
Sbjct: 931  KDENVIVDSNGFVKLIDFGSAAYTKTGPFEV----FVG-------TIDYAAPEILGGN-- 977

Query: 221  LPIDEK-SDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLML 279
             P   K  DIWALGV LY L Y   PF    E  IL  +  +    + + +  +LIR +L
Sbjct: 978  -PYKGKPQDIWALGVLLYTLIYKENPFYNVDE--ILEGQLRFDGTCNVTQDCIDLIRWIL 1034

Query: 280  ANQPSQRPNICQVL 293
                + RP+I +++
Sbjct: 1035 TKSVNDRPSIDEIV 1048

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 78/276 (28%), Positives = 130/276 (47%), Gaps = 42/276 (15%)

Query: 24  ILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFD 83
           ILK +  G + +VY A   P   +     V LK     DK+  N  R EV   +   +F 
Sbjct: 39  ILKQIGEGSFGKVYLASHKPTHRK-----VVLK---TSDKSDPNLVR-EVFYHRQF-DFP 88

Query: 84  HVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQ 143
           ++    +    ++       +V + +E+C    L + +   + +R+   E   + +Q+  
Sbjct: 89  YITKLYEVIVTET-------KVWMALEYCPGRELYEHL--LMLHRIPLDECAKLFAQIVS 139

Query: 144 GVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILK 203
            V   HSL    +HRD+K+EN+L+  +G  KL DF    G  R   S+     +      
Sbjct: 140 AVHYAHSLN--CVHRDLKLENILLDKNGNAKLTDF----GFTRECVSKSSLETI------ 187

Query: 204 NTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYL- 262
             T  Y APE+I   R      K DIW+LGV LY +   T PF++  E     ++++ + 
Sbjct: 188 CGTTVYMAPELI--QRQAYDGFKIDIWSLGVILYTMINGTMPFDEDDETK---TKWKIVN 242

Query: 263 AYPHYSDNL-----KNLIRLMLANQPSQRPNICQVL 293
            +P+++DN      K+LI+ +LA  PS+RP + Q+L
Sbjct: 243 DFPNFNDNFVSHEAKDLIKRLLAKCPSERPTMEQIL 278

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score = 87.0 bits (214), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 82/287 (28%), Positives = 129/287 (44%), Gaps = 54/287 (18%)

Query: 19  VHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKL 78
           V +  ILK +  G + +VY A   P   +     VCLK     DK   N  R EV   + 
Sbjct: 38  VGNYKILKQIGEGSFGKVYLALHRPTHRK-----VCLK---TSDKNDPNIVR-EVFYHRQ 88

Query: 79  LRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIM 138
             +F ++    +    +S       +V + +E+C    L D + +   +R+   E   + 
Sbjct: 89  F-DFPYITKLYEVIVTES-------KVWMALEYCPGKELYDHLLS--LHRISLLECGELF 138

Query: 139 SQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQ 198
           +Q++  V   HS+    +HRD+K+EN+L+  +G  KL DFG                F +
Sbjct: 139 AQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFG----------------FTR 180

Query: 199 HDILKNT------TAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEA 252
             + K T      T  Y APE+I   R      K D W+LGV LY L   + PF+   EA
Sbjct: 181 ECMTKTTLETVCGTTVYMAPELI--GRKTYDGFKIDTWSLGVILYTLITGSLPFDDDDEA 238

Query: 253 AILHSRYEYL-AYPHYS-----DNLKNLIRLMLANQPSQRPNICQVL 293
               ++++ +   P Y      D+ K+LI  +LA  P +RP++ QVL
Sbjct: 239 ---KTKWKIVNEEPKYDPKLIPDDAKDLISRLLAKNPGERPSLPQVL 282

>ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]
           {ON} similar to uniprot|P08458 Saccharomyces cerevisiae
           YDR523C SPS1 dispensable for mitosis involved in
           middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 471

 Score = 85.9 bits (211), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 59/193 (30%), Positives = 93/193 (48%), Gaps = 16/193 (8%)

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIEN 164
           + ++ME+C  G   D +     N + E ++  I SQV +G+  +H  E   +HRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKHIYINGMPEKKVAFITSQVLRGLVYLH--EQKKIHRDIKAAN 143

Query: 165 VLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPID 224
           +L+++ G  KL DFG V G IR    +  F           T  + APE++    +   D
Sbjct: 144 ILLTDEGTVKLGDFG-VSGQIRATLKRGTF---------VGTPYWMAPEVVS-KENDGYD 192

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKAGEAAI---LHSRYEYLAYPHYSDNLKNLIRLMLAN 281
           EK+DIW+LG+ +Y+L     P  K     +   L  R     + HYS + KN +   L  
Sbjct: 193 EKADIWSLGITVYELLKGAPPLSKCDPMKVMINLPKRKPPALHGHYSHSAKNFVSSCLVK 252

Query: 282 QPSQRPNICQVLE 294
            P  R +  +++E
Sbjct: 253 NPVGRASAYEMVE 265

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score = 86.7 bits (213), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 63/206 (30%), Positives = 99/206 (48%), Gaps = 43/206 (20%)

Query: 104 EVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIE 163
           +V + +E+C    L D + +   +R+   E + + +Q+  GV   HSL    +HRD+K+E
Sbjct: 103 KVWMALEYCPGKELYDRVLS--MHRVPTDECVQLFAQIVGGVHYAHSLN--CVHRDLKLE 158

Query: 164 NVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNT------TAQYRAPEMIDL 217
           N+L+  SG+ KL DFG                F +  + K T      T  Y APE+I+ 
Sbjct: 159 NILLDKSGDAKLTDFG----------------FTRECMTKTTLETICGTTVYMAPELIER 202

Query: 218 SRHLPIDEKSDIWALGVFLYKLCYYTTPF----EKAGEAAILHSRYEYLAYPHYSDNL-- 271
             +     K DIW+LGV LY +   + PF    E   E  I+H        P  ++N+  
Sbjct: 203 KSYDGF--KIDIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQT------PQLNENIVT 254

Query: 272 ---KNLIRLMLANQPSQRPNICQVLE 294
              K+LI  +LA  P+ RP + Q+L+
Sbjct: 255 ADAKDLILRLLAKNPNDRPTVEQILK 280

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 62/201 (30%), Positives = 95/201 (47%), Gaps = 35/201 (17%)

Query: 104 EVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIE 163
           +V +++E+C    L D++ ++   R+   E   I +Q+   V   HSL    +HRD+K+E
Sbjct: 104 KVWMVIEYCPNKELYDYLLSK--KRISLDESARIFAQIVGAVYYAHSLS--CVHRDLKLE 159

Query: 164 NVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNT-------TAQYRAPEMID 216
           N+L+      KL DFG                    D  KNT       T  Y APE+  
Sbjct: 160 NILLDKDNNAKLTDFG-----------------FTRDFSKNTQLETICGTTVYMAPEL-- 200

Query: 217 LSRHLPIDEKSDIWALGVFLYKLCYYTTPFE----KAGEAAILHSRYEYLAYPHYSDNLK 272
           L R      K DIWALG+ LY +   T PF+    K  E  I+ +  +Y    +++D+  
Sbjct: 201 LRREKYDGYKIDIWALGILLYTIINGTMPFDEDDPKKTELKIISASPDY-DNKYFNDDSI 259

Query: 273 NLIRLMLANQPSQRPNICQVL 293
           +L+  +L+  PS RP I Q+L
Sbjct: 260 DLVNRLLSKDPSMRPTIEQIL 280

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 98/208 (47%), Gaps = 49/208 (23%)

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIEN 164
           V + +E+C    L +++  +    L+E   L   SQ+   V   HS++   +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYLLAKKHIPLEECSEL--FSQIVGAVYYAHSMK--CVHRDLKLEN 158

Query: 165 VLISNSGEYKLCDFG------------SVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAP 212
           +L+   G  KL DFG            ++CG                      T  Y AP
Sbjct: 159 ILLDKKGHAKLTDFGFTRECATKGILETICG----------------------TTVYMAP 196

Query: 213 EMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAY-PHYSD-- 269
           E+I+  R      K D W+LG+ LY + + T PF++  E   + ++Y+ + Y P Y +  
Sbjct: 197 ELIE--RKPYEGYKIDTWSLGIILYTMIHGTMPFDEVDE---VKTKYKIVHYNPTYDNDY 251

Query: 270 ---NLKNLIRLMLANQPSQRPNICQVLE 294
              N K LI  +L   P+QRP++ QVL+
Sbjct: 252 IDSNGKELISQLLEKDPNQRPSLTQVLQ 279

>KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 346

 Score = 83.6 bits (205), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 79/332 (23%), Positives = 148/332 (44%), Gaps = 55/332 (16%)

Query: 15  LQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVP--DKASLNTPRAE 72
           + V  H   I + L  GG++ VY       +SR  + ++ LK++  P     S++    E
Sbjct: 19  VSVNGHRYHIKRLLGEGGFSFVYLV-----ESRE-NGLMALKKIRCPFGSIGSISPAMKE 72

Query: 73  VDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQ-- 130
           VD  +  ++  ++   IDS   +    +G+  V +L+ + ++G L D +N  L +  Q  
Sbjct: 73  VDNYQKFKS-PYIAQIIDSQVVQE--RDGSKTVYILLPYFSKGSLQDEINRHLLDCTQVP 129

Query: 131 EFEILNIMSQVTQGVAAMHSLEPP-------------------LL--------------- 156
           E E++ +   V +G+  +H   P                    LL               
Sbjct: 130 ELEVVRLALGVARGLLCIHDAAPADESDVTYSIVSAPYAEDSSLLNDLELDTFGESHQAY 189

Query: 157 -HRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMI 215
            H DIK  N++IS+ G   + D GS         S+Q     Q    ++ T  + APE++
Sbjct: 190 AHHDIKPSNIMISSEGMPVISDLGSCSRACVEINSRQALLQFQEWRSEHCTLTFMAPEIL 249

Query: 216 DLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGE---AAILHS----RYEYLAYPHYS 268
           D+  +  I EK D+W+ G  +Y +C+  +PFE+  +   A++ +S    +Y   +  +YS
Sbjct: 250 DVKLNSVITEKCDVWSFGCTIYTMCFGISPFEREEQISGASVTYSLTTGKYSIPSGTNYS 309

Query: 269 DNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300
             L ++++  L   P  RP++ +++  +  LQ
Sbjct: 310 SGLIDVVKKCLNVDPDGRPSVDELISLLMDLQ 341

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 82/287 (28%), Positives = 125/287 (43%), Gaps = 54/287 (18%)

Query: 19  VHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKL 78
           V +  ILK +  G + +VY A   P   +     VCLK     DK   N  R EV   + 
Sbjct: 38  VGNYKILKQIGEGSFGKVYLALHRPTHRK-----VCLK---TSDKNDPNIVR-EVFYHRQ 88

Query: 79  LRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIM 138
             +F ++    +    +S       +V + +E+C    L D  +     R+   E   + 
Sbjct: 89  F-DFPYITKLYEVIVTES-------KVWMALEYCPGKELYD--HLLSLRRISLLECGELF 138

Query: 139 SQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQ 198
           +Q++  V   HS+    +HRD+K+EN+L+  +G  KL DFG                F +
Sbjct: 139 AQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFG----------------FTR 180

Query: 199 HDILKNT------TAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEA 252
             + K T      T  Y APE+I+  R      K DIW+LGV LY L     PF+   EA
Sbjct: 181 ECMTKTTLETVCGTTVYMAPELIE--RRTYDGFKIDIWSLGVILYTLITGYLPFDDDDEA 238

Query: 253 AILHS------RYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVL 293
                      +Y+    P   D+ ++LI  +LA  P +RP++ QVL
Sbjct: 239 KTKWKIVNEEPKYDAKVIP---DDARDLISRLLAKNPGERPSLSQVL 282

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 96/201 (47%), Gaps = 18/201 (8%)

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIEN 164
           + ++ME+C  G   D +       L E +   I  +V +G+  +H  E   +HRDIK  N
Sbjct: 88  MWIIMEYCGGGSCADLLRNIYNCGLPESKSAYITREVLKGLEYLH--EQKKIHRDIKAAN 145

Query: 165 VLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPID 224
           +L+++ G+ KL DFG V G IR    +  F           T  + APE++        D
Sbjct: 146 ILLTDEGKVKLGDFG-VSGQIRATLKRGTF---------VGTPFWMAPEVVSKDSD-GYD 194

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKAGEAAI---LHSRYEYLAYPHYSDNLKNLIRLMLAN 281
           EK+DIW+LG+ +Y+L   + P  K     +   L  R   + + HYS   K+ +   L  
Sbjct: 195 EKADIWSLGITVYELLKGSPPLYKCDPMKVMVNLPKRKPPVLHGHYSSAAKHFVASCLVK 254

Query: 282 QPSQRPNICQVL--EEVSRLQ 300
            P  RP+  ++L  E V+ LQ
Sbjct: 255 NPKNRPSAVELLNSEFVTNLQ 275

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 96/210 (45%), Gaps = 53/210 (25%)

Query: 104 EVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIE 163
           +V + +E+C    L D + ++  +RL   E   + +Q+T  V   H+L    +HRD+K+E
Sbjct: 107 KVWMALEYCPGKELYDHLLSK--SRLPTLECAELFAQITGAVHYAHTLN--CVHRDLKLE 162

Query: 164 NVLISNSGEYKLCDFG------------SVCGVIRPPTSQQEFNFVQHDILKNTTAQYRA 211
           NVL+  +G  KL DFG            +VCG                      T  Y A
Sbjct: 163 NVLLDKNGNAKLTDFGFTRESMTKAVLETVCG----------------------TTVYMA 200

Query: 212 PEMIDLSRHLPIDE-KSDIWALGVFLYKLCYYTTPFEKAGE----AAILHSR---YEYLA 263
           PEMI   +H P D  K DIW+LGV LY L     PF++  +      I++      E + 
Sbjct: 201 PEMI---QHKPYDGFKVDIWSLGVILYTLLCGCLPFDEDDDLLTKQKIINDTPVIDERIT 257

Query: 264 YPHYSDNLKNLIRLMLANQPSQRPNICQVL 293
            P      +NLI  +L+  P++RPN   +L
Sbjct: 258 IPE----AQNLIEQLLSKDPTERPNTSAIL 283

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 71/272 (26%), Positives = 127/272 (46%), Gaps = 30/272 (11%)

Query: 27  YLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDHVV 86
           +L  GG+A+ +Q K    D +  +     K  I  +KA  N   +E+   K +R+  ++V
Sbjct: 103 FLGEGGFARCFQMK--DDDGKVFAAKTVAKISIKSEKAR-NKLLSEIQIHKNMRH-QNIV 158

Query: 87  SYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVA 146
            +ID              V +L+E C  G L+D +  R    L E E+    +Q+   + 
Sbjct: 159 HFIDC-------FEDDINVYILLEICPNGSLMDLLKRR--KILTEPEVRFFTTQICGALD 209

Query: 147 AMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTT 206
            MHS    ++HRD+K+ N+        K+ DFG     I    +++++           T
Sbjct: 210 HMHSRN--IIHRDLKLGNIFFDKDFNLKIGDFG--LAAIINNENERKYTIC-------GT 258

Query: 207 AQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAY-- 264
             Y APE+I   + +    + DIW+LGV ++ +     PF+ A E + ++ R ++  Y  
Sbjct: 259 PNYIAPEVIMGGKQIGHSFEVDIWSLGVMIFAMITGKPPFQ-AKEVSTIYDRIKHCNYSF 317

Query: 265 ---PHYSDNLKNLIRLMLANQPSQRPNICQVL 293
               + S ++K LI+ +L+  P +RP I ++L
Sbjct: 318 PTDKYVSKDVKKLIQDILSMNPMERPTIQEIL 349

>KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.24
           YDR523C
          Length = 507

 Score = 84.0 bits (206), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 60/215 (27%), Positives = 100/215 (46%), Gaps = 22/215 (10%)

Query: 83  DHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVT 142
           D++++YI +      +        ++M++C  G   D +     N + E ++  I+  V 
Sbjct: 72  DYIINYITTIMEDVSM-------WIVMDYCGGGSCSDLIKIVYPNGIVEEKVSFIVKNVL 124

Query: 143 QGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDIL 202
            G+  +H  E   +HRDIK  N+L+++ G+ KL DFG V G I+    +  F        
Sbjct: 125 LGLQYLH--EQKKIHRDIKAANILLTDDGQVKLGDFG-VSGQIKATLKRDTFV------- 174

Query: 203 KNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHS---RY 259
              T  + APE+I+   +   DEK DIW+LG+  Y+L     P  K     ++ S   R 
Sbjct: 175 --GTPYWMAPEVINKEINNGYDEKVDIWSLGITTYELLKGVPPLSKYDPVKVMTSLVKRK 232

Query: 260 EYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLE 294
               +  Y+D  K+ I   L   P  RPN+  +L+
Sbjct: 233 PPKLHGPYNDFTKSFISFCLIKDPKLRPNVQNLLK 267

>Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 80/345 (23%), Positives = 143/345 (41%), Gaps = 61/345 (17%)

Query: 14  SLQVGVHHATILKYLTSGGYAQVY-----QAKISPPDSRTGSDIVCLKRLIVPDKASLNT 68
           +++V      I + L  GG + VY     +  +   +     ++  LK++I P+  S++ 
Sbjct: 22  TIRVNDKRYKIQRLLGEGGLSFVYLVQLLKGSLIMENGVAAPELYALKKIICPNVESISN 81

Query: 69  PRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRL--Q 126
              E++  K  ++  +V+  IDS   +    +G+  + +++ F   G L D +N RL   
Sbjct: 82  GMREIENYKRFQS-PYVIQSIDSQVMQE--KDGSKSIYIILPFYTLGSLQDSINRRLLEG 138

Query: 127 NRLQEFEILNIMSQVTQGVAAMHS---------------------------------LEP 153
             + E E + IM  V +G+  +H                                  LE 
Sbjct: 139 TFISEAECVRIMLGVIRGLLCLHDPASRQDNTNSRTTVDTVSMTYSDETAFLLEDTPLEM 198

Query: 154 PLL-----------HRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDIL 202
            +L           HRDI   N+L S+ G   + D GS         ++ +   +Q  + 
Sbjct: 199 DMLSSNLGASIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLRELQEWVN 258

Query: 203 KNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEA-------AIL 255
            N T  Y APE++ L  +  +D K DIW+LG   Y L +  +PFE+  +        AI 
Sbjct: 259 DNCTLPYTAPELLGLKLNQTLDCKVDIWSLGCTFYTLMFGISPFEREEQIHGASITYAIN 318

Query: 256 HSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300
             +Y +     +S+ L ++I+  +   P QRP   Q+L  +  L+
Sbjct: 319 TGKYSFPRNSRFSEGLLSVIKKCIQVDPVQRPTTSQLLNILQDLE 363

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 73/277 (26%), Positives = 131/277 (47%), Gaps = 35/277 (12%)

Query: 27  YLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDH-- 84
           +L  GG+A+ +Q K    DS    DI   K +      S  T +  +  +++ ++  H  
Sbjct: 87  FLGEGGFARCFQIK---DDS---GDIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMAHPN 140

Query: 85  VVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQG 144
           +V +ID     S        V +L+E C  G L++ +  R    L E E+    +Q+   
Sbjct: 141 IVQFIDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLSEPEVRFFTTQICGA 191

Query: 145 VAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKN 204
           +  MHS    ++HRD+K+ N+   ++   K+ DFG     +    S++++          
Sbjct: 192 IKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG--LAAVLANESERKYTIC------- 240

Query: 205 TTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEY--L 262
            T  Y APE++ + +H     + DIW+LGV LY L     PF+ A +   ++ R +    
Sbjct: 241 GTPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCRDF 298

Query: 263 AYPH---YSDNLKNLIRLMLANQPSQRPNICQVLEEV 296
           ++P     SD  K LIR +L+  P +RP++ ++++ V
Sbjct: 299 SFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24
           YDR523C
          Length = 543

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 74/284 (26%), Positives = 137/284 (48%), Gaps = 32/284 (11%)

Query: 23  TILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPR--AEVDAMKLLR 80
           TI K +  G +  V++A      +    ++V +K +I  D +   T     E+  M LL+
Sbjct: 17  TIDKCVGKGNFGDVFKAM-----NNVTKEVVAIK-IINLDDSEEETFEIIKEMRLMSLLK 70

Query: 81  NFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQ 140
           +  ++  YI +        N  Y + ++ME+C  G   D + T  +  L E ++  ++  
Sbjct: 71  S-PYIARYITT-------INEDYLMWIVMEYCGGGSARDLIKTCYREGLAENKVAFVVKS 122

Query: 141 VTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHD 200
           V  G+  +H+     +HRDIK  N+L+++SG  K+ DFG V   +R  ++ +   FV   
Sbjct: 123 VLLGLQYLHAQHK--IHRDIKAANILLTDSGLVKVADFG-VSAEMR--STMKAKTFV--- 174

Query: 201 ILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHS--- 257
                T  + APE++ ++  +  +EKSDIW+LG+  Y+L     P  K     ++ +   
Sbjct: 175 ----GTPYWMAPEVV-MNEGMGYNEKSDIWSLGITTYELLKGVPPLAKYDAIRVMRNIPK 229

Query: 258 RYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQG 301
           R     +  Y++ +K+ I   L   P +RP+  ++LE    ++G
Sbjct: 230 RKPPKLHGAYTNLVKHFIATCLIKDPEKRPSASELLEHDFMVKG 273

>Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C
           (SPS1) - serine/threonine kinase homologous to Ste20p;
           expressed in middle/late meiosis [contig 123] FULL
          Length = 505

 Score = 83.2 bits (204), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 57/192 (29%), Positives = 93/192 (48%), Gaps = 17/192 (8%)

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIEN 164
           + ++MEFC  G   D +    ++RL E ++  I+ +V  G+  +HS     +HRD+K  N
Sbjct: 107 MWIVMEFCGGGSCADLLKHLPEHRLPENKVAYIIREVLYGLEYLHSQRK--IHRDVKAAN 164

Query: 165 VLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPID 224
           +L+++ GE KL DFG V G I     +  F           T  + APE+I  +R    D
Sbjct: 165 ILLTDEGEVKLGDFG-VSGQIMATLKRNTF---------VGTPYWMAPEII--ARDNGYD 212

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKAGEAAILHS---RYEYLAYPHYSDNLKNLIRLMLAN 281
           EK+DIW+LG+   +L     P+ K     +L +   R        ++ + ++ I L L  
Sbjct: 213 EKADIWSLGITAMELLTGQPPYAKYDPMKVLMNIPLRKPPRLQGRFTSSARDFIALCLTK 272

Query: 282 QPSQRPNICQVL 293
            P+ RP    +L
Sbjct: 273 DPALRPTASDLL 284

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 82.8 bits (203), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 92/194 (47%), Gaps = 16/194 (8%)

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIEN 164
           + ++ME+C  G   D +       L E ++  I   V +G+  +H  E   +HRD+K  N
Sbjct: 92  MWIVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKNVLRGLQYLH--EQRKIHRDVKAAN 149

Query: 165 VLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPID 224
           VL+++ G  KL DFG V G +R    +  F           T  + APE+I  S H   +
Sbjct: 150 VLLTDDGLVKLADFG-VSGQLRSTAKRNTF---------VGTPYWMAPEIISNSSH-GYN 198

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKAGEAAILHS---RYEYLAYPHYSDNLKNLIRLMLAN 281
           EK+DIW+LG+ +Y+L     P+ K     ++ +   +        +SD  K  I   L  
Sbjct: 199 EKADIWSLGITVYELLKGCPPYAKYDAGKVMRNIPKKNLQDCMVSFSDAAKLFISACLIK 258

Query: 282 QPSQRPNICQVLEE 295
            P +RP   ++L++
Sbjct: 259 DPDERPTATELLQQ 272

>KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1229

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 90/196 (45%), Gaps = 21/196 (10%)

Query: 107  LLMEFCAEGGLIDFMN-TRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENV 165
            L  E   E G ID  +   L+  + EFE   +  QV  G+  +H  +  ++HRDIK ENV
Sbjct: 1052 LETEMHGETGSIDLFDLIELKTNMTEFEAKLLFKQVASGIKHLH--DNGIVHRDIKDENV 1109

Query: 166  LISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDE 225
            ++ N G  KL DFGS   V   P           D+   T   Y APE++      P + 
Sbjct: 1110 IVDNKGFVKLIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGE---PYEG 1155

Query: 226  K-SDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPS 284
            K  DIWA+GV LY + Y   PF    E  IL       +    S     LIR +L    S
Sbjct: 1156 KPQDIWAIGVLLYTIIYKENPFYNIDE--ILDGDLRIQSTHEVSAECVALIRKILNRSVS 1213

Query: 285  QRPNICQVLEEVSRLQ 300
            +RP I  ++E+ S LQ
Sbjct: 1214 KRPTIDDIMED-SWLQ 1228

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 83.6 bits (205), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 72/277 (25%), Positives = 131/277 (47%), Gaps = 35/277 (12%)

Query: 27  YLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDH-- 84
           +L  GG+A+ +Q K    DS    +I   K +      S  T +  +  +++ ++  H  
Sbjct: 87  FLGEGGFARCFQIK---DDS---GEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMSHPN 140

Query: 85  VVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQG 144
           +V +ID     S        V +L+E C  G L++ +  R    L E E+    +Q+   
Sbjct: 141 IVQFIDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGA 191

Query: 145 VAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKN 204
           +  MHS    ++HRD+K+ N+   ++   K+ DFG     +    S++++          
Sbjct: 192 IKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG--LAAVLANESERKYTIC------- 240

Query: 205 TTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEY--L 262
            T  Y APE++ + +H     + DIW+LGV LY L     PF+ A +   ++ R +    
Sbjct: 241 GTPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCRDF 298

Query: 263 AYPH---YSDNLKNLIRLMLANQPSQRPNICQVLEEV 296
           ++P     SD  K LIR +L+  P +RP++ ++++ V
Sbjct: 299 SFPRDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096w KIN2 ser/thr protein kinase
          Length = 1192

 Score = 83.6 bits (205), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 103/210 (49%), Gaps = 20/210 (9%)

Query: 107 LLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVL 166
           +L E+ A G L+D++       L+E         V   +  +H+    ++HRD+KIEN++
Sbjct: 209 MLFEYVAGGQLLDYIIQ--HGSLREHHARKFARGVASALQYLHANN--IVHRDLKIENIM 264

Query: 167 ISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEK 226
           ISNSGE K+ DFG +  V    T +Q   F         +  + APE+  L  H     +
Sbjct: 265 ISNSGEIKIIDFG-LSNVYD--TRKQLHTFC-------GSLYFAAPEL--LKAHPYTGPE 312

Query: 227 SDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEY--LAYP-HYSDNLKNLIRLMLANQP 283
            D+W+ GV LY L     PF+    +++LH + +   + YP H S  + +L+  ML   P
Sbjct: 313 VDVWSFGVVLYVLVCGKVPFDDEN-SSVLHEKIKRGKVEYPQHLSIEVMSLLSKMLVVDP 371

Query: 284 SQRPNICQVLEEVSRLQGIPCPIKNFYLER 313
           S+R ++ QV+E     +G   P  ++   R
Sbjct: 372 SRRASLKQVVEHPWMTKGYDTPAPSYVPNR 401

>TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {ON}
           Anc_1.24 YDR523C
          Length = 482

 Score = 82.4 bits (202), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 93/193 (48%), Gaps = 16/193 (8%)

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIEN 164
           + ++ME+C  G   D +       + E ++  I+    +G+  +H  +   +HRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKMVYSKGIPESKVSYILRDTVKGLKYLHDQKK--IHRDIKAAN 143

Query: 165 VLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPID 224
           +L+++ G+ KL DFG V G IR    +  F           T  + APE+I+  +    +
Sbjct: 144 ILLTDCGKVKLGDFG-VSGQIRATMKRGTF---------VGTPYWMAPEVIN-KQCKGYN 192

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKAGEAAILHS---RYEYLAYPHYSDNLKNLIRLMLAN 281
           EK+DIW+LG+  Y+L     P  K     ++ +   R     +  YS+  K  + L L  
Sbjct: 193 EKADIWSLGITAYELLKGVPPLSKYDPFKVMLNIPKRKPPKLHGQYSEKAKYFVSLCLIK 252

Query: 282 QPSQRPNICQVLE 294
            P QRP+I  +LE
Sbjct: 253 DPKQRPSIEALLE 265

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 83/287 (28%), Positives = 128/287 (44%), Gaps = 54/287 (18%)

Query: 19  VHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKL 78
           V +  ILK +  G + +VY A   P   +     VCLK     DK   N  R EV   + 
Sbjct: 38  VGNYKILKQIGEGSFGKVYLALHRPTHRK-----VCLK---TSDKNDPNIVR-EVFYHRQ 88

Query: 79  LRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIM 138
             +F ++    +    +S       +V + +E+C    L D  +     RL   E   + 
Sbjct: 89  F-DFPYITKLYEVIVTES-------KVWMALEYCPGKELYD--HLLSLRRLSLLECGELF 138

Query: 139 SQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQ 198
           +Q++  V   HS+    +HRD+K+EN+L+  +G  KL DFG                F +
Sbjct: 139 AQISGAVYYAHSMH--CVHRDLKLENILLDRNGNAKLTDFG----------------FTR 180

Query: 199 HDILKNT------TAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEA 252
             + K T      T  Y APE+I+  R      K DIW+LGV LY L     PF+   E 
Sbjct: 181 ECMTKTTLETVCGTTVYMAPELIE--RKTYDGFKIDIWSLGVILYTLITGYLPFDDDDE- 237

Query: 253 AILHSRYEYL-AYPHYS-----DNLKNLIRLMLANQPSQRPNICQVL 293
             + ++++ +   P Y      D+ K+LI  +LA  P +RP++ QVL
Sbjct: 238 --VKTKWKIVNEEPKYDSKFIPDDAKDLISRLLAKNPGERPSLPQVL 282

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 72/277 (25%), Positives = 131/277 (47%), Gaps = 35/277 (12%)

Query: 27  YLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDH-- 84
           +L  GG+A+ +Q K    DS    +I   K +      S  T +  +  +++ ++  H  
Sbjct: 87  FLGEGGFARCFQIK---DDS---GEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMSHPN 140

Query: 85  VVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQG 144
           +V +ID     S        V +L+E C  G L++ +  R    L E E+    +Q+   
Sbjct: 141 IVQFIDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGA 191

Query: 145 VAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKN 204
           +  MHS    ++HRD+K+ N+   ++   K+ DFG     +    S++++          
Sbjct: 192 IKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG--LAAVLANESERKYTIC------- 240

Query: 205 TTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEY--L 262
            T  Y APE++ + +H     + DIW+LGV LY L     PF+ A +   ++ R +    
Sbjct: 241 GTPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCRDF 298

Query: 263 AYPH---YSDNLKNLIRLMLANQPSQRPNICQVLEEV 296
           ++P     SD  K LIR +L+  P +RP++ ++++ V
Sbjct: 299 SFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly
           similar to uniprot|Q03306 Saccharomyces cerevisiae
           YDR466W
          Length = 653

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 80/282 (28%), Positives = 123/282 (43%), Gaps = 38/282 (13%)

Query: 23  TILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNF 82
             L+ L  G Y+ V++A       R  +  VC K+ I+ ++  +     E D + LL   
Sbjct: 11  VFLEKLGQGSYSTVFRAVERANGLRNYAIKVCSKKHIIRER-KVKYVTVEKDLLNLLAGG 69

Query: 83  DH--VVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQ 140
            H  VV    +      L+        ++EF + G L+  +  R   RL E     I SQ
Sbjct: 70  GHPGVVRLFCTFHDTDNLY-------YVLEFVSGGELLGLV--RRMGRLPEEWCRRIASQ 120

Query: 141 VTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVC----GVIRPPTSQQEFNF 196
           +   V  MH+    ++HRD+K ENVL+S  G   + DFG+ C    G   P  + +  +F
Sbjct: 121 LVDTVDYMHAKG--VIHRDLKPENVLLSQEGRIVITDFGAACCASEGGSAPGAADRAASF 178

Query: 197 VQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGE----- 251
           V        TA+Y +PE++    H      SD+WALG  +Y+L     PF    E     
Sbjct: 179 V-------GTAEYVSPELL---LHSQCSFGSDVWALGCIIYQLTQGAPPFRGDTELQSFE 228

Query: 252 -AAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQV 292
               L  R+ Y A P     +  L++ +L   P QRP+  Q+
Sbjct: 229 KIVALDYRWVYAAPPL----IVALVQSILVLDPLQRPSAKQL 266

>Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON}
           (48405..49868) [1464 nt, 488 aa]
          Length = 487

 Score = 82.0 bits (201), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 57/186 (30%), Positives = 93/186 (50%), Gaps = 16/186 (8%)

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIEN 164
           + ++ME+C  G   D + T   N L E ++  I  +V +G+  +H  +   +HRDIK  N
Sbjct: 86  MWIVMEYCGGGACSDLIKTVYINGLPENKVGFITREVLKGLKYLHDQKK--IHRDIKAAN 143

Query: 165 VLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPID 224
           +L+++ G+ KL DFG V G IR   + +   FV        T  + APE+++   +   +
Sbjct: 144 ILLTDEGKVKLGDFG-VSGQIR--ATMKRGTFV-------GTPYWMAPEVVNKESN-GYN 192

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKAGEAAILHS---RYEYLAYPHYSDNLKNLIRLMLAN 281
           EK+DIW+LG+ +Y+L     P  K     ++ S   R     +  YSD  K  +   L  
Sbjct: 193 EKADIWSLGITVYELLKGLPPLSKCDPMKVMVSLPRRKPPKLHGQYSDVAKGFVAACLVK 252

Query: 282 QPSQRP 287
            P+ RP
Sbjct: 253 DPNLRP 258

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/270 (24%), Positives = 125/270 (46%), Gaps = 26/270 (9%)

Query: 28  LTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDHVVS 87
           L  G Y+ V  A  +  DS+    +  L +  +  +  +     E +A++ + N   +V 
Sbjct: 185 LGDGAYSTVMLA--TSIDSKKQYAVKVLNKEYLIKQKKVKYVNIEKNALQRINNSKMIVK 242

Query: 88  YIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAA 147
              +   +S L+        L+E+C  G  +  M  +    L E       +QV   +  
Sbjct: 243 LFFTFQDESSLY-------FLLEYCPNGDFLSLM--KKYGSLNETVACYYSAQVIDAIDY 293

Query: 148 MHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTA 207
           +H+    ++HRDIK EN+L+    + KL DFG+    I   ++  +F+ +        TA
Sbjct: 294 LHT--NGIIHRDIKPENILLDKEFKIKLTDFGT--AKILDSSTNNKFDLLTRSKSFVGTA 349

Query: 208 QYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGE----AAILHSRYEYLA 263
           +Y APE+++ S    +D + D+WA G  LY++     PF+   E      ++  +Y + A
Sbjct: 350 EYVAPELLNDSF---VDYRCDVWAFGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAFTA 406

Query: 264 -YPHYSDNLKNLIRLMLANQPSQRPNICQV 292
            +P     +++L++ +L    +QRP+I Q+
Sbjct: 407 GFPLI---IRDLVKKILVKDLNQRPSISQI 433

>Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 76/332 (22%), Positives = 142/332 (42%), Gaps = 61/332 (18%)

Query: 14  SLQVGVHHATILKYLTSGGYAQVY-----QAKISPPDSRTGSDIVCLKRLIVPDKASLNT 68
           +++V      I + L  GG + VY     +  +S  +S   +++  LK++I P   +++ 
Sbjct: 22  TIRVNDRRYKIQRLLGEGGMSFVYLVQLLKGSLSMENSAATAELYALKKIICPSVENISN 81

Query: 69  PRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRL--Q 126
              E++  K  ++  +V+  IDS   +    +G+  + +++ + + G L D +N RL   
Sbjct: 82  GMREIENYKRFQS-PYVIQSIDSQVMQE--KDGSKTIYIILPYYSLGSLQDSINRRLLEG 138

Query: 127 NRLQEFEILNIMSQVTQGVAAMHS---------------------------------LEP 153
             + E E + IM  VT+G+  +H                                  LE 
Sbjct: 139 TFISEAECVRIMLGVTRGLLCLHDPASRQDNVTTRTTVDTISMTYSDETAMLLEDTPLEM 198

Query: 154 PLL-----------HRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDIL 202
            +L           HRDI   N+L S+ G   + D GS         ++ + + +Q  + 
Sbjct: 199 DMLSSSSAGLIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLSELQEWVN 258

Query: 203 KNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEA-------AIL 255
            N T  Y APE+++L  +  +  K DIW++G   Y L +  +PFE+  +        AI 
Sbjct: 259 DNCTLPYTAPELLNLKLNQALSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASLTYAIN 318

Query: 256 HSRYEYLAYPHYSDNLKNLIRLMLANQPSQRP 287
             +Y +     +S+ L ++I+  +   P QRP
Sbjct: 319 TGKYSFPRNSRFSERLLDVIKRCIQVDPIQRP 350

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 71/277 (25%), Positives = 131/277 (47%), Gaps = 35/277 (12%)

Query: 27  YLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDH-- 84
           +L  GG+A+ +Q K    DS    +I   K +      S  T +  +  +++ ++  H  
Sbjct: 87  FLGEGGFARCFQIK---DDS---GEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMAHPN 140

Query: 85  VVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQG 144
           +V ++D     S        V +L+E C  G L++ +  R    L E E+    +Q+   
Sbjct: 141 IVQFVDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGA 191

Query: 145 VAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKN 204
           +  MHS    ++HRD+K+ N+   ++   K+ DFG     +    S++++          
Sbjct: 192 IKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG--LAAVLANESERKYTIC------- 240

Query: 205 TTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEY--L 262
            T  Y APE++ + +H     + DIW+LGV LY L     PF+ A +   ++ R +    
Sbjct: 241 GTPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCRDF 298

Query: 263 AYPH---YSDNLKNLIRLMLANQPSQRPNICQVLEEV 296
           ++P     SD  K LIR +L+  P +RP++ ++++ V
Sbjct: 299 SFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/281 (23%), Positives = 133/281 (47%), Gaps = 32/281 (11%)

Query: 27  YLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDHVV 86
           +L  GG+A+ +Q K           +    ++ +  + +     +E+   K +R+F+ VV
Sbjct: 96  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHFN-VV 151

Query: 87  SYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVA 146
            +ID     +        V +L+E C  G L++ +  R    + E E+   M+Q+   + 
Sbjct: 152 QFIDCFEDDTN-------VYILLEICPNGSLMELLKKR--RTVTEPEVRYFMTQICGAIK 202

Query: 147 AMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTT 206
            MHS    ++HRD+K+ N+    +   K+ DFG     +     ++++           T
Sbjct: 203 YMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFG--LAAVLANDRERKYTVC-------GT 251

Query: 207 AQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEY--LAY 264
             Y APE++ + +H     + DIW++GV +Y L     PF+ + +  +++ R +    A+
Sbjct: 252 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQ-SKDVNMIYERIKNRDFAF 309

Query: 265 P---HYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQGI 302
           P   + S+  K LI  +L+  P +RP+I ++++ V   +GI
Sbjct: 310 PKDKYISNEAKTLIHDILSTDPLERPSIEEIIDYVW-FRGI 349

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/205 (30%), Positives = 94/205 (45%), Gaps = 30/205 (14%)

Query: 101 GAY----EVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLL 156
           G+Y    E+ ++ME+CA G L   +      ++ E  I  IM ++   +A MH  +  ++
Sbjct: 83  GSYLNNTELWVIMEYCAGGSLRTLLRP---GKIGEQYIGVIMRELL--IALMHIHKDGVI 137

Query: 157 HRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNT---TAQYRAPE 213
           HRDIK  NVLI+N G  KLCDFG                  Q  I + T   T  + APE
Sbjct: 138 HRDIKAANVLITNDGHIKLCDFGVAA------------QLSQTKIRRQTMAGTPYWMAPE 185

Query: 214 MIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKA----GEAAILHSRYEYLAYPHYSD 269
           +I     +  D K DIW+LG+  Y++     P+           I  S+   L    +S 
Sbjct: 186 VI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLEGRQHSS 243

Query: 270 NLKNLIRLMLANQPSQRPNICQVLE 294
            LK  I L L   P +RP+  ++L+
Sbjct: 244 ALKEFIALCLDEDPKERPSAEELLK 268

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 72/278 (25%), Positives = 128/278 (46%), Gaps = 35/278 (12%)

Query: 26  KYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDH- 84
           ++L  GG+A+ +Q K    DS     I   K +      S  T +  +  +++ ++  H 
Sbjct: 85  QFLGEGGFARCFQIK---DDS---GKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMSHT 138

Query: 85  -VVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQ 143
            +V +ID              V +L+E C  G L++ +  R    + E E+   M+Q+  
Sbjct: 139 NIVQFIDC-------FEDNVNVYILLEICPNGSLMELIKKR--KTITEPEVRFFMTQICG 189

Query: 144 GVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILK 203
           G+  MHS    ++HRD+K+ N+        K+ DFG     +     +++F         
Sbjct: 190 GIQYMHSNR--VIHRDLKLGNIFFDEHYNLKIGDFG--LAAVLANDRERKFTIC------ 239

Query: 204 NTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEY-- 261
             T  Y APE++ + +H     + DIW++GV LY L     PF+ A +   ++ R +   
Sbjct: 240 -GTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQ-AKDVNTIYERIKQRN 296

Query: 262 LAYP---HYSDNLKNLIRLMLANQPSQRPNICQVLEEV 296
            AYP     S + K LI  +L+  P +RP+I ++++ V
Sbjct: 297 FAYPKDKKISQDAKYLIDDILSLNPMERPSIQEIMDYV 334

>TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1.24
           YDR523C
          Length = 516

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 58/189 (30%), Positives = 93/189 (49%), Gaps = 20/189 (10%)

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIEN 164
           + ++ME+C  G   D +    +  L E +   I  +V +G+  +H  E   +HRDIK  N
Sbjct: 86  IWIVMEYCGGGSCADLIKYAYKRGLPENKASFITKEVLKGLRYLH--EQKKIHRDIKAAN 143

Query: 165 VLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMI--DLSRHLP 222
           +L+++ G  KL DFG V G I+    +  F           T  + APE++  D S +  
Sbjct: 144 ILLTDDGMVKLGDFG-VSGQIKATLKKDTF---------VGTPYWMAPEVVKKDESGY-- 191

Query: 223 IDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHS---RYEYLAYPHYSDNLKNLIRLML 279
            +EK+DIW+LG+ +Y+L     P  K     ++ S   R     + HYS++ K+ I   L
Sbjct: 192 -NEKADIWSLGITVYELLKGCPPLAKYDPMKVMISVPKRRAPKLHGHYSEDAKSFISHCL 250

Query: 280 ANQPSQRPN 288
              P+ RPN
Sbjct: 251 IKDPNARPN 259

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 68/284 (23%), Positives = 129/284 (45%), Gaps = 32/284 (11%)

Query: 27  YLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDHVV 86
           +L  GG+A+ +Q K           +    ++ +  + +     +E+   K +++  ++V
Sbjct: 97  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTKKKLLSEIQIHKSMKH-PNIV 152

Query: 87  SYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVA 146
            ++D     +        V +L+E C+ G L+D M  R    L E E+    +Q+   V 
Sbjct: 153 HFVDCFEDDTN-------VYILLEICSNGSLMDLMKKR--KTLTEPEVRFFTTQICGAVK 203

Query: 147 AMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTT 206
            MHS    ++HRD+K+ N+        K+ DFG     +     ++++           T
Sbjct: 204 YMHSRR--VIHRDLKLGNIFFDKDYNLKVGDFG--LAAVLANNRERKYTVC-------GT 252

Query: 207 AQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSR-----YEY 261
             Y APE++ + +H     + DIW++GV +Y L     PF+ A +  +++ R     Y Y
Sbjct: 253 PNYIAPEVL-MGKHAGHSFEVDIWSIGVMIYALLVGKPPFQ-AKDVNVIYDRIKACQYGY 310

Query: 262 LAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQGIPCP 305
               + S   K LI  +L   P +RP+I +++++V   +GI  P
Sbjct: 311 PKDKYVSSEAKTLIADILCVDPVERPSIREIIDDVW-FRGIFPP 353

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 76/286 (26%), Positives = 130/286 (45%), Gaps = 52/286 (18%)

Query: 19  VHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRA-----EV 73
           V +  I+K +  G + +VY A   P   +     V LK     DK   N  R      + 
Sbjct: 34  VGNYKIMKQIGEGSFGKVYLASHKPTHRK-----VVLK---TSDKNDPNVVREVFYHRQF 85

Query: 74  DAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFE 133
           D + + R ++ +V+                +V + +E+C    L + +      R+   E
Sbjct: 86  DYLYITRLYEVIVTET--------------KVWMALEYCPGKELYEHLLA--LKRISLDE 129

Query: 134 ILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQE 193
              + +Q+   +   HSL    +HRD+K+EN+L+   G  KL DF    G  R   S+ +
Sbjct: 130 CSRLFAQIVGAIYYAHSLN--CVHRDLKLENILLDKKGNAKLTDF----GFTRECVSKSQ 183

Query: 194 FNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAA 253
                 D +  TT  Y APE+ +   +     K DIWALGV LY +   + PF++  EA 
Sbjct: 184 L-----DTICGTTV-YMAPELTERKSYDGF--KIDIWALGVILYTMINGSMPFDEDDEAK 235

Query: 254 ILHSRYEYL-AYPHYSDNL-----KNLIRLMLANQPSQRPNICQVL 293
              ++++ +   P  +++L     K+LI  +LA  P++RP+I ++L
Sbjct: 236 ---TKWKIVNEMPEINEDLVSPDAKDLIEQLLAKDPNERPSIEKIL 278

>TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1237

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 59/186 (31%), Positives = 87/186 (46%), Gaps = 20/186 (10%)

Query: 113  AEGGLIDFMN-TRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSG 171
             E G ID  +   L+  + EFE   I  QV  G+  +H  E  ++HRDIK ENV++ + G
Sbjct: 1066 GETGSIDLFDLIELKTNMTEFEAKLIFKQVISGIKHLH--EQGIVHRDIKDENVIVDSKG 1123

Query: 172  EYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEK-SDIW 230
              KL DFGS   V   P           D+   T   Y APE++      P + K  DIW
Sbjct: 1124 FVKLIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGE---PYEGKPQDIW 1169

Query: 231  ALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNIC 290
            A+G+ LY + +   PF    E  I+    ++      S+   NLI+ +L     +RP I 
Sbjct: 1170 AVGILLYTIVFKENPFYNIDE--IMEGTLKFSIGSEVSEECVNLIKKILNKNAPKRPTIQ 1227

Query: 291  QVLEEV 296
             + ++V
Sbjct: 1228 DIYDDV 1233

>KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7.86
            YAL017W
          Length = 1440

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 83/182 (45%), Gaps = 20/182 (10%)

Query: 113  AEGGLIDFMN-TRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSG 171
             E G ID  +   L+N + E E+  I  Q+  G+  +H  +  ++HRDIK ENV++  +G
Sbjct: 1269 GETGCIDLFDLIELKNNMTEMEVKLIFKQIVSGIKHLH--DQAIIHRDIKDENVIVDATG 1326

Query: 172  EYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEK-SDIW 230
              KL DFGS   V   P           D+   T   Y APE++      P + K  DIW
Sbjct: 1327 FVKLIDFGSAAHVKSGP----------FDVFVGTI-DYAAPEVLSGD---PYEGKPQDIW 1372

Query: 231  ALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNIC 290
            A+G+ LY + +   PF    E  IL     +      S   K LI ++L     +RP I 
Sbjct: 1373 AIGILLYTIVFKENPFYNIDE--ILEGELTFSESSDVSAECKALISMILNRNVQKRPTID 1430

Query: 291  QV 292
             +
Sbjct: 1431 DI 1432

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 73/294 (24%), Positives = 138/294 (46%), Gaps = 36/294 (12%)

Query: 27  YLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDHVV 86
           +L  GG+A+ +Q K    DS        + +L +  + +     +E+   K +++  +VV
Sbjct: 87  FLGEGGFARCFQIK---DDSGKIFAAKTVAKLSIKSEKTRKKLLSEIQIHKSMKH-QNVV 142

Query: 87  SYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVA 146
            +ID     +        V +L+E C  G L+D +  R    L E E+    +Q+   + 
Sbjct: 143 QFIDCFEDDTN-------VYILLEICPNGSLMDLLKKR--KLLTEPEVRFFTTQICGAIK 193

Query: 147 AMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTT 206
            MHS    ++HRD+K+ N+    +   K+ DFG     +     ++++           T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFG--LAAVLANDRERKYTVC-------GT 242

Query: 207 AQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEY--LAY 264
             Y APE++ + +H     + DIW++GV LY L     PF+ + +   ++ R +    ++
Sbjct: 243 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQ-SKDVNTIYERIKCCDFSF 300

Query: 265 P---HYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQGIPCPIKNFYLERAI 315
           P   H S+  K LI+ +L+  P +RP+I ++++ V   +GI  P    Y+E  +
Sbjct: 301 PKEKHISNEAKVLIQDLLSLDPLERPSISEIMDYVW-FRGIFPP----YIESTV 349

>TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_7.86
            YAL017W
          Length = 1262

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 86/180 (47%), Gaps = 18/180 (10%)

Query: 116  GLIDFMN-TRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYK 174
            G ID  +    +  + EFE   I  Q+  G++ +H  E  ++HRDIK ENV++   G  K
Sbjct: 1094 GCIDLFDLIEFKTNMTEFEAKLIFKQIISGISHLH--ESGIVHRDIKDENVIVDAKGFVK 1151

Query: 175  LCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGV 234
            L DFGS   V   P           D+   T   Y +PE++   ++    +  DIWALG+
Sbjct: 1152 LIDFGSAAYVKNGP----------FDVFVGTI-DYASPEVLRGEKYE--GKPQDIWALGI 1198

Query: 235  FLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLE 294
             LY + +   PF    E  IL    ++    + S N  +LI+L+L     +RP+I  + E
Sbjct: 1199 LLYTIVFKENPFYNIDE--ILEGDMKFPETENISANCIDLIKLILNRSALERPSITDISE 1256

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 60/211 (28%), Positives = 106/211 (50%), Gaps = 20/211 (9%)

Query: 107 LLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVL 166
           +L E+ + G L+D++       L+E         V   +  +H+    ++HRD+KIEN++
Sbjct: 202 MLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGVASALQYLHANN--IVHRDLKIENIM 257

Query: 167 ISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEK 226
           IS SGE K+ DFG +  V    T +Q   F         +  + APE++  + +  I  +
Sbjct: 258 ISTSGEIKIIDFG-LSNVFD--TRKQLHTFC-------GSLYFAAPELLKANPY--IGPE 305

Query: 227 SDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEY--LAYP-HYSDNLKNLIRLMLANQP 283
            DIW+ GV LY L     PF+    +++LH + +   + YP H S  + +L+  ML   P
Sbjct: 306 VDIWSFGVVLYVLVCGKVPFDDEN-SSVLHEKIKQGKVEYPNHLSIEVISLLSKMLVVDP 364

Query: 284 SQRPNICQVLEEVSRLQGIPCPIKNFYLERA 314
            +R N+ +V+E    ++G   P  ++  +R+
Sbjct: 365 LKRANLTKVIEHPWMIRGYDFPPPSYLPKRS 395

>Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C
           (REAL)
          Length = 364

 Score = 79.3 bits (194), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 79/332 (23%), Positives = 139/332 (41%), Gaps = 61/332 (18%)

Query: 14  SLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIV-----CLKRLIVPDKASLNT 68
           +++V      I + L  GG + VY  ++        + I+      LK++I P   S++ 
Sbjct: 22  TIRVNDKRYKIQRLLGEGGMSFVYLVQLLKNSLIMENGIITPEMYALKKIICPSVESISN 81

Query: 69  PRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRL--Q 126
              E++  K  ++  +V+  IDS   +    NG+  + +++ + + G L D +N RL   
Sbjct: 82  GMREIENYKRFQS-PYVIQSIDSQVTQE--KNGSKIIYIILPYYSLGSLQDSINRRLLEG 138

Query: 127 NRLQEFEILNIMSQVTQGVAAMHS---------------------------------LEP 153
             + E E + IM  VT+G+  +H                                  LE 
Sbjct: 139 TFISEAECVRIMLGVTRGLLCLHDPASRQDNITPRVNVDAVSMTYSDETAMLLEDTPLEM 198

Query: 154 PLL-----------HRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDIL 202
            +L           HRDI   N+L S+ G   + D GS         S+ + + +Q  + 
Sbjct: 199 DVLSSGSAGSIAYAHRDITPSNILYSSEGLPVIADLGSCSQADIRIGSRNQLSELQEWVN 258

Query: 203 KNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEA-------AIL 255
            N T  Y APE+++L  +  +  K DIW++G   Y L +  +PFE+  +        AI 
Sbjct: 259 DNCTLPYTAPELLNLKLNQILSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASITYAIN 318

Query: 256 HSRYEYLAYPHYSDNLKNLIRLMLANQPSQRP 287
             +Y +     +S+ L N+I+  +   P QRP
Sbjct: 319 TGKYSFPRNSRFSEALLNVIKKCIQVDPIQRP 350

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score = 80.5 bits (197), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 66/277 (23%), Positives = 122/277 (44%), Gaps = 35/277 (12%)

Query: 27  YLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDH-- 84
           +L  GG+A+ +Q K           I   K +      S  T R  +  +++ ++  H  
Sbjct: 100 FLGEGGFARCFQIK------DESGKIFAAKTVAKISIKSEKTKRKLLSEIQIHKSMKHSN 153

Query: 85  VVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQG 144
           +V +ID     +        V +L+E C  G L+D +  R    L E E+    +Q+   
Sbjct: 154 IVQFIDCFEDDAN-------VYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGA 204

Query: 145 VAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKN 204
           +  +HS    ++HRD+K+ N+        K+ DFG     +     ++++          
Sbjct: 205 IKYLHSRR--IIHRDLKLGNIFFDKDYNLKVGDFG--LAAVLANDRERKYTVC------- 253

Query: 205 TTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAY 264
            T  Y APE++ + +H     + DIW++GV +Y L     PF+ A +  +++ R +   Y
Sbjct: 254 GTPNYIAPEVL-MGKHSGHSFEVDIWSIGVMIYALLVGKPPFQ-AKDVNVIYERIKLCKY 311

Query: 265 PHYSDNLKN-----LIRLMLANQPSQRPNICQVLEEV 296
            +  D   +     LI  +L+  P QRP I  ++++V
Sbjct: 312 GYPKDKYVSKEAEILIHDILSLNPLQRPTIIDIIDDV 348

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 57/210 (27%), Positives = 103/210 (49%), Gaps = 20/210 (9%)

Query: 107 LLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVL 166
           +L E+ + G L+D++       L+E         +   +  +H+    ++HRD+KIEN++
Sbjct: 241 MLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIASALQYLHANN--IVHRDLKIENIM 296

Query: 167 ISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEK 226
           IS SGE K+ DFG +  +  P T    F           +  + APE++  S +  +  +
Sbjct: 297 ISTSGEIKIIDFG-LSNMFDPRTQLHTF---------CGSLYFAAPELLKASPY--VGPE 344

Query: 227 SDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEY--LAYP-HYSDNLKNLIRLMLANQP 283
            D+W+ GV LY L     PF+    +++LH + +   + YP H S  + +L+  ML   P
Sbjct: 345 VDVWSFGVVLYVLVCGKVPFDDEN-SSVLHEKIKQGKVDYPQHLSIEVISLLSKMLVVDP 403

Query: 284 SQRPNICQVLEEVSRLQGIPCPIKNFYLER 313
            +R ++ QV+E    ++G   P  ++   R
Sbjct: 404 RKRASLKQVVEHHWMIRGYDFPAPSYVPNR 433

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 95/219 (43%), Gaps = 27/219 (12%)

Query: 72  EVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQE 131
           E+  +  L+   ++  Y  S    + L        ++ME+CA G L   +      ++ E
Sbjct: 69  EIQFLASLKQIHNITRYYGSYLKDTSL-------WIIMEYCAGGSLRSLLR---PGKIDE 118

Query: 132 FEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQ 191
             I  IM +V   +  +H     ++HRDIK  NVLI+N G  KLCDFG    V +    +
Sbjct: 119 KYIGVIMREVLVALKCIHKDN--VIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRR 176

Query: 192 QEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKA-- 249
           Q             T  + APE+I     +  D K DIW+LG+  Y++     P+ +   
Sbjct: 177 QTM---------AGTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIATGNPPYCEVEA 225

Query: 250 --GEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQR 286
                 I+ S+   L    YS +LK  I L L   P +R
Sbjct: 226 LRAMQLIIKSKPPRLEGRSYSPSLKEFIALCLDEDPKER 264

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score = 80.1 bits (196), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 129/284 (45%), Gaps = 32/284 (11%)

Query: 27  YLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDHVV 86
           +L  GG+A+ +Q K    DS        + ++ +  + +     +E+   K +R+F+ +V
Sbjct: 84  FLGEGGFARCFQIK---DDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMRHFN-IV 139

Query: 87  SYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVA 146
            +ID     +        V +L+E C  G L+D +  R    L E E+    +Q+   V 
Sbjct: 140 QFIDCFEDDTN-------VYILLEICPNGSLMDLLKRR--KVLTEPEVRFFTTQIVGAVK 190

Query: 147 AMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTT 206
            MHS    ++HRD+K+ N+        K+ DFG     +     ++++           T
Sbjct: 191 YMHSRR--VIHRDLKLGNIFFDKHYNLKIGDFG--LAAVLANDRERKYTVC-------GT 239

Query: 207 AQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPH 266
             Y APE++   +H     + DIW+ GV +Y L     PF+ A E  I++ R +   Y  
Sbjct: 240 PNYIAPEVLT-GKHTGHSYEVDIWSCGVMIYALLIGKPPFQ-AKEVNIIYERIKCGDYVF 297

Query: 267 YSDNLKN-----LIRLMLANQPSQRPNICQVLEEVSRLQGIPCP 305
             D   +     LIR +L+  P +RP++ ++++ V   +GI  P
Sbjct: 298 PRDKCISQEALTLIRDILSIDPLERPSLDEIIDYVW-FRGIFPP 340

>ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {ON}
           some similarities with uniprot|Q03306 Saccharomyces
           cerevisiae YDR466W
          Length = 890

 Score = 80.1 bits (196), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 75/285 (26%), Positives = 135/285 (47%), Gaps = 37/285 (12%)

Query: 20  HHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV-PDKASLNTPRAEVDAMKL 78
           H     + L +G Y++VY+A       R  +  VC KR I+  +K    T   E + + L
Sbjct: 10  HDFVFKEELGNGSYSRVYKAVDRSDPQRVYAVKVCSKRHIIHENKVKYVT--IEKNTLNL 67

Query: 79  LRNFDHVVSYIDSNAAKSGLHNGAYE---VLLLMEFCAEGGLIDFMNTRLQNRLQEFEIL 135
           L   +H             LH+  ++   +  +++F A G L+  +N R+  +  E    
Sbjct: 68  LARANH--------PGIVKLHSTFHDEENLYFVLDFAAGGELLSLLN-RV-GKFTEPCAR 117

Query: 136 NIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFN 195
           + ++Q+      +HS    ++HRD+K ENVL+   G   + DFG+   + +   ++   +
Sbjct: 118 HFIAQLIDTTEFIHSQG--VIHRDLKPENVLLHRDGRLMVTDFGTATNITK-ENTEGGAS 174

Query: 196 FVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAIL 255
           FV        TA+Y +PE++  ++       SD+WALG  LY+      PF    E   L
Sbjct: 175 FV-------GTAEYVSPELLLYNQ---CQFASDVWALGCMLYQFIEGVPPFRGENE---L 221

Query: 256 HSRYEYLA--YPHYSDN---LKNLIRLMLANQPSQRPNICQVLEE 295
           H+  + +A  YP  ++N   + +L+R +L   PSQRP++  + ++
Sbjct: 222 HTFEKIVALEYPWANNNKGGVVSLVRRILTLDPSQRPSLTSIKQD 266

>NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1411

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 86/185 (46%), Gaps = 20/185 (10%)

Query: 113  AEGGLIDFMN-TRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSG 171
             E G ID  +    +  + EFE   I  QV  G+  +H     ++HRDIK ENV++ + G
Sbjct: 1240 GETGCIDLFDLIEFKTNMTEFEAKLIFKQVVSGIKHLH--HQGIVHRDIKDENVIVDSKG 1297

Query: 172  EYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEK-SDIW 230
              K+ DFGS   V   P           D+   T   Y APE++      P + K  DIW
Sbjct: 1298 LVKIIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLSGE---PYEGKPQDIW 1343

Query: 231  ALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNIC 290
            ALG+ LY + +   PF    E  IL    ++ +    +++   LI+ +L  Q   RP I 
Sbjct: 1344 ALGILLYTIVFKENPFYNIDE--ILEGDLKFDSNTEVTEDCMELIKKVLIRQVRNRPAID 1401

Query: 291  QVLEE 295
            ++ ++
Sbjct: 1402 EIFDD 1406

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 70/284 (24%), Positives = 134/284 (47%), Gaps = 32/284 (11%)

Query: 27  YLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDHVV 86
           +L  GG+A+ +Q K    DS        + +L +  + +     +E+   K +R+ + +V
Sbjct: 106 FLGEGGFARCFQIK---DDSGKIFAAKTVAKLSIKTEKTRKKLLSEIQIHKSMRHAN-IV 161

Query: 87  SYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVA 146
            +ID    ++        V +L+E C  G L++ +  R    L E E+    +Q+  G+ 
Sbjct: 162 QFIDCFEDETN-------VYILLEICPNGSLMELLKKR--KTLTEPEVRFFTTQICGGIK 212

Query: 147 AMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTT 206
            MHS    ++HRD+K+ N+    +   K+ DFG     +     ++++           T
Sbjct: 213 YMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFG--LAAVLANDRERKYTVC-------GT 261

Query: 207 AQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEY--LAY 264
             Y APE++ + +H     + DIW++GV +Y L     PF+ A +   ++ R +     +
Sbjct: 262 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQ-AKDVNTIYERIKCCDFVF 319

Query: 265 P---HYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQGIPCP 305
           P   + S   + L++ +L+  P +RP+I +VL+ V   +GI  P
Sbjct: 320 PKEKYISSEARILVQDLLSLDPLERPSIMEVLDYVW-FRGIFPP 362

>Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 73/272 (26%), Positives = 119/272 (43%), Gaps = 41/272 (15%)

Query: 31  GGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDH--VVSY 88
           G Y  VY+A     D      +V +K ++  +   LN   AE+    LL+N +H  +V Y
Sbjct: 34  GSYGVVYKAINKHTD-----QVVAIKEIVYENDEELNDIMAEI---SLLKNLNHHNIVKY 85

Query: 89  IDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAM 148
                   G    +YE+ +L+E+CA G L   + +R    L E E    ++Q   G+  +
Sbjct: 86  -------HGFIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKTYVTQTLLGLKYL 137

Query: 149 HSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPP--TSQQEFNFVQHDILKNTT 206
           H     ++HRDIK  N+L+S     KL DFG V  ++     T     N++  +IL N  
Sbjct: 138 HG--EGVIHRDIKAANILLSADNTVKLADFG-VSTIVNSSALTLAGTLNWMAPEILGNRG 194

Query: 207 AQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYP- 265
           A                   SDIW+LG  + ++     P+    +A I ++      YP 
Sbjct: 195 AS----------------TLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPP 238

Query: 266 -HYSDNLKNLIRLMLANQPSQRPNICQVLEEV 296
             +S++LK+ +         +RP   Q+L+ V
Sbjct: 239 SSFSESLKDFLSKCFVKNMYKRPTADQLLKHV 270

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 94/219 (42%), Gaps = 27/219 (12%)

Query: 72  EVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQE 131
           E+  +  L+   ++  Y  S    + L        +LME+CA G L   +      ++ E
Sbjct: 69  EIQFLASLKQMPNITRYYGSYLKDTSL-------WILMEYCAGGSLRSLLRP---GKIDE 118

Query: 132 FEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQ 191
             I  IM ++   +  +H     ++HRDIK  NVLI+N G  KLCDFG    V +    +
Sbjct: 119 KYIGVIMRELLVALKCIHKDN--VIHRDIKAANVLITNEGSVKLCDFGVAAQVNQTSLRR 176

Query: 192 QEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKA-- 249
           Q             T  + APE+I     +  D K DIW+LG+  Y++     P+     
Sbjct: 177 QTM---------AGTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEA 225

Query: 250 --GEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQR 286
                 I+ S+   L    YS +LK  I L L   P +R
Sbjct: 226 LRAMQLIIKSKPPRLEGRSYSSSLKEFIALCLDEDPKER 264

>Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {ON}
           YDR466W - Hypothetical ORF [contig 196] FULL
          Length = 621

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 74/274 (27%), Positives = 124/274 (45%), Gaps = 24/274 (8%)

Query: 23  TILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNF 82
             L  L  G Y+ VY+A       R  +  VC K+ I+ +K  +     E D + +L   
Sbjct: 11  VFLDRLGQGSYSTVYRAVERSNSGRNYAIKVCSKKHIIREK-KVKYVTIEKDLLNMLAKG 69

Query: 83  DHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVT 142
            H+   +        + N    +  ++E+ + G L+  +  RL  RL E    +I +Q+ 
Sbjct: 70  GHL-GIVKLFCTFHDIEN----LYFVLEYVSGGELLALIQ-RL-GRLTEDLSRHITAQLV 122

Query: 143 QGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDIL 202
             V  MHS    ++HRD+K ENVL+S  G   + DFG+ C       + ++F   +    
Sbjct: 123 DTVDYMHS--KGVIHRDLKPENVLLSQEGRVVITDFGAAC-----TAADRKFENTKRTAS 175

Query: 203 KNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGE----AAILHSR 258
              TA+Y +PE++    H      SDIWALG  +Y+L     PF    E      I+   
Sbjct: 176 FVGTAEYVSPELL---LHSQCGFSSDIWALGCIIYQLNQGKPPFRGENELQTFEKIVALD 232

Query: 259 YEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQV 292
           Y++L     S  + ++++ +L   P +RP+  Q+
Sbjct: 233 YKWLF--SNSPQVVSIVQSILVTDPLKRPSAAQL 264

>SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar to
           uniprot|Q751V1 Ashbya gossypii AFR724C AFR724Cp and some
           similarites with YDR523C uniprot|P08458 Saccharomyces
           cerevisiae YDR523C SPS1 dispensable for mitosis involved
           in middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 564

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 92/193 (47%), Gaps = 16/193 (8%)

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIEN 164
           + ++ME+C  G   D +    +  L E ++  I  ++ +G+  +HS     +HRDIK  N
Sbjct: 105 MWIVMEYCGGGSCSDLLKCLPRGTLTEEKVAFITREILRGLEYLHSQRK--IHRDIKAAN 162

Query: 165 VLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPID 224
           +L+++ G+ KL DFG          S Q     + D    T   + APE+I  S     +
Sbjct: 163 ILLTDDGKVKLGDFG---------VSGQMMATRRRDTFVGTPF-WMAPEVIARSEQ-GYN 211

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKAGEAAILH---SRYEYLAYPHYSDNLKNLIRLMLAN 281
           EK+DIW+LG+ +++L     P  +     +L    SR        YS  ++  + L L  
Sbjct: 212 EKADIWSLGITVFELLKGQPPLSQHDPMKVLMSIPSRRPPKLEDRYSHAIREFVSLCLNK 271

Query: 282 QPSQRPNICQVLE 294
            P++RP   ++L+
Sbjct: 272 DPAKRPTASELLK 284

>YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON}
           ENV7Protein proposed to be involved in vacuolar
           functions; mutant shows defect in CPY processing; has
           sequence similarity with the human serine/threonine
           protein kinase STK16
          Length = 364

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 76/332 (22%), Positives = 139/332 (41%), Gaps = 61/332 (18%)

Query: 14  SLQVGVHHATILKYLTSGGYAQVYQAKISP-----PDSRTGSDIVCLKRLIVPDKASLNT 68
           +++V      I + L  GG + VY  ++S       +     ++  LK++I P   S++ 
Sbjct: 22  TIRVNDKRYRIQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPELYALKKIICPSVESISN 81

Query: 69  PRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRL--Q 126
              E++  K  ++  +V+  IDS   +    +G+  + +++ + + G L D +N RL   
Sbjct: 82  GMREIENYKRFQS-PYVIKSIDSQVMQE--KDGSKTIYIVLPYYSLGSLQDSINRRLLEG 138

Query: 127 NRLQEFEILNIMSQVTQGVAAMHS---------------------------------LEP 153
             + E E + IM  VT+G+  +H                                  LE 
Sbjct: 139 TFVSEAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLEDTPLEM 198

Query: 154 PLL-----------HRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDIL 202
            +L           HRDI   N+L S+ G   + D GS         ++ + + +Q  + 
Sbjct: 199 DMLSSNSAGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSELQEWVN 258

Query: 203 KNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEA-------AIL 255
            N T  Y  PE+++L  +  +  K DIW+LG   Y L +  +PFE+  +        AI 
Sbjct: 259 DNCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASLTYAIN 318

Query: 256 HSRYEYLAYPHYSDNLKNLIRLMLANQPSQRP 287
             +Y +     +S+ L ++I+  +   P QRP
Sbjct: 319 TGKYSFPRNSRFSEGLLSVIKKCIQVDPIQRP 350

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 94/205 (45%), Gaps = 30/205 (14%)

Query: 101 GAY----EVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLL 156
           G+Y    ++ ++ME+CA G L   +      ++ E  I  IM ++    A MH  +  ++
Sbjct: 83  GSYLNDTKLWVIMEYCAGGSLRTLLRP---GKIGEQYIGVIMRELL--TALMHIHKDGVI 137

Query: 157 HRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNT---TAQYRAPE 213
           HRDIK  NVLI+N G  KLCDFG                  Q  I + T   T  + APE
Sbjct: 138 HRDIKAANVLITNDGHIKLCDFGVAA------------QLSQTKIRRQTMAGTPYWMAPE 185

Query: 214 MIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKA----GEAAILHSRYEYLAYPHYSD 269
           +I     +  D K DIW+LG+  Y++     P+ +         I  S+   L    +S 
Sbjct: 186 VI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLEGRQHSS 243

Query: 270 NLKNLIRLMLANQPSQRPNICQVLE 294
            LK +I L L   P +RP+   +L+
Sbjct: 244 ALKEIIALCLDEDPKERPSAEDLLK 268

>Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C
           (REAL)
          Length = 974

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 71/268 (26%), Positives = 119/268 (44%), Gaps = 37/268 (13%)

Query: 31  GGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDHVVSYID 90
           G Y  VY+A      ++    +V +K ++      LN   AE+  +K L N D++V Y  
Sbjct: 34  GSYGVVYKAI-----NKHTDQVVAIKEIVYESDEELNDIMAEISLLKNL-NHDNIVKY-- 85

Query: 91  SNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHS 150
                 G    +YE+ +L+E+CA G L   + +R    L E E  + ++Q   G+  +H 
Sbjct: 86  -----HGFIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKSYVTQTLLGLKYLHG 139

Query: 151 LEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPP--TSQQEFNFVQHDILKNTTAQ 208
               ++HRDIK  N+L+S     KL DFG V  ++     T     N++  +IL N  A 
Sbjct: 140 --EGVIHRDIKAANILLSADNTVKLADFG-VSTIVNSSALTLAGTLNWMAPEILGNRGAS 196

Query: 209 YRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYP--H 266
                             SDIW+LG  + ++     P+    +A I ++      YP   
Sbjct: 197 ----------------TLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSS 240

Query: 267 YSDNLKNLIRLMLANQPSQRPNICQVLE 294
           +S++LK+ +         +RP   Q+L+
Sbjct: 241 FSESLKDFLSKCFVKNMYKRPTADQLLK 268

>Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {ON}
            similar to Ashbya gossypii ACR281C
          Length = 1325

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/179 (33%), Positives = 84/179 (46%), Gaps = 20/179 (11%)

Query: 113  AEGGLIDFMN-TRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSG 171
             E G ID  +   L+  + E+E   +  Q+T GV  +H  +  ++HRDIK ENV++ N G
Sbjct: 1154 GETGSIDLFDLIELKTNMTEYEAKLLFKQITSGVKHLH--DNGIVHRDIKDENVIVDNKG 1211

Query: 172  EYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEK-SDIW 230
              KL DFGS   V R P           D+   T   Y APE+++     P + K  DIW
Sbjct: 1212 CVKLIDFGSAAYVKRGP----------FDVFVGTI-DYAAPEVLEGD---PYEGKPQDIW 1257

Query: 231  ALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNI 289
            A+GV LY + Y   PF    E  IL            S+    LI ++L    S+RP +
Sbjct: 1258 AIGVLLYTIIYKENPFYNVDE--ILDGDLRINPSVIVSEECVALITMVLDRSLSKRPTV 1314

>KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar to
           uniprot|P08458 Saccharomyces cerevisiae YDR523C SPS1
           dispensable for mitosis involved in middle/late stage of
           meiosis required for spore wall formation
           serine/threonine kinase homologous to Ste20p expressed
           in middle/late meiosis
          Length = 512

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 94/192 (48%), Gaps = 16/192 (8%)

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIEN 164
           + ++MEFC  G   D +    ++RL E ++  I+ +V  G+  +HS +   +HRDIK  N
Sbjct: 110 MWIVMEFCGGGSCADLLKHLPEHRLSENKVAYIIREVLFGLDYLHSQKK--IHRDIKAAN 167

Query: 165 VLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPID 224
           +L+++ GE KL DFG V G I     +  F           T  + APE+I   +    +
Sbjct: 168 ILLTDDGEVKLGDFG-VSGQIMATLKRTTF---------VGTPYWMAPEII-AKKDNGYN 216

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKAGEAAILHS---RYEYLAYPHYSDNLKNLIRLMLAN 281
           EK+DIW+LG+   +L     P+ K     +L +   R        ++ + ++ I L L  
Sbjct: 217 EKADIWSLGITAIELLTGQPPYAKHDPMKVLVNIPLRKPPKLQGRFTGSARDFIALCLIK 276

Query: 282 QPSQRPNICQVL 293
            P  RP+  ++L
Sbjct: 277 DPDLRPSAAELL 288

>KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1381

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/182 (31%), Positives = 86/182 (47%), Gaps = 20/182 (10%)

Query: 113  AEGGLIDFMN-TRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSG 171
             E G ID  +     + + EFEI  +  QV  GV  +H  +  ++HRDIK EN+++ N G
Sbjct: 1210 GETGSIDLFDLIEFTSNMTEFEIKLLFKQVVSGVKHLH--DQGIVHRDIKDENIIVDNKG 1267

Query: 172  EYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEK-SDIW 230
              K+ DFGS   V   P           D+   T   Y APE++  +   P + K  DIW
Sbjct: 1268 FIKIIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGN---PYEGKPQDIW 1313

Query: 231  ALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNIC 290
            ALG+ LY + +   PF    E  IL    ++    + S +   LI+L+L     +RP I 
Sbjct: 1314 ALGILLYTIVFKENPFYNIDE--ILEGDLKFNDPENISQDCIELIKLILNRNVFKRPTID 1371

Query: 291  QV 292
             +
Sbjct: 1372 DI 1373

>Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W
           (REAL)
          Length = 1073

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/219 (27%), Positives = 94/219 (42%), Gaps = 27/219 (12%)

Query: 72  EVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQE 131
           E+  +  L+   ++  Y  S    + L        ++ME+CA G L   +      ++ E
Sbjct: 69  EIQFLASLKQISNITRYYGSYLKDTSL-------WIIMEYCAGGSLRSLLRP---GKIDE 118

Query: 132 FEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQ 191
             I  IM ++   +  +H     ++HRDIK  NVLI+N G  KLCDFG    V +    +
Sbjct: 119 KYIGVIMRELLVALKCIHKDN--VIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRR 176

Query: 192 QEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKA-- 249
           Q             T  + APE+I     +  D K DIW+LG+  Y++     P+     
Sbjct: 177 QTM---------AGTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEA 225

Query: 250 --GEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQR 286
                 I+ S+   L    YS +LK  I L L   P +R
Sbjct: 226 LRAMQLIIKSKPPRLEGRSYSPSLKEFIALCLDEDPKER 264

>Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON}
           (11581..13467) [1887 nt, 629 aa]
          Length = 628

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 114/233 (48%), Gaps = 37/233 (15%)

Query: 72  EVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQE 131
           E++A+KLL +  ++V   D       L N  Y + +++E+ + G    ++  +   RL+E
Sbjct: 112 EINALKLL-SHPNIVKLEDV------LQNSKY-IGIVLEYASGGEFYKYLQRK--KRLKE 161

Query: 132 FEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQ 191
               +  +Q+  GVA +HS    L+HRD+K+EN+L+       + DFG V  +       
Sbjct: 162 PLACSTFAQLISGVAYIHS--KGLVHRDLKLENLLLDKHSNLVITDFGFVNEI------- 212

Query: 192 QEFNFVQHDILKNTTAQ--YRAPEMIDLSRHLPID-EKSDIWALGVFLYKLCYYTTPFEK 248
                  + ++K       Y APE++  ++  P D  K+DIW+ GV LY +     P++ 
Sbjct: 213 ----STNNKLMKTPCGSPCYAAPELVLSTK--PYDARKADIWSAGVILYAMLAGYLPWDD 266

Query: 249 AGE---AAILHSRYEY-----LAYPHYSDNL-KNLIRLMLANQPSQRPNICQV 292
             E    + +   YEY     L +P Y + L ++LIR +L  QP  R NI QV
Sbjct: 267 DPENPDGSNIMRLYEYITKNNLKFPDYIEPLARDLIRKILVIQPKSRLNIVQV 319

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/222 (28%), Positives = 100/222 (45%), Gaps = 27/222 (12%)

Query: 70  RAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRL 129
           R E+  +  L+   ++  Y  S    + L        ++ME+CA G L   +   +   +
Sbjct: 60  RKEIQFLSSLKQTPNITHYYGSYLIDTKL-------WVIMEYCAGGSLRTLLRPGI---I 109

Query: 130 QEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPT 189
           +E  I  IM ++   + ++H     ++HRDIK  N+LI+N+G  KLCDFG    + +   
Sbjct: 110 EEKYIGVIMREILVALISIHRDN--VIHRDIKAANILIANNGSVKLCDFGVAAQLSQSML 167

Query: 190 SQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPF--E 247
            +Q             T  + APE+I     +  D K DIW+LG+  Y++     P+   
Sbjct: 168 KRQTM---------AGTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCHM 216

Query: 248 KAGEA--AILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRP 287
           +A  A   I  S+   L    YS  LK  I L L   P +RP
Sbjct: 217 EAIRAMQMITKSKPPRLEGREYSQPLKEFIALCLDEDPKERP 258

>TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5.406
           YHR102W
          Length = 1036

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 59/219 (26%), Positives = 99/219 (45%), Gaps = 27/219 (12%)

Query: 72  EVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQE 131
           EV  +  L+ F +++ Y  S    + L        ++M++CA G +   +      ++ E
Sbjct: 92  EVQFLSSLKQFPNIIRYFGSYLKDTNL-------WIIMDYCAGGSIRTLLR---PGKIDE 141

Query: 132 FEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQ 191
             I  IM ++   +  +H  +  ++HRDIK  NVL++N G+ KLCDFG    + +    +
Sbjct: 142 KYIGIIMREILIALQYIH--KDNVIHRDIKAANVLVTNEGKVKLCDFGVAAQLNQTKLRR 199

Query: 192 QEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEK--- 248
           Q             T  + APE+I    +   D K+DIW+LG+  Y++     P+ +   
Sbjct: 200 QTM---------AGTPYWMAPEVIMEGAYY--DTKADIWSLGITAYEIATGNPPYCEIEA 248

Query: 249 -AGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQR 286
                 I  S+   L    YS +LK  I L L   P +R
Sbjct: 249 LRAMQLITKSKPARLEGRSYSTSLKEFIALCLDEDPKER 287

>CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31 or
            uniprot|Q08217 Saccharomyces cerevisiae YOL045w
          Length = 1206

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 87/186 (46%), Gaps = 20/186 (10%)

Query: 113  AEGGLIDFMNT-RLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSG 171
             + G +D  +    ++ + EFE   I  Q+  G+  +H  +  ++HRDIK ENV++ + G
Sbjct: 1035 GQTGSVDLFDIIEFKSNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKG 1092

Query: 172  EYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKS-DIW 230
              KL DFGS   V   P           D+   T   Y APE++  +   P + KS DIW
Sbjct: 1093 FVKLIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGN---PYEGKSQDIW 1138

Query: 231  ALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNIC 290
            A+G+ LY L Y   PF    E  IL     +      S   K LI  +L     +RP I 
Sbjct: 1139 AIGILLYTLIYKENPFYNIDE--ILEGELRFNDSADVSQECKALITKILNRCVRKRPTID 1196

Query: 291  QVLEEV 296
            ++ ++V
Sbjct: 1197 EICQDV 1202

>CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} similar
           to uniprot|P13185 Saccharomyces cerevisiae YDR122w KIN1
           or uniprot|P13186 Saccharomyces cerevisiae YLR096w KIN2
          Length = 944

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 109/214 (50%), Gaps = 25/214 (11%)

Query: 107 LLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGV-AAMHSLEPP-LLHRDIKIEN 164
           +  EF + G L+D++       L+E    N   +V++G+ +A+  L    ++HRD+KIEN
Sbjct: 168 MFFEFISGGQLLDYIIQ--HGSLKE----NHARKVSRGILSALQYLHANNIVHRDLKIEN 221

Query: 165 VLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPID 224
           +++S +GE KL DFG +  +  P  S Q F           +  + APE+  L  H  + 
Sbjct: 222 IMLSKTGEIKLIDFG-LSNMYDPRKSLQTF---------CGSLYFAAPEL--LKAHPYLG 269

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYE--YLAYPHY-SDNLKNLIRLMLAN 281
            + D+W+ GV LY L     PF+    +A LH + +   + YP + S ++ +L+  +L  
Sbjct: 270 PEVDVWSFGVVLYVLVCGKVPFDDENSSA-LHEKIKKGKVTYPQFLSIDVISLLSKILVV 328

Query: 282 QPSQRPNICQVLEEVSRLQGIPCPIKNFYLERAI 315
            P +R  + QV+     L+G   P ++ YL R +
Sbjct: 329 DPQKRATLQQVVNHQWMLKGYDFPPQS-YLPRRV 361

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 79/291 (27%), Positives = 125/291 (42%), Gaps = 60/291 (20%)

Query: 19  VHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKL 78
           V +  ILK +  G + +VY A   P             R +V   +S   P   V  +  
Sbjct: 34  VGNYKILKQVGEGSFGKVYLAIHRPT-----------HRKVVLKSSSKTDPNV-VREVFY 81

Query: 79  LRNFDHVVSYIDSNAAKSGLHNGAYEVLLL-------MEFCAEGGLIDFMNTRLQNRLQE 131
            R FDH   YI             YE+++        +E+C    L D++   +  R+  
Sbjct: 82  HRQFDH--PYI----------TKLYEIIITETKVWMSLEYCPGKELYDYL--LVMRRIPL 127

Query: 132 FEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQ 191
            E   + +Q+   V   HSL    +HRD+K+EN+L+   G  KL DF    G  R   ++
Sbjct: 128 DECSRLFAQIVGAVYYAHSLN--CVHRDLKLENILLDMQGNAKLADF----GFTRECATK 181

Query: 192 QEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGE 251
            +   +        T  Y APE+  L R      K DIW+LGV LY L   + PF++  E
Sbjct: 182 NQLETIC------GTTVYMAPEL--LRRDTYDGFKIDIWSLGVILYTLINGSMPFDEEDE 233

Query: 252 AAILHSRYEYL---AYPHYSDNLKN-----LIRLMLANQPSQRPNICQVLE 294
                +R E+      P Y++ + N     LI+ +L   P +RP++ ++L+
Sbjct: 234 -----TRTEWKIINEEPDYNEKIFNANSIELIKSLLIKDPKKRPSMTEILK 279

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 68/285 (23%), Positives = 128/285 (44%), Gaps = 31/285 (10%)

Query: 27  YLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDHVV 86
           +L  GG+A+ +Q K    DS        + ++ +  + +     +E+   K +++  ++V
Sbjct: 78  FLGEGGFARCFQMK---DDSGKVFAAKTVAKISIKSEKTRKKLLSEIQIHKSMKH-PNIV 133

Query: 87  SYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVA 146
            + D     +        V +L+E C  G L+D +  R Q  L E E+    +Q+   + 
Sbjct: 134 QFTDCFEDDTN-------VYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAIK 184

Query: 147 AMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTT 206
            MHS    ++HRD+K+ N+        K+ DFG     +     ++++           T
Sbjct: 185 YMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFG--LAAVLANDRERKYTIC-------GT 233

Query: 207 AQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEY--LAY 264
             Y APE++   +H     + DIW++GV +Y L     PF+ A E   ++ R +    ++
Sbjct: 234 PNYIAPEVLT-GKHTGHSFEVDIWSIGVMIYALLIGKPPFQ-AKEVNTIYERIKVCDFSF 291

Query: 265 PH---YSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQGIPCPI 306
           P     S   K LI+ +L+  P +RP++ +++E V      P  I
Sbjct: 292 PKDKPISSEAKVLIKDILSLDPLERPSLAEIMEYVWFRNVFPARI 336

>NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141
          Length = 905

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 82/336 (24%), Positives = 141/336 (41%), Gaps = 85/336 (25%)

Query: 14  SLQVGVHHATILKYLTSGGYAQVYQAKISPP----------DSRTGSDIVCLKRLIVPDK 63
           ++ VG     + K +  G +A V++A +  P          DS + ++  C    IVP  
Sbjct: 30  TIYVGSDRYIVDKEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKIVP-- 87

Query: 64  ASLNTPRAEVDAMKLLRNFD------------HVVSYIDSNAAKSGLHNGAYEVLLLMEF 111
                 R+++   KLL N +            H+V  ID           + +  L+ME+
Sbjct: 88  ------RSKLKNKKLLENLEIEIAILKKISHPHIVKLID-------FERTSKDFYLIMEY 134

Query: 112 CAEGGLIDFMNTRLQ----------------------NRLQEFEILNIMSQVTQGVAAMH 149
           C+ G L   +  R Q                      N L +  ILN + Q++  +  + 
Sbjct: 135 CSLGDLTFLIKKRQQLIKNHPLLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLR 194

Query: 150 SLEPPLLHRDIKIENVLIS----NSGEYK-LCDFGSVCGVIRPPTSQQEFNFVQHDILKN 204
           S    L+HRDIK +N+L+S    N  + K   D G V     P     +F F +   L N
Sbjct: 195 SKN--LVHRDIKPQNLLLSAPLINYNDPKSFHDLGFVGIYNLPILKIADFGFAR--FLPN 250

Query: 205 TTAQ--------YRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAI-- 254
           T+          Y APE+++  ++   + K+D+W++G  LY++CY   PF+ +    +  
Sbjct: 251 TSMAETLCGSPLYMAPEILNYQKY---NAKADLWSVGTVLYEMCYGNPPFKASNHLELYK 307

Query: 255 -LHSRYEYLAYPHY---SDNLKNLIRLMLANQPSQR 286
            +    + + +P Y    +NLK+LI  +L   P +R
Sbjct: 308 KIKKANDLIYFPTYIEIDNNLKSLISKLLTFDPQER 343

>SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1062

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 74/307 (24%), Positives = 134/307 (43%), Gaps = 43/307 (14%)

Query: 27  YLTSGGYAQVYQAKISPPDSRTGSDIVCLK------RLIVPDKASLNTPRAEVDAMKLLR 80
           +L + G   + + K++    R  S+I  +K      +  V  +  +  P++E +A++  R
Sbjct: 81  FLETVGAGSMGKVKLA--RHRYTSEICAIKIVNRAAKSFVHKQQQMTPPKSEQEALERKR 138

Query: 81  NFDHVVSYIDSNAAKSGLHNGAYE---------------VLLLMEFCAEGGLIDFMNTRL 125
             +  +S       ++ L    Y                  +L E+ + G L+D++    
Sbjct: 139 KLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYIIQ-- 196

Query: 126 QNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVI 185
              L+E         +   +  +H     ++HRD+KIEN++IS SGE K+ DFG +  + 
Sbjct: 197 HGSLRERHARKFARGIASALQYLHMNN--IVHRDLKIENIMISTSGEIKIIDFG-LSNMY 253

Query: 186 RPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTP 245
            P   +Q   F         +  + APE+  L  H  I  + D+W+ GV LY L     P
Sbjct: 254 DP--KKQLHTFC-------GSLYFAAPEL--LKAHPYIGPEVDVWSFGVVLYVLVCGKVP 302

Query: 246 FEKAGEAAILHSRYEY--LAYP-HYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQGI 302
           F+    A++LH + +   + YP H S  + +L+  ML   PS+R  + QV+      +G 
Sbjct: 303 FDDEN-ASVLHEKIKQGKVEYPQHLSIEVISLLSKMLVVDPSKRATLKQVVSHQWMQRGY 361

Query: 303 PCPIKNF 309
             P  ++
Sbjct: 362 DFPAPSY 368

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 100/197 (50%), Gaps = 25/197 (12%)

Query: 104 EVLLLMEFCAEGGLIDFMNTRLQ-NRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKI 162
           +V + +E+C    L D +   LQ  R+   E + + SQ+   V   HSL    +HRD+K+
Sbjct: 111 KVWMALEYCPGRELYDHV---LQMKRIPAEECIQLFSQIVGAVYYAHSLN--CVHRDLKL 165

Query: 163 ENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLP 222
           EN+L+   G  KL DFG          +++    V  + +  TT  Y APE   L+   P
Sbjct: 166 ENILLDKDGNAKLTDFG---------FTRECMEKVNLETICGTTV-YMAPE---LTERKP 212

Query: 223 IDE-KSDIWALGVFLYKLCYYTTPFEKAGEA----AILHSRYEYLAYPHYSDNLKNLIRL 277
            D  K DIW+LGV LY +   + PF++  EA     I++   EY +    ++  ++L+R 
Sbjct: 213 YDGFKIDIWSLGVILYTMLSGSMPFDEDDEAKTKWKIINEEPEYNSKFMTAEG-EDLVRK 271

Query: 278 MLANQPSQRPNICQVLE 294
           +L    + RP++ ++L+
Sbjct: 272 LLQKDSNLRPSVREILQ 288

>ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {ON}
           weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 943

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 83/186 (44%), Gaps = 20/186 (10%)

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIEN 164
           + +++E+CA G L   +      ++ E  I  IM +V   +  +H     ++HRDIK  N
Sbjct: 101 LWIIIEYCAGGSLRTLLR---PGKIDEKYIGIIMREVLIALKYIHKDN--VIHRDIKAAN 155

Query: 165 VLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPID 224
           VLI+N G  KLCDFG    + +    +Q             T  + APE+I     +  D
Sbjct: 156 VLITNEGHVKLCDFGVAAQLNQSSLKRQTM---------AGTPYWMAPEVI--MEGVSYD 204

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKA----GEAAILHSRYEYLAYPHYSDNLKNLIRLMLA 280
            K DIW+LG+  Y++     P+           I  S+   L   HYS  LK  I L L 
Sbjct: 205 TKVDIWSLGITTYEIATGNPPYCDVEALRAMQLITKSKPPRLEGRHYSPMLKEFIALCLD 264

Query: 281 NQPSQR 286
             P +R
Sbjct: 265 EDPKER 270

>YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}
           CDC15Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase;
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p; required for spindle
           disassembly after meiosis II
          Length = 974

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 72/272 (26%), Positives = 119/272 (43%), Gaps = 41/272 (15%)

Query: 31  GGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDH--VVSY 88
           G Y  VY+A      ++    +V +K ++  +   LN   AE+    LL+N +H  +V Y
Sbjct: 34  GSYGVVYKAI-----NKHTDQVVAIKEVVYENDEELNDIMAEI---SLLKNLNHNNIVKY 85

Query: 89  IDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAM 148
                   G    +YE+ +L+E+CA G L   + +R    L E E    ++Q   G+  +
Sbjct: 86  -------HGFIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKTYVTQTLLGLKYL 137

Query: 149 HSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPP--TSQQEFNFVQHDILKNTT 206
           H     ++HRDIK  N+L+S     KL DFG V  ++     T     N++  +IL N  
Sbjct: 138 HG--EGVIHRDIKAANILLSADNTVKLADFG-VSTIVNSSALTLAGTLNWMAPEILGNRG 194

Query: 207 AQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYP- 265
           A                   SDIW+LG  + ++     P+    +A I ++      YP 
Sbjct: 195 AS----------------TLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPP 238

Query: 266 -HYSDNLKNLIRLMLANQPSQRPNICQVLEEV 296
             +S+ LK+ +         +RP   Q+L+ V
Sbjct: 239 SSFSEPLKDFLSKCFVKNMYKRPTADQLLKHV 270

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 94/194 (48%), Gaps = 20/194 (10%)

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIEN 164
           + ++ME+CA G L   +      ++ E  I  IM ++   +  +H  +  ++HRDIK  N
Sbjct: 88  LWIIMEYCAGGSLRSLLRP---GKIDEKYIGVIMRELLVALKVIH--KDNVIHRDIKAAN 142

Query: 165 VLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPID 224
           VLI+N G+ KLCDFG    + +    +Q             T  + APE+I     +  D
Sbjct: 143 VLITNEGQVKLCDFGVAAQLNQTSLRRQTM---------AGTPYWMAPEVI--MEGVYYD 191

Query: 225 EKSDIWALGVFLYKLCYYTTPF--EKAGEAA--ILHSRYEYLAYPHYSDNLKNLIRLMLA 280
            K DIW+LG+  Y++     P+   +A  A   I+ S+   L   +Y+  LK  I L L 
Sbjct: 192 TKVDIWSLGITAYEIATGNPPYCDVEALRAMQLIIKSKPPRLEERNYTPQLKEFIALCLD 251

Query: 281 NQPSQRPNICQVLE 294
             P +R +  ++L+
Sbjct: 252 EDPQERLSAEELLK 265

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score = 77.4 bits (189), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 68/285 (23%), Positives = 127/285 (44%), Gaps = 31/285 (10%)

Query: 27  YLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDHVV 86
           +L  GG+A+ +Q K    DS        + ++ +  + +     +E+   K +R+  ++V
Sbjct: 78  FLGEGGFARCFQMK---DDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMRH-PNIV 133

Query: 87  SYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVA 146
            + D     +        V +L+E C  G L+D +  R Q  L E E+    +Q+   + 
Sbjct: 134 QFTDCFEDDTN-------VYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAIK 184

Query: 147 AMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTT 206
            MHS    ++HRD+K+ N+        K+ DFG     +     ++++           T
Sbjct: 185 YMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFG--LAAVLANDRERKYTIC-------GT 233

Query: 207 AQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEY--LAY 264
             Y APE++   +H     + D+W++GV +Y L     PF+ A E   ++ R +     +
Sbjct: 234 PNYIAPEVLT-GKHTGHSFEVDVWSIGVMIYALLIGKPPFQ-AKEVNTIYERIKVCDFNF 291

Query: 265 PH---YSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQGIPCPI 306
           P     S   K LI+ +L+  P +RP++ +++E V      P  I
Sbjct: 292 PRDKPISSEAKVLIKDILSLDPLERPSLTEIMEYVWFRNVFPMRI 336

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 55/186 (29%), Positives = 85/186 (45%), Gaps = 20/186 (10%)

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIEN 164
           + ++ME+CA G L   +   +   + E  I  IM ++   +  +H  +  ++HRDIK  N
Sbjct: 116 LWIIMEYCAGGSLRTLLRPGM---IDEKYIGVIMRELLTALQCIH--KDNVIHRDIKAAN 170

Query: 165 VLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPID 224
           VLI+N G+ KLCDFG    + +    +Q             T  + APE+I     +  D
Sbjct: 171 VLITNEGKVKLCDFGVAAQLNQTSLRRQTM---------AGTPYWMAPEVI--MEGVYYD 219

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKA----GEAAILHSRYEYLAYPHYSDNLKNLIRLMLA 280
            K DIW+LG+  Y++     P+ +         I  S+   L    YS  LK  I L L 
Sbjct: 220 TKVDIWSLGITAYEIATGNPPYCEIEALRAMQLITKSKPARLEGRQYSSGLKEFIALCLD 279

Query: 281 NQPSQR 286
             P +R
Sbjct: 280 EDPKER 285

>NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24
          Length = 535

 Score = 77.0 bits (188), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 75/284 (26%), Positives = 133/284 (46%), Gaps = 40/284 (14%)

Query: 20  HHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLL 79
           H+  + + +  G +  VY+A       RT + +V +K   V D  + N  R EV A ++ 
Sbjct: 20  HNYIVKECVGRGNFGDVYRA-----IDRTTNKVVAIK---VVDLENTNE-RLEVLAQEIF 70

Query: 80  RNFD----HVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEIL 135
              +    ++++YI +    + +        ++ME+C  G   D +     N L E ++ 
Sbjct: 71  FLAELKSPYIINYITTLLEDASM-------WIVMEYCGGGSCSDLLKYYFNNGLPEKKVA 123

Query: 136 NIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFN 195
            I  ++ +G+  +H  E   +HRDIK  N+L++  G  KL DFG V G ++  ++ +   
Sbjct: 124 YITREILKGLQYLH--EQKKIHRDIKAANILLTEEGHVKLGDFG-VSGQLK--STLRRGT 178

Query: 196 FVQHDILKNTTAQYRAPEMIDLSRHLP-IDEKSDIWALGVFLYKLCYYTTPFEKAGEAAI 254
            V        T  + APE+   S+++   DEK DIW+LG+ +++L     P  K     +
Sbjct: 179 IV-------GTPYWMAPEVA--SQNIEGYDEKIDIWSLGITVFELLKGVPPLVKLDPIRV 229

Query: 255 LHSRYEYLAYPH----YSDNLKNLIRLMLANQPSQRPNICQVLE 294
           L +     A P     YSD  K+ + L L   P++RP    +L+
Sbjct: 230 LANLSRKSA-PRLQGAYSDAAKSFVALCLIKNPNERPAAVDLLK 272

>Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON}
            (57057..60950) [3894 nt, 1298 aa]
          Length = 1297

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 84/181 (46%), Gaps = 18/181 (9%)

Query: 113  AEGGLIDFMN-TRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSG 171
             E G ID  +    +  + E E   I  QV   +  +H  +  ++HRDIK ENV++ + G
Sbjct: 1126 GETGCIDLFDLIEFKTNMSEVETKLIFMQVVSSIKFLH--DQGIVHRDIKDENVIVDSQG 1183

Query: 172  EYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWA 231
              KL DFGS   V   P           D+   T   Y APE+  L     + +  DIWA
Sbjct: 1184 FIKLIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEV--LGGEPYVGKPQDIWA 1230

Query: 232  LGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQ 291
            +G+ LY + +   PF    E  IL +  ++       ++  +LI+ +L   P++RP I +
Sbjct: 1231 IGILLYTIIFKENPFYNIDE--ILEAELKFNTSTGACEDCVDLIKRILTRNPTKRPTIDE 1288

Query: 292  V 292
            +
Sbjct: 1289 I 1289

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 67/277 (24%), Positives = 123/277 (44%), Gaps = 35/277 (12%)

Query: 27  YLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDH-- 84
           +L  GG+A+ +Q K    D +    +   K +      S  T R  +  +++ ++  H  
Sbjct: 95  FLGEGGFARCFQMK----DDK--GKVFAAKTVAKLSIKSEKTRRKLLSEIQIHKSMKHPN 148

Query: 85  VVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQG 144
           +V + D     +        V +L+E C  G +++ +  R    L E E+   M Q+   
Sbjct: 149 IVQFTDCFEDDTN-------VYILLEICPNGSVMELLRQR--KHLTEPEVRFCMIQIIGA 199

Query: 145 VAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKN 204
           +  MHS    ++HRD+K+ N+        K+ DFG     +     ++++          
Sbjct: 200 IRYMHSRR--VIHRDLKLGNIFFDKEYNLKIGDFG--LAAVLANDKERKYTIC------- 248

Query: 205 TTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSR-----Y 259
            T  Y APE++   +H     + DIW++GV LY L +   PF+ A E   ++ R     +
Sbjct: 249 GTPNYIAPEVLT-GKHTGHSYEVDIWSIGVMLYALLFGKPPFQ-AKEVETIYERIKCRDF 306

Query: 260 EYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEV 296
            + A    S + KNLI  +L   P+ RP++ ++ + V
Sbjct: 307 IFPADKPVSSDAKNLISHLLQLNPAARPSLYEITDNV 343

>YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Protein
           kinase of the PAK/Ste20 family, required for cell
           integrity; physically interacts with Cdc31p (centrin),
           which is a component of the spindle pole body; part of
           the RAM network that regulates cellular polarity and
           morphogenesis
          Length = 1080

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 61/219 (27%), Positives = 93/219 (42%), Gaps = 27/219 (12%)

Query: 72  EVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQE 131
           E+  +  L+   ++  Y  S    + L        ++ME CA G L   +      ++ E
Sbjct: 69  EIQFLASLKQISNITRYYGSYLKDTSL-------WIIMEHCAGGSLRSLLR---PGKIDE 118

Query: 132 FEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQ 191
             I  IM ++   +  +H     ++HRDIK  NVLI+N G  KLCDFG    V +    +
Sbjct: 119 KYIGVIMRELLVALKCIHKDN--VIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRR 176

Query: 192 QEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKA-- 249
           Q             T  + APE+I    +   D K DIW+LG+  Y++     P+     
Sbjct: 177 QTM---------AGTPYWMAPEVIMEGVYY--DTKVDIWSLGITTYEIATGNPPYCDVEA 225

Query: 250 --GEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQR 286
                 I+ S+   L    YS +LK  I L L   P +R
Sbjct: 226 LRAMQLIIKSKPPRLEDRSYSTSLKEFIALCLDEDPKER 264

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 111/221 (50%), Gaps = 32/221 (14%)

Query: 98  LHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLH 157
           L N  Y + +++E+ + G    ++  +   RL+E     + +Q+  GV  MHS    L+H
Sbjct: 117 LQNSKY-IGIVLEYASGGEFYRYIQKK--RRLKEHAACRLFAQLISGVHYMHSKG--LVH 171

Query: 158 RDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQ--YRAPEMI 215
           RD+K+EN+L+  +    + DFG V           EFN  +++++K +     Y APE++
Sbjct: 172 RDLKLENLLLDKNENLLITDFGFV----------NEFNH-KNELMKTSCGSPCYAAPELV 220

Query: 216 DLSRHLPID-EKSDIWALGVFLYKLCYYTTPFEKAG---EAAILHSRYEY-----LAYPH 266
             ++  P +  K+DIW+ GV +Y +     P++      E   +   Y Y     L +P 
Sbjct: 221 VTTK--PYEARKADIWSCGVIMYAMLAGYLPWDDDSENPEGDDIAKLYHYITKTPLKFPE 278

Query: 267 YSDNL-KNLIRLMLANQPSQRPNICQVLEEVSRLQGIPCPI 306
           Y + + ++L+R +L + P +R N+ QV E+   LQ   CP 
Sbjct: 279 YINPVPRDLLRRILVSNPKKRLNLRQV-EQHQWLQPH-CPF 317

>YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One of
            two (see also PSK1) PAS domain containing S/T protein
            kinases; regulates sugar flux and translation in response
            to an unknown metabolite by phosphorylating Ugp1p and
            Gsy2p (sugar flux) and Caf20p, Tif11p and Sro9p
            (translation)
          Length = 1101

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 85/184 (46%), Gaps = 18/184 (9%)

Query: 113  AEGGLIDFMNT-RLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSG 171
             E G ID  +    +  + E E   +  QV   +  +H  +  ++HRDIK ENV++ + G
Sbjct: 930  GETGSIDLFDVIEFKKDMVEHEAKLVFKQVVASIKHLH--DQGIVHRDIKDENVIVDSHG 987

Query: 172  EYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWA 231
              KL DFGS   +   P           D+    T  Y APE++  S +    +  DIWA
Sbjct: 988  FVKLIDFGSAAYIKSGP----------FDVFVG-TMDYAAPEVLGGSSYK--GKPQDIWA 1034

Query: 232  LGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQ 291
            LGV LY + Y   P+    E  IL     +    H S+   +LI+ +L  +  +RP I +
Sbjct: 1035 LGVLLYTIIYKENPYYNIDE--ILEGELRFDKSEHVSEECISLIKRILTREVDKRPTIDE 1092

Query: 292  VLEE 295
            + E+
Sbjct: 1093 IYED 1096

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 61/214 (28%), Positives = 98/214 (45%), Gaps = 28/214 (13%)

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIEN 164
           V + +E+C    L D++   L+ R+   E   + +Q+   V   HSL+   +HRD+K+EN
Sbjct: 103 VWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAHSLQ--CVHRDLKLEN 158

Query: 165 VLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPID 224
           +L+  +G   L DF    G  R   ++ +   V        T  Y APE+I   R     
Sbjct: 159 ILLDKNGYAMLTDF----GFTRECATKTQLETV------CGTTVYMAPELI--KREAYDG 206

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKAGEA----AILHSRYEYLAYPHYSDNLKNLIRLMLA 280
            K D W+LG+ LY + +   PF++         I+H     L   + S   K+LI  +L 
Sbjct: 207 YKVDTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEEPAVLD-EYTSPQAKDLIVRLLD 265

Query: 281 NQPSQRPNICQVLEE-------VSRLQGIPCPIK 307
              +QRPN+ +VL+           L+ + C IK
Sbjct: 266 KNAAQRPNLNEVLQHPFLQPYGALLLETVECLIK 299

>TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1315

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 60/211 (28%), Positives = 105/211 (49%), Gaps = 22/211 (10%)

Query: 107 LLMEFCAEGGLIDFMNTRLQN-RLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENV 165
           +L E+ + G L+D++   +Q+  L+E         +   +  +HS    ++HRD+KIEN+
Sbjct: 284 MLFEYVSGGQLLDYI---IQHGSLREHHARKFARGIASALQYLHSNN--IVHRDLKIENI 338

Query: 166 LISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDE 225
           +IS SGE K+ DFG +  +    T++Q   F         +  + APE+  L  H     
Sbjct: 339 MISTSGEIKIIDFG-LSNLYD--TTRQLHTFC-------GSLYFAAPEL--LKAHPYTGP 386

Query: 226 KSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEY--LAYP-HYSDNLKNLIRLMLANQ 282
           + D+W+ GV LY L     PF+    +++LH + +   + YP H S  + +L+  ML   
Sbjct: 387 EVDVWSFGVVLYVLVCGKVPFDDEN-SSVLHEKIKQGKVDYPQHLSIEVISLLSKMLVVD 445

Query: 283 PSQRPNICQVLEEVSRLQGIPCPIKNFYLER 313
           P +R  + QV+E    ++G   P  ++   R
Sbjct: 446 PKKRATLRQVVEHHWMVRGYDNPSSSYLPNR 476

>Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}
           similar to Ashbya gossypii AFL143C
          Length = 363

 Score = 75.5 bits (184), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 78/346 (22%), Positives = 138/346 (39%), Gaps = 65/346 (18%)

Query: 12  GISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRA 71
           G+ + +      +   L  G    +YQ K  P  S +G  +  LK++  P   +    RA
Sbjct: 21  GVRISINGKSYLVTTLLREGELTALYQVK-CPKRSHSGG-VYALKKVTCPIGRADFVTRA 78

Query: 72  EVDAMKLLR-NFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRL--QNR 128
             +     R N  ++ + +D   A+    NG   + +L+ +   G L D +N  +   + 
Sbjct: 79  MTEISNYQRFNSPYITNILDFQVAQHD--NGTKIIYMLLPYFPAGSLQDLINNMIIRGDS 136

Query: 129 LQEFEILNIMSQVTQGVAAMHS-------------------------------------L 151
           L E  ++ +M  + +GV  MH                                      L
Sbjct: 137 LSESRVVRLMLDICRGVRCMHEPSESDFRDPYDVAYFDAASLRYSDETHLLVDAMELDLL 196

Query: 152 EPPL--------LHRDIKIENVLISNSGEYKLCDFGSVCGVIRPP---TSQQEFNFVQHD 200
            PPL        +H  +  EN+++S+ G   + +  S    +R P   TS  +   +Q  
Sbjct: 197 SPPLTNSEPSAYVHCGLNPENIMLSSEGLPVIYNMASC---VRAPLELTSNSKLLGLQEW 253

Query: 201 ILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAA---ILHS 257
           + +N+   Y  PE++DL  +  I  + DIW+LG   Y L Y  + F +  +     I HS
Sbjct: 254 LNENSCLPYTCPELLDLHPNTSITNRCDIWSLGCICYALMYSISSFAREQQLCGTPIKHS 313

Query: 258 ----RYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRL 299
                + +   P YS +LK +++  L   P +RP+I + L +   L
Sbjct: 314 ISTGNFSFPDEPRYSQSLKRIVQRCLVIDPHKRPDIYETLAQFQEL 359

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 77.4 bits (189), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 60/203 (29%), Positives = 94/203 (46%), Gaps = 33/203 (16%)

Query: 105  VLLLMEFCAE-------------GGLIDFMN-TRLQNRLQEFEILNIMSQVTQGVAAMHS 150
            +L+L++F  +              G ID  +   ++  + E E + I  Q+  G+  +H 
Sbjct: 1021 ILMLLDFFEDDDYYYIETAVHGTSGSIDLFDLIEMKTDMTEHEAMLIFKQIASGIKNLH- 1079

Query: 151  LEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYR 210
             +  ++HRDIK ENV++  +G  K+ DFGS   V   P           D+   T   Y 
Sbjct: 1080 -DNGIVHRDIKDENVIVDCNGFVKIVDFGSAAYVKSGP----------FDVFVGTI-DYA 1127

Query: 211  APEMIDLSRHLPIDEK-SDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSD 269
            APE++      P + K  DIWA+GV LY + Y   PF    E  IL +     +    SD
Sbjct: 1128 APEVLGGE---PYEGKPQDIWAIGVLLYTIIYKENPFYNIDE--ILDADLRVNSSERISD 1182

Query: 270  NLKNLIRLMLANQPSQRPNICQV 292
            +   LIR +L    S+RP+I ++
Sbjct: 1183 DCIALIRKILNRSVSKRPSIDEI 1205

>NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {ON}
           Anc_8.654
          Length = 729

 Score = 77.0 bits (188), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 114/234 (48%), Gaps = 35/234 (14%)

Query: 72  EVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQE 131
           E++A+KLL + + V         +  L N  Y + +++EF + G    ++  + + RL+E
Sbjct: 103 EINALKLLTHPNIV-------RLEEVLQNSKY-IGIVLEFASGGEFYKYL--QRKRRLKE 152

Query: 132 FEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQ 191
                + +Q+  GV  MHS    L+HRD+K+EN+L+  +    + DFG V          
Sbjct: 153 PHACQLFAQLISGVTYMHS--KGLVHRDLKLENLLLDKNENLIITDFGFV---------- 200

Query: 192 QEFNFVQHDILKNTTAQ--YRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKA 249
            EF F  ++++K +     Y APE++ LS       K DIW+ G+ LY +     P++  
Sbjct: 201 NEF-FGSNELMKRSCGSPCYAAPELV-LSTEPYRARKVDIWSCGIILYAMLAGYLPWDDD 258

Query: 250 GE---AAILHSRYEY-----LAYPHYSDNL-KNLIRLMLANQPSQRPNICQVLE 294
            +      +   Y+Y     L +P Y   L ++LIR +L   PS+R +I  + +
Sbjct: 259 SQNPNGDDIGKLYQYITKTALKFPAYISPLARDLIRKILTANPSRRISISYICK 312

>CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} similar
           to uniprot|Q12236 Saccharomyces cerevisiae YOL100w PKH2
          Length = 1076

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 64/283 (22%), Positives = 124/283 (43%), Gaps = 22/283 (7%)

Query: 15  LQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVD 74
           ++ G+      + +  G Y+ V  A  +  DS     +  L +  +  +  +     E +
Sbjct: 175 IRKGIKDFKFGEMVGDGAYSTVMLA--TAKDSGKKYAVKVLNKEYLIKQKKVKYVNIEKN 232

Query: 75  AMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEI 134
           A++ L N   +V    +   +S L+        L+E+   G  +  M  +    L E   
Sbjct: 233 ALQRLNNSRGIVKLFFTFQDESSLY-------FLLEYAPNGDFLSVM--KKYGSLSEDCT 283

Query: 135 LNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQ-- 192
               +Q+  G+  +HS    ++HRDIK EN+L+    + K+ DFG+   ++ P    +  
Sbjct: 284 RYYSAQIIDGIKYLHS--KGIIHRDIKPENILLDKDMKVKITDFGT-AKILEPKNEDEDN 340

Query: 193 -EFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGE 251
            EFN +        TA+Y +PE+++ S    +D + DIWA G  ++++     PF+   E
Sbjct: 341 PEFNLLTRSKSFVGTAEYVSPELLNDSY---VDARCDIWAFGCMVFQMIAGKPPFKATNE 397

Query: 252 AAILHS--RYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQV 292
                   + +Y     +   +++L++ +L   P QR  I Q+
Sbjct: 398 YLTFQKVMKVQYAFTAGFPVVVRDLVKRILLKVPEQRLTIPQI 440

>TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1367

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 87/184 (47%), Gaps = 18/184 (9%)

Query: 113  AEGGLIDFMN-TRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSG 171
             E G ID  +    ++ + E E   I  QV  G+  +H  +  ++HRD+K ENV++   G
Sbjct: 1196 GETGCIDLFDLIEFKSNMTESEARLIFIQVVLGIKHLH--DSNIVHRDVKDENVIVDAKG 1253

Query: 172  EYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWA 231
              KL DFGS   V   P           D+   T   Y APE+  LS    + +  DIWA
Sbjct: 1254 FVKLIDFGSAAYVNSGP----------FDVFVGTI-DYAAPEV--LSGEPYLGKPQDIWA 1300

Query: 232  LGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQ 291
            +G+ LY + +   PF    E  IL +  +       S +  +LI+ +L   P++RP I +
Sbjct: 1301 IGILLYTIMFKENPFYNIDE--ILEAELKINNTSDASQDCIDLIKRILTKNPNKRPTIDE 1358

Query: 292  VLEE 295
            ++ +
Sbjct: 1359 IVND 1362

>TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1.271
            YJL095W
          Length = 1434

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 64/262 (24%), Positives = 117/262 (44%), Gaps = 36/262 (13%)

Query: 48   TGSDIVCLKRLIVPDKAS-----LNTPRAEVDAMKLLRNFDH--VVSYIDSNAAKSGLHN 100
            T  +++ +K++ VP   S     LNT  A    +  L++ DH  +V Y+       G   
Sbjct: 1156 TTGEMMAVKQIEVPSYGSQSETMLNTVEAMKSEVSTLKDLDHLNIVQYL-------GFEM 1208

Query: 101  GAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDI 160
                  L +E+ A G +   +  R+  R  +  I ++ +QV +G++ +HS    +LHRD+
Sbjct: 1209 KHNIYSLFLEYVAGGSVGSLI--RMYGRFDDKLIRHLTNQVLEGLSYLHSQG--ILHRDM 1264

Query: 161  KIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRH 220
            K +N+L+   G  K+ DFG         + + E  +   ++    T  + APEM+D  + 
Sbjct: 1265 KADNLLLDQDGICKISDFGI--------SKKSEDIYSNSEMTMRGTVFWMAPEMVDTKQG 1316

Query: 221  LPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLA 280
               + K DIW+LG  + ++     P+        ++   +  + P   ++ K+LI     
Sbjct: 1317 Y--NAKVDIWSLGCVVLEMFAGKRPWSNFEVVTAMYKIGQSKSAPPIPEDTKDLISPTAK 1374

Query: 281  N--------QPSQRPNICQVLE 294
            N         P +RP   Q+LE
Sbjct: 1375 NFLNQCFHIDPKERPTAGQLLE 1396

>KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON}
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase
          Length = 1338

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 65/253 (25%), Positives = 117/253 (46%), Gaps = 35/253 (13%)

Query: 31   GGYAQVYQAKISPPDSRTGSDIVCLKRLIVP-----DKASLNTPRAEVDAMKLLRNFDHV 85
            G +  VY A      + T  +++ +K++ VP     D+++++   A    +  L++ +HV
Sbjct: 1047 GSFGAVYLAL-----NVTTGEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKDLNHV 1101

Query: 86   --VSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQ 143
              V Y+          NG Y   L +E+ A G +   +  R+  R  +  I ++  QV +
Sbjct: 1102 NIVQYLGFEE-----KNGIYS--LFLEYVAGGSVGSLI--RMYGRFDDQLIRHLTKQVLE 1152

Query: 144  GVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFN-FVQHDIL 202
            G+A +HS    +LHRD+K +N+L+ N G  K+ DFG          S++  N +   D+ 
Sbjct: 1153 GLAYLHSKG--ILHRDMKADNLLLDNDGVCKISDFG---------ISRKSNNIYSNSDMT 1201

Query: 203  KNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYL 262
               T  + APEM+D +       K DIW+LG  + ++     P+      A +    +  
Sbjct: 1202 MRGTVFWMAPEMVDTAHGY--SAKVDIWSLGCVVLEMFAGKRPWSNFEVVAAMFQIGKSK 1259

Query: 263  AYPHYSDNLKNLI 275
              P   D+ K+L+
Sbjct: 1260 TAPPIPDDTKDLV 1272

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 67/284 (23%), Positives = 132/284 (46%), Gaps = 32/284 (11%)

Query: 27  YLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDHVV 86
           +L  GG+A+ +Q +    DS        + +L +  + +     +E+   K +++  ++V
Sbjct: 150 FLGEGGFARCFQIR---DDSGKLFAAKTVAKLSIKTEKTRKKLLSEIQIHKSMKH-QNIV 205

Query: 87  SYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVA 146
            +ID     +        V +L+E C  G L++ +  R Q  L E E+    +Q+   + 
Sbjct: 206 QFIDCFEDDTN-------VYILLEICPNGSLMELLKKRKQ--LTEPEVRFFTTQICGAIK 256

Query: 147 AMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTT 206
            MHS    ++HRD+K+ N+    +   K+ DFG     +     +++F           T
Sbjct: 257 YMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFG--LAAVLANDRERKFTVC-------GT 305

Query: 207 AQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEY--LAY 264
             Y APE++ + +H     + D+W++GV +Y L     PF+ A +   ++ R +     +
Sbjct: 306 PNYIAPEVL-MGKHSGHSYEVDVWSIGVMVYALLVGKPPFQ-AKDVNTIYERIKCCDFIF 363

Query: 265 PH---YSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQGIPCP 305
           P     S   K L++ +L+  P +RP+I ++++ V   +GI  P
Sbjct: 364 PKEKPISHEAKVLVQDLLSLDPLERPSISEIMDYVW-FRGIFPP 406

>KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar to
           uniprot|P08458 Saccharomyces cerevisiae YDR523C SPS1
           dispensable for mitosis involved in middle/late stage of
           meiosis required for spore wall formation
           serine/threonine kinase homologous to Ste20p expressed
           in middle/late meiosis
          Length = 483

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 96/209 (45%), Gaps = 28/209 (13%)

Query: 97  GLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLL 156
           G   G   + ++ME+C+ G L++ +  R  +RL E     I+ QV   +  +H  E  L+
Sbjct: 81  GTFTGDCNLYIVMEYCSNGSLLNLL--RYYSRLTEQTTCFIILQVCHALEYLH--EKRLI 136

Query: 157 HRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNT-----TAQYRA 211
           HRD+K  N+L+++ GE +L D G         T Q +FN  +H   KN      T  + A
Sbjct: 137 HRDLKAANILLNDDGEVRLADLGV--------TGQLKFNSTRHGG-KNLNTFVGTPFWMA 187

Query: 212 PEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNL 271
           PE+I   ++   D K DIW+LG+   +L     P         L  R   L       N+
Sbjct: 188 PEII---KNQSYDGKCDIWSLGITTLELLNGKPPMSHLDSMKALM-RIPKLNADSILRNM 243

Query: 272 ------KNLIRLMLANQPSQRPNICQVLE 294
                 K+ IR  L   P+QRP   Q+L+
Sbjct: 244 DISPLGKDFIRSCLQQDPNQRPTCKQLLQ 272

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 65/275 (23%), Positives = 126/275 (45%), Gaps = 31/275 (11%)

Query: 27  YLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDHVV 86
           +L  GG+A+ +Q      DS        + +L +  + +     +E+   K ++N + +V
Sbjct: 88  FLGEGGFARCFQFN---DDSGKIFAAKTVAKLSIKSEKTRRKLLSEIQIHKSMKNVN-IV 143

Query: 87  SYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVA 146
            +ID     +        V +L+E C  G L+D +  R    L E E+    +Q+   + 
Sbjct: 144 QFIDCFEDDTN-------VYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 194

Query: 147 AMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTT 206
            MHS    ++HRD+K+ N+        K+ DFG     +     ++++           T
Sbjct: 195 YMHSRR--VIHRDLKLGNIFFDKDYNLKIGDFG--LAAVLANDRERKYTVC-------GT 243

Query: 207 AQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEY--LAY 264
             Y APE++ + +H     + DIW++GV LY L     PF+ + +   ++ R +     +
Sbjct: 244 PNYIAPEVL-MGKHTGHSYEVDIWSIGVMLYALLIGKPPFQ-SKDVNTIYERIKCCDFTF 301

Query: 265 P---HYSDNLKNLIRLMLANQPSQRPNICQVLEEV 296
           P   + S   K LI+ +L+  P +RP++ ++++ V
Sbjct: 302 PKDKYISPEAKILIQDLLSLDPLERPSVDEIIDYV 336

>CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {ON}
           similar to uniprot|Q12236 Saccharomyces cerevisiae
           YOL100w PKH2
          Length = 965

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 64/284 (22%), Positives = 127/284 (44%), Gaps = 19/284 (6%)

Query: 15  LQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVD 74
           ++ G+        L  G Y+QV+ A      S+T +  V  K  ++  K  +     E  
Sbjct: 111 IRKGIKDFKFGDMLGDGSYSQVFLATSKTDSSKTYAVKVLNKEYLIKQKK-VKYVNIEKT 169

Query: 75  AMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEI 134
           A++ L++   V++   +   ++ L+        L+E+   G  +  +  +    L E   
Sbjct: 170 ALQNLKSVTGVINLSFTFQDEANLY-------FLLEYAPNGDFLSLI--KKFGTLNEECT 220

Query: 135 LNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRP--PTSQQ 192
           +   +Q+   + +MHS    ++HRDIK EN+L+  + + KL DFG+   + +      + 
Sbjct: 221 IYYSAQIIDAIGSMHSHG--IIHRDIKPENILLDGNMKIKLTDFGTAKLLQKKSDKNGKP 278

Query: 193 EFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEA 252
            +N +        TA+Y +PE++  +     D K DIWA G  +Y++     PF+   E 
Sbjct: 279 HYNLLTRSSSFVGTAEYVSPELLSDNY---TDYKCDIWAFGCLVYQMIAGKPPFKATNEY 335

Query: 253 AILHS--RYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLE 294
                  + ++     +   +++L++ +L  QP +R  I Q+ E
Sbjct: 336 LTFQKVMKVQFAFTAGFPTIIRDLVKNILVKQPEKRLTIPQIKE 379

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/215 (25%), Positives = 98/215 (45%), Gaps = 14/215 (6%)

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIEN 164
           +  L+E+ + G L+  +  +      E   +   +Q+   +  +HS+   ++HRDIK EN
Sbjct: 334 LYFLLEYASNGDLLTLL--KKYGSFDETSTIYFTAQIIDSIHYIHSMG--IIHRDIKPEN 389

Query: 165 VLISNSGEYKLCDFGSV----CGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRH 220
           +L++   + KL DFG+             SQ  FN ++       TA+Y +PE++  S  
Sbjct: 390 ILLTKDFKIKLTDFGTAKILDPSQPSQSQSQPHFNLLERSKSFVGTAEYVSPELLTDSY- 448

Query: 221 LPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHS--RYEYLAYPHYSDNLKNLIRLM 278
              D + DIWA G  L++L     PF+   E        + +Y     +   L++LI+ +
Sbjct: 449 --TDSRCDIWAFGCILFQLIAGKPPFKATNEYLTFQKIIKLQYAFTAGFPTILRDLIKKI 506

Query: 279 LANQPSQRPNICQVLEEV-SRLQGIPCPIKNFYLE 312
           L   P+ R  I Q+   +  R +    P   +YL+
Sbjct: 507 LIKNPNNRLTIHQIKSHLFYRSKDFSNPWNIWYLD 541

>KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8.279
           YLR096W
          Length = 1192

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/191 (28%), Positives = 96/191 (50%), Gaps = 20/191 (10%)

Query: 107 LLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVL 166
           +L E+ + G L+D++       L+E         +   +  +H+    ++HRD+KIEN++
Sbjct: 210 MLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIGSALQYLHANN--IVHRDLKIENIM 265

Query: 167 ISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEK 226
           IS SGE K+ DFG +  V  P   +Q   F         +  + APE++    +L    +
Sbjct: 266 ISTSGEIKIIDFG-LSNVYDP--RKQLHTFC-------GSLYFAAPELLKARPYL--GPE 313

Query: 227 SDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEY--LAYP-HYSDNLKNLIRLMLANQP 283
            D+W+ GV LY L     PF+    +++LH + +   + YP H S  + +L+  ML   P
Sbjct: 314 VDVWSFGVVLYVLVCGKVPFDDE-VSSVLHEKIKQGNVEYPNHLSIEVLSLLSKMLVVDP 372

Query: 284 SQRPNICQVLE 294
            +R ++ QV+E
Sbjct: 373 ERRASLKQVIE 383

>TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1057

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 107/226 (47%), Gaps = 22/226 (9%)

Query: 72  EVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQE 131
           E +A++ L N   +V    +   +S L+        L+E+   G  +  M  +    L E
Sbjct: 215 EKNALQRLNNSRGIVKLYFTFQDESSLY-------FLLEYAPNGDFLSIM--KKYGSLNE 265

Query: 132 FEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQ 191
                  +Q+   +  +HS    ++HRDIK EN+L+    + KL DFG+   +   P + 
Sbjct: 266 DCACYYSAQIIDAIDFLHS--KGIVHRDIKPENILLDKDFKVKLTDFGTAKILEPKPNTT 323

Query: 192 QEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGE 251
             ++ +        TA+Y +PE+++ +    +D + DIWA G  L+++     PF+   E
Sbjct: 324 DSYDLLSRSKSFVGTAEYVSPELLNDNY---VDYRCDIWAFGCILFQMIAGKPPFKATNE 380

Query: 252 ----AAILHSRYEYLA-YPHYSDNLKNLIRLMLANQPSQRPNICQV 292
                 ++  +Y + A +P     +++L++ +L  QP+QR  I Q+
Sbjct: 381 YLTFQKVMKVQYAFTAGFPLV---VRDLVKGILIKQPAQRLTIPQI 423

>Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {ON}
           YDR490C (REAL)
          Length = 758

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 66/288 (22%), Positives = 123/288 (42%), Gaps = 22/288 (7%)

Query: 15  LQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVD 74
           +++G+      + L  G Y+ V  A       +    ++  + LI   K    T   E  
Sbjct: 118 VKMGIKDFKFGEQLGDGSYSSVVLATARESGKKYAVKVLSKEYLIRQKKVKYVT--VEKL 175

Query: 75  AMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEI 134
           A++ L     ++    +   ++ L+        L+E+   G  +  +  +    L E   
Sbjct: 176 ALQKLNGTKGIIRLFFTFQDEASLY-------FLLEYAPHGDFLGLI--KKYGSLNEICA 226

Query: 135 LNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQE- 193
               SQ+   V ++HS+   ++HRDIK EN+L+    + KL DFG+   +   P++  + 
Sbjct: 227 RYYASQIIDAVDSLHSI--GIIHRDIKPENILLDKDMKVKLTDFGTAKILPEQPSNAADG 284

Query: 194 ---FNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAG 250
              F+          TA+Y +PE+++ S     D + DIWA G  LY++     PF+ A 
Sbjct: 285 KPCFDLYAKSKSFVGTAEYVSPELLNDSY---TDSRCDIWAFGCILYQMLAGKPPFKAAN 341

Query: 251 EAAILHS--RYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEV 296
           E        + +Y     +   +K+L++ +L   P+ R  I Q+   V
Sbjct: 342 EYLTFQKVMKIQYAFTAGFPQIVKDLVKKLLVRDPNDRLAIEQIKAHV 389

>TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8.279
           YLR096W
          Length = 1126

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 101/222 (45%), Gaps = 44/222 (19%)

Query: 107 LLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVL 166
           +L E+ + G L+D++       L+E         +   +  +H+    ++HRD+KIEN++
Sbjct: 179 MLFEYVSGGQLLDYIIQ--HGSLREHHARKFTRGIASALQYLHANN--IVHRDLKIENIM 234

Query: 167 ISNSGEYKLCDFG------------SVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEM 214
           IS SGE K+ DFG            + CG +          F   ++LK   + Y  PE+
Sbjct: 235 ISTSGEIKIIDFGLSNLFDKSKQLHTFCGSL---------YFAAPELLK--ASPYTGPEV 283

Query: 215 IDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEY--LAYP-HYSDNL 271
                        D+W+ GV LY L     PF+    +++LH + +   + YP H S  +
Sbjct: 284 -------------DVWSFGVVLYVLVCGKVPFDDEN-SSVLHEKIKQGKVEYPQHLSIEV 329

Query: 272 KNLIRLMLANQPSQRPNICQVLEEVSRLQGIPCPIKNFYLER 313
            +L+  ML   P +R ++ QV+E    ++G   P  ++   R
Sbjct: 330 ISLLSKMLVVDPHRRASLKQVVEHHWMVRGYDGPPPSYVPNR 371

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 99/199 (49%), Gaps = 28/199 (14%)

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIEN 164
           + ++ME+C  G   + +    +++L E +   I+S+V  G+  +HS     +HRDIK  N
Sbjct: 91  MWIVMEYCGGGSCAELLKYTPEHKLTEDQCAFIVSEVLVGLDYLHSQRK--IHRDIKSAN 148

Query: 165 VLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPID 224
           +L++++G  KL DFG V G +    +++   FV        T  + APE+ID ++    +
Sbjct: 149 ILLTDNGHVKLGDFG-VSGQMM--VTRKRDTFV-------GTPFWMAPEVIDRNKK-GYN 197

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYP---------HYSDNLKNLI 275
           E +DIW+LG+ + +L     P +K      L      +A P          +S + K+ +
Sbjct: 198 EMADIWSLGITVIELLMGHPPLDKYDAMKAL------MAIPKRDPPKLDKRFSSHAKDFV 251

Query: 276 RLMLANQPSQRPNICQVLE 294
              L   PSQRP   ++L+
Sbjct: 252 AQCLIKDPSQRPTASELLK 270

>TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.406
           YHR102W
          Length = 975

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 92/195 (47%), Gaps = 20/195 (10%)

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIEN 164
           + ++ME+CA G +   +      ++ E  I  IM ++   +  +H  +  ++HRDIK  N
Sbjct: 114 LWIIMEYCAGGSVRTLLR---PGKIDEKYIAVIMRELLVALHYIH--KDNVIHRDIKAAN 168

Query: 165 VLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPID 224
           +LI+N G  KLCDFG          +Q   N ++   +   T  + APE+I     +  D
Sbjct: 169 LLITNEGNVKLCDFGVA--------AQLNQNTMRRQTMAG-TPYWMAPEVI--MEGISYD 217

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKA----GEAAILHSRYEYLAYPHYSDNLKNLIRLMLA 280
            K+DIW++G+  Y++     PF +         I  S+   L   ++   LK  I + L 
Sbjct: 218 TKADIWSVGITAYEIATGNPPFCEMEALRAMQVISKSKPARLEGKNHDPLLKEFIAMCLD 277

Query: 281 NQPSQRPNICQVLEE 295
             P +RP   ++L E
Sbjct: 278 EDPQERPTADKLLHE 292

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 95/193 (49%), Gaps = 21/193 (10%)

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIEN 164
           V +++E+C+   L + +    + RL   E   + SQ+   V   H L+   +HRD+K+EN
Sbjct: 103 VWMVLEYCSGHELYEHLLK--EQRLSLEESKKLFSQIASAVYYAHELK--CVHRDLKLEN 158

Query: 165 VLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPID 224
           VL+  +G  KL DF    G  R   ++ +   +        T  Y APE+I+  R     
Sbjct: 159 VLLDGNGHAKLTDF----GFTREMATRSQLETI------CGTTVYMAPELIE--RKCYDG 206

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKAGEA----AILHSRYEYLAYPHYSDNLKNLIRLMLA 280
            K DIW+LG+ LY +     PF++  +      I++   ++      SD+  +LI+ ML 
Sbjct: 207 FKVDIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDF-NQEWISDDAIDLIQGMLR 265

Query: 281 NQPSQRPNICQVL 293
             P++R ++ QVL
Sbjct: 266 KNPNERISLAQVL 278

>AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR523C
           (SPS1)
          Length = 440

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 72/281 (25%), Positives = 136/281 (48%), Gaps = 42/281 (14%)

Query: 24  ILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKAS-LNTPRAEVDAMKLLRNF 82
           IL+ +  G +  VY+A+       T ++IV +K + + D    ++    E+  +  LR+ 
Sbjct: 22  ILQCIGRGNFGDVYKAR-----DLTSNEIVAIKVVNLEDTDEPIDLLAQEIFFLSELRS- 75

Query: 83  DHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVT 142
                YI +N   + L + +  + ++ME+C  G   + +    ++++ E +   I+S+V 
Sbjct: 76  ----PYI-TNYKTAFLVDVS--MWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEVL 128

Query: 143 QGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDIL 202
            G+  +HS     +HRDIK  N+L++++G  KL DFG V G +    +++   FV     
Sbjct: 129 IGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSGQMM--VTRKRDTFV----- 178

Query: 203 KNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYL 262
              T  + APE+ID ++    +E +DIW+LG+ + +L     P +K      L      +
Sbjct: 179 --GTPFWMAPEVIDRNKQ-GYNEMADIWSLGITVIELLMGHPPLDKYDAMKAL------M 229

Query: 263 AYP---------HYSDNLKNLIRLMLANQPSQRPNICQVLE 294
           A P          +S + ++ +   L   PSQRP   ++L+
Sbjct: 230 AIPKRDPPKLDKRFSSHARDFVAQCLIKDPSQRPTAAELLK 270

>SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102W KIC1 Protein kinase of the PAK/Ste20 kinase
           family required for cell integrity possibly through
           regulating 1 6-beta-glucan levels in the wall physically
           interacts with Cdc31p (centrin) which is a component of
           the spindle pole body
          Length = 885

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 89/197 (45%), Gaps = 30/197 (15%)

Query: 101 GAY----EVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLL 156
           G+Y    ++ ++ME+CA G L   +      ++ E  I  IM ++   VA ++  +  ++
Sbjct: 90  GSYLYDTKLWIIMEYCAGGSLRTLLR---PGKIDEKYIGVIMRELL--VALLYIHKDNVI 144

Query: 157 HRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNT---TAQYRAPE 213
           HRDIK  NVLI+N G  KLCDFG                  Q ++ + T   T  + APE
Sbjct: 145 HRDIKAANVLITNDGRVKLCDFGVAA------------QLTQSNVRRQTMAGTPYWMAPE 192

Query: 214 MIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKA----GEAAILHSRYEYLAYPHYSD 269
           +I     +  D K DIW+LG+  Y++     P+           I  S+   L    YS 
Sbjct: 193 VI--MEGVYYDTKVDIWSLGITTYEITTGNPPYCDVEALRAMQLITKSKPPRLEGRQYSP 250

Query: 270 NLKNLIRLMLANQPSQR 286
            LK  I L L   P +R
Sbjct: 251 LLKEFIALCLDEDPKER 267

>NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON} 
          Length = 1258

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 61/212 (28%), Positives = 102/212 (48%), Gaps = 21/212 (9%)

Query: 107 LLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVL 166
           +L E+ + G L+D++       L+E         +   +  +H     ++HRD+KIEN++
Sbjct: 265 MLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIASALQYLHLNN--IVHRDLKIENIM 320

Query: 167 ISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEK 226
           ISNSGE K+ DFG +  V      +Q   F         +  + APE+  L  H     +
Sbjct: 321 ISNSGEIKIIDFG-LSNVFD--NRKQLHTFC-------GSLYFAAPEL--LKAHPYTGPE 368

Query: 227 SDIWALGVFLYKLCYYTTPFEKAGEAAILHS--RYEYLAYP-HYSDNLKNLIRLMLANQP 283
            D+W+ G+ LY L     PF+    +++LH   R   + YP H S  + +L+  M+   P
Sbjct: 369 VDVWSFGIVLYVLVCGKVPFDDEN-SSVLHEKIRQGKVEYPNHLSIEVISLLSKMIVVDP 427

Query: 284 SQRPNICQVLEEVSRLQGIPCPIKNFYLERAI 315
           ++R ++ QV+E     +G   P  + YL R I
Sbjct: 428 AKRASLRQVVEHPWMTRGYDFPPLS-YLPRRI 458

>KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {ON}
           Anc_3.177 YAR019C
          Length = 936

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 72/268 (26%), Positives = 112/268 (41%), Gaps = 36/268 (13%)

Query: 31  GGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDHVVSYID 90
           G Y  VY+A      +R    +V +K L   +   L     E+D   LL+N DHV     
Sbjct: 38  GSYGIVYKAI-----NRRTEQVVAIKELYYNNDTELQDIMVEID---LLKNLDHV----- 84

Query: 91  SNAAK-SGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMH 149
            N  K  G       + +++EF + G L + M  R +  L E E    + Q   G+  +H
Sbjct: 85  -NIIKYHGFIQKLSNLYIILEFASHGSLKNLMMQRPEKHLNEKETRIYIKQTINGLVYLH 143

Query: 150 SLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPP-TSQQEFNFVQHDILKNTTAQ 208
             E  ++HRDIK  N+L+  S   KL DFG    V     T     N++  +I+ N  A 
Sbjct: 144 --EQGVIHRDIKAANLLLDASNTIKLADFGVSTSVANSAMTLAGSLNWMAPEIITNKGAS 201

Query: 209 YRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYP--H 266
                             SDIW+LG  + +L     PF K  +  I ++    +  P  +
Sbjct: 202 ----------------TLSDIWSLGATIIELLTGNPPFHKLMDINIYYAIENDVFLPPEN 245

Query: 267 YSDNLKNLIRLMLANQPSQRPNICQVLE 294
            S N +N++ L       +RP+   +L+
Sbjct: 246 LSTNCQNILNLCFQKNMFKRPSAVSLLK 273

>NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {ON}
            Anc_7.86
          Length = 1382

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 85/185 (45%), Gaps = 20/185 (10%)

Query: 113  AEGGLIDFMN-TRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSG 171
             E G ID  +    +  + EFE   I  Q+  G+  +H  +  ++HRDIK ENV++ + G
Sbjct: 1211 GETGCIDLFDLIEFKTNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKG 1268

Query: 172  EYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEK-SDIW 230
              K+ DFGS   V   P           D+   T   Y APE++      P + K  DIW
Sbjct: 1269 CVKIIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLSGE---PYEGKPQDIW 1314

Query: 231  ALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNIC 290
            A+G+ LY + +   PF    E  IL    ++      S++   LI+ +L     +RP I 
Sbjct: 1315 AIGILLYTIVFKENPFYNIDE--ILEGELKFNNSNDISEDCIELIKKILIRSVPKRPLIE 1372

Query: 291  QVLEE 295
            ++  +
Sbjct: 1373 EIFND 1377

>YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}
           SPS1Putative protein serine/threonine kinase expressed
           at the end of meiosis and localized to the prospore
           membrane, required for correct localization of enzymes
           involved in spore wall synthesis
          Length = 490

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 57/193 (29%), Positives = 90/193 (46%), Gaps = 18/193 (9%)

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIEN 164
           + ++ME+C  G   D +     N L E ++  I+ +VT G+  +H  E   +HRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLH--EQRKIHRDIKAAN 146

Query: 165 VLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPID 224
           +L++  G  KL DFG V G IR    +  F           T  + APE++        +
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIRSTLKRDTF---------VGTPYWMAPEVVCCEVD-GYN 195

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKAGEAAIL----HSRYEYLAYPHYSDNLKNLIRLMLA 280
           EK+DIW+LG+  Y+L     P  K     ++      +   L  P +SD  K+ +   L 
Sbjct: 196 EKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP-FSDAAKDFVAGCLV 254

Query: 281 NQPSQRPNICQVL 293
             P+ RP+   +L
Sbjct: 255 KTPADRPSAYNLL 267

>TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.654
           YPL141C
          Length = 622

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 117/233 (50%), Gaps = 33/233 (14%)

Query: 72  EVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQE 131
           E++A+K+L + + V         +  L N  Y + +++E+ + G    ++  + + RL+E
Sbjct: 126 EINALKMLTHPNIV-------KLEEVLQNSKY-IGIVLEYASGGEFYKYI--KFKKRLKE 175

Query: 132 FEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQ 191
            +   I +Q+  GV+ +HS    L+HRD+K+EN+L+  +G   + DFG V  V +     
Sbjct: 176 SKACTIFAQLISGVSYIHS--KGLVHRDLKLENLLLDKAGNLLITDFGFVNEVTKT---- 229

Query: 192 QEFNFVQHDILKNTTAQYRAPEMIDLSRHLPID-EKSDIWALGVFLYKLCYYTTPFE--- 247
              N + H    +    Y APE++      P +  K+DIW+ GV LY +     P++   
Sbjct: 230 ---NKLMHTPCGSPC--YAAPELVTSVE--PYNARKADIWSCGVILYAMLAGYLPWDDDP 282

Query: 248 KAGEAAILHSRYEY-----LAYPHYSDNL-KNLIRLMLANQPSQRPNICQVLE 294
           K      +   Y+Y     L +P Y + + ++L+R ML   P++R ++  +L+
Sbjct: 283 KNINGTDIVKLYKYIENQPLKFPEYINMVPRDLLRRMLEIDPAKRMSMKHILQ 335

>Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095W
            (BCK1) - MEKK serine/threonine kinase [contig 48] FULL
          Length = 1446

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 110/236 (46%), Gaps = 30/236 (12%)

Query: 48   TGSDIVCLKRLIVP-----DKASLNTPRAEVDAMKLLRNFDH--VVSYIDSNAAKSGLHN 100
            T  +++ +K++ VP     D+ +L+   A    +  L++ DH  +V Y+       G  N
Sbjct: 1167 TTGEMIAVKQVEVPRYGSQDETTLSVLEALRSEVATLKDLDHTNIVQYL-------GFEN 1219

Query: 101  GAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDI 160
              Y   L +E+ A G +   +  RL  +  E  I  +  QV +G++ +HS +  +LHRD+
Sbjct: 1220 KNYVYSLFLEYVAGGSVGSLI--RLYGKFDENLIRFLAVQVLRGLSYLHSKK--ILHRDM 1275

Query: 161  KIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFN-FVQHDILKNTTAQYRAPEMIDLSR 219
            K +N+L+   G  K+ DFG          S++  N +   D+    T  + APEM+D  +
Sbjct: 1276 KADNLLLDVDGICKISDFG---------ISKKSNNIYSNSDMTMRGTVFWMAPEMVDTKQ 1326

Query: 220  HLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLI 275
                  K DIW+LG  + ++     P+      A +    ++ + P   ++ + +I
Sbjct: 1327 GY--SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKFKSAPPIPEDTQKII 1380

>TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {ON}
           Anc_8.654 YPL141C
          Length = 1208

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 58/209 (27%), Positives = 105/209 (50%), Gaps = 30/209 (14%)

Query: 98  LHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLH 157
           L N  Y + +++E+ + G    ++  + + RL+E    N+ SQ+  GV  MH     L+H
Sbjct: 146 LQNSKY-IGIVLEYASGGEFYKYI--QKKRRLKESVASNLFSQLVSGVYYMHCKG--LVH 200

Query: 158 RDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQ--YRAPEMI 215
           RD+K+EN+L+   G   + DFG V           EF+    +++K +     Y APE++
Sbjct: 201 RDLKLENLLLDKYGNLIITDFGFV----------NEFSKFS-ELMKTSCGSPCYAAPELV 249

Query: 216 DLSRHLPID-EKSDIWALGVFLYKLCYYTTPFE---KAGEAAILHSRYEY-----LAYPH 266
             +R  P +  K+DIW+ G+ L+ +     P++   K  +   +   Y+Y     L +P 
Sbjct: 250 ISTR--PYEARKADIWSCGIILFAMLAGYLPWDDDPKNPDGNDIAKLYKYITTTPLKFPE 307

Query: 267 Y-SDNLKNLIRLMLANQPSQRPNICQVLE 294
           Y S   ++L+R +L   P +R  + Q+L+
Sbjct: 308 YISPMARDLLRNILIPYPQKRATLKQILK 336

>Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 73.9 bits (180), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 57/192 (29%), Positives = 87/192 (45%), Gaps = 16/192 (8%)

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIEN 164
           + ++ME+C  G   D +     N L E ++  I+ QVT G+  +H  E   +HRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLH--EQRKIHRDIKAAN 141

Query: 165 VLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPID 224
           +L++  G  KL DFG V G IR    +  F           T  + APE++        +
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHIRSTMKRDTF---------VGTPYWMAPEVVCCEVD-GYN 190

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKAGEAAI---LHSRYEYLAYPHYSDNLKNLIRLMLAN 281
           EK+DIW+LG+  Y+L     P  K     +   L  R        +S+  K  +   L  
Sbjct: 191 EKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGSFSEAAKEFVAGCLVK 250

Query: 282 QPSQRPNICQVL 293
            P+ RP+   +L
Sbjct: 251 APADRPSAYDLL 262

>Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {ON}
           YJR059W (PTK2) - putative serine)/threonine kinase
           involved in spermine metabolism [contig 43] FULL
          Length = 735

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 55/174 (31%), Positives = 79/174 (45%), Gaps = 15/174 (8%)

Query: 107 LLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVL 166
            +ME+C EG L   ++     +    E      QV +G+  +HS    ++HRDIK ENVL
Sbjct: 361 FVMEYCTEGDLFSLISKPNWKKRPLKEKYEYWRQVVEGIKFIHSQG--VVHRDIKPENVL 418

Query: 167 ISNSGEYKLCDFG-SVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDL-------S 218
           IS  G  K+ DFG S  G   P             +    +  Y APE++          
Sbjct: 419 ISKEGIAKMTDFGISDWGNEDPDDLTSPVRLFDTYV---GSPPYSAPEVVAFKDEDSTYQ 475

Query: 219 RHLPIDE-KSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNL 271
              P D  K D WALGV L+ L Y  TPF  A ++   +  Y  L+Y ++ D++
Sbjct: 476 DRKPYDAYKMDCWALGVLLFTLVYQCTPFLDASKSDSKYRSY-VLSYNNFVDHI 528

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 66/278 (23%), Positives = 121/278 (43%), Gaps = 35/278 (12%)

Query: 26  KYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDH- 84
           ++L  GG+A+ +Q K           I   K +      +  T R  +  +++ ++  H 
Sbjct: 146 QFLGEGGFARCFQIK------DESGKIFAAKTVAKISIKTEKTRRKLLSEIQIHKSMKHQ 199

Query: 85  -VVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQ 143
            +V ++D              V +L+  C  G L++ +  R    L E E+     Q+  
Sbjct: 200 NIVQFVDC-------FEDHINVYILLGMCPNGSLMELLKKR--KILTEPEVRFFTVQICG 250

Query: 144 GVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILK 203
            +  MHS    ++HRD+K+ N+    +   K+ DFG     +     ++++         
Sbjct: 251 AIKYMHSRR--VIHRDLKLGNIFFDENYNLKIGDFG--LAAVLANDRERKYTVC------ 300

Query: 204 NTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSR----- 258
             T  Y APE++ L +H     + DIW++GV ++ L     PF+ A +   ++SR     
Sbjct: 301 -GTPNYIAPEVL-LGKHSGHSYEVDIWSIGVMIFALLIGKPPFQ-AKDVNTIYSRIKNSE 357

Query: 259 YEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEV 296
           Y +      S   K LI+ +L N P  RP+I +++E V
Sbjct: 358 YTFPINKSISQEAKTLIQDILINDPIARPSINEIMEYV 395

>Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {ON}
           similar to Ashbya gossypii AFR335C
          Length = 1077

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 93/193 (48%), Gaps = 16/193 (8%)

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIEN 164
           +  L+E+   G  +  M  +    L E       +Q+  G+  +H     ++HRDIK EN
Sbjct: 278 LYFLLEYAPNGDFLSIM--KKYGSLNEECARYYGAQILNGIYFLH--RHGIIHRDIKPEN 333

Query: 165 VLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPID 224
           +L+  S + KL DFG+   ++      +E++          TA+Y +PE+++ S    +D
Sbjct: 334 ILLDKSMKVKLTDFGT-AKLLNRKDGTEEYDLTTRSKSFVGTAEYVSPELLNDSW---VD 389

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKAGE----AAILHSRYEYLA-YPHYSDNLKNLIRLML 279
            K DIWA G  L+++     PF+   E      ++  +Y + A +P     +++L++ +L
Sbjct: 390 HKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPMV---VRDLVKQIL 446

Query: 280 ANQPSQRPNICQV 292
             +P  R  I Q+
Sbjct: 447 VKKPEHRLTIPQI 459

>KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {ON}
           Anc_8.668 YPL150W
          Length = 879

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 80/306 (26%), Positives = 134/306 (43%), Gaps = 69/306 (22%)

Query: 9   YPQGISLQ-VGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLN 67
           Y Q +S + + V +  ILK +  G + +VY A   P             R +V   +  N
Sbjct: 27  YGQFMSDELIEVGNYRILKQIGEGSFGKVYLALHRPT-----------HRKVVLKTSDKN 75

Query: 68  TPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVL-------LLMEFCAEGGLIDF 120
            P   V  +   R FD+   YI             YE++       + +E+C    L D 
Sbjct: 76  DPNI-VREVFYHRQFDY--PYI----------TKVYEIIVTETKVWMALEYCPGKELYDH 122

Query: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180
           +      R+   E   + +Q+   V   HSL    +HRD+K+EN+L+   G  KL DFG 
Sbjct: 123 L--LFSKRIPIAECTELFAQIVGAVYYAHSLN--CVHRDLKLENILLDKHGRAKLTDFG- 177

Query: 181 VCGVIRPPTSQQEFNFVQHDILKNT------TAQYRAPEMIDLSRHLPIDEKSDIWALGV 234
                          F +  + ++T      T  Y APE+I+   +     K DIWALGV
Sbjct: 178 ---------------FTRECMTRSTLETVCGTTVYMAPELIERKSYDGF--KIDIWALGV 220

Query: 235 FLYKLCYYTTPFEKAGEAAILHSRYEYL-AYPHYSDNLKN-----LIRLMLANQPSQRPN 288
            LY + Y   PF++  E   + ++++ +   P +++N+ +     LI+ +L   P++RP 
Sbjct: 221 ILYTMIYGAMPFDEDDE---VKTKWKIVNEDPDFTNNISSNDVKDLIKKLLKKDPTERPT 277

Query: 289 ICQVLE 294
           I ++L+
Sbjct: 278 IREILK 283

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 101/208 (48%), Gaps = 30/208 (14%)

Query: 98  LHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLH 157
           L N  Y + +++E+ + G    ++  +   RL+E     + +Q+  GV  MHS    L+H
Sbjct: 114 LQNSKY-IGIVLEYASGGEFYKYIQKK--RRLKESAACRLFAQLISGVYYMHSKG--LVH 168

Query: 158 RDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQ--YRAPEMI 215
           RD+K+EN+L+  +    + DFG V           EF   +++++K +     Y APE++
Sbjct: 169 RDLKLENLLLDKNENLLITDFGFV----------NEF-LPENELMKTSCGSPCYAAPELV 217

Query: 216 DLSRHLPID-EKSDIWALGVFLYKLCYYTTPFEKAGE---AAILHSRYEY-----LAYPH 266
             +R  P +  K+DIW+ GV +Y +     P++   E      +   Y Y     L +P 
Sbjct: 218 VTAR--PYEARKADIWSCGVIMYAMLAGYLPWDDDPENPDGDDIGKLYRYITRTPLKFPD 275

Query: 267 YSDNL-KNLIRLMLANQPSQRPNICQVL 293
           Y   + ++L+R +L   P +R  I Q L
Sbjct: 276 YIAPVPRDLLRAILVADPKKRITIAQTL 303

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
           YHR102W
          Length = 1008

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 103/237 (43%), Gaps = 27/237 (11%)

Query: 62  DKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFM 121
           D+  +   + E+  +  L+   ++  Y  S    + L        ++ME+C  G L   +
Sbjct: 71  DEDEVEDVQKEIQFLASLKQLPNITRYYGSYLKNTSL-------WIIMEYCGGGSLRSLL 123

Query: 122 NTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSV 181
                 ++ E  I  IM ++   +  +H  +  ++HRDIK  NVLI+N G  KLCDFG  
Sbjct: 124 R---PGKIDEKYIGVIMREILIALKYIH--KDNVIHRDIKAANVLINNDGSIKLCDFGVA 178

Query: 182 CGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCY 241
             + +  + +Q             T  + APE+I     +  D K+DIW+ G+  Y++  
Sbjct: 179 AQLNQTKSRRQTM---------AGTPYWMAPEVI--MEGVYYDTKADIWSTGITAYEVTT 227

Query: 242 YTTPFEKA----GEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLE 294
              P+           I  S+   L   +YS  +K  I   L   PS+RP   ++L+
Sbjct: 228 GNPPYCDVEALRAMQLIAKSKPPRLEGRNYSALIKEFIATCLDEDPSERPTADELLK 284

>Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 73.6 bits (179), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 57/192 (29%), Positives = 87/192 (45%), Gaps = 16/192 (8%)

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIEN 164
           + ++ME+C  G   D +     N L E ++  I+ QVT G+  +H  E   +HRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLH--EQRKIHRDIKAAN 141

Query: 165 VLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPID 224
           +L++  G  KL DFG V G +R    +  F           T  + APE++        +
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHLRSTMKRDTF---------VGTPYWMAPEVVCCEVD-GYN 190

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKAGEAAI---LHSRYEYLAYPHYSDNLKNLIRLMLAN 281
           EK+DIW+LG+  Y+L     P  K     +   L  R        +SD  K  +   L  
Sbjct: 191 EKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGSFSDAAKEFVAGCLVK 250

Query: 282 QPSQRPNICQVL 293
            P+ RP+   +L
Sbjct: 251 VPADRPSAYDLL 262

>KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {ON}
           Anc_8.654 YPL141C
          Length = 644

 Score = 73.9 bits (180), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 95/201 (47%), Gaps = 30/201 (14%)

Query: 98  LHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLH 157
           L N  Y + +++E+ + G    ++  + + RL+E     + SQ+  GV  MHS    L+H
Sbjct: 129 LQNSKY-IGIVLEYASGGEFYKYI--QRKRRLKEVNASRLFSQLVSGVHYMHSKG--LVH 183

Query: 158 RDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQ---YRAPEM 214
           RD+K+EN+L+  +    + DFG V              F   ++L  T+     Y APE+
Sbjct: 184 RDLKLENLLLDKNENLMITDFGFVN------------EFSNENVLMKTSCGSPCYAAPEL 231

Query: 215 IDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGE---AAILHSRYEY-----LAYPH 266
           + +SR   +  K DIW+ GV LY +     P++          +   Y Y     L +P 
Sbjct: 232 V-VSREAYVGVKVDIWSCGVILYAMLAGYLPWDDDPSNPNGDDISKLYSYITATPLKFPD 290

Query: 267 YSDNL-KNLIRLMLANQPSQR 286
           Y + L ++L+R +L   P +R
Sbjct: 291 YVNPLPRDLLRRILVADPRRR 311

>ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {ON}
           weakly similar to uniprot|Q03497 Saccharomyces
           cerevisiae YHL007C STE20 Signal transducing kinase of
           the PAK (p21-activated kinase) family involved in
           pheromone response and pseudohyphal/invasive growth
           pathways activated by Cdc42p binds Ste4p at a GBB motif
           present in noncatalytic domains of PAK kinases
          Length = 963

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 67/249 (26%), Positives = 114/249 (45%), Gaps = 42/249 (16%)

Query: 69  PRAE--VDAMKLLRNFDH--VVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTR 124
           P+ E  ++ + +++   H  +V++IDS   K  L        ++ME+   G L D +   
Sbjct: 692 PKKELIINEIMVMKGSKHRNIVNFIDSYLLKGDL-------WVVMEYMEGGSLTDVVTHC 744

Query: 125 LQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGV 184
           +   L E +I  +  +   G+  +HS    ++HRDIK +N+L+S +GE KL DFG  C  
Sbjct: 745 I---LTEGQIGAVCRETLAGLQFLHSKG--VIHRDIKSDNILLSMTGEIKLTDFG-FCAQ 798

Query: 185 IRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTT 244
           I       E N  +  ++   T  + APE++    + P   K DIW+LG+ + ++     
Sbjct: 799 I------NEINLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEP 847

Query: 245 PFEKAGEAAILH----SRYEYLAYP-HYSDNLKNLIRLMLANQPSQR---------PNIC 290
           P+        L+    +    L  P +  + L+N +   L  +P QR         P + 
Sbjct: 848 PYLNETPLRALYLIATNGTPKLKEPDNLGEELQNFLDWCLTVEPDQRASSSQLLKDPFVT 907

Query: 291 QVLEEVSRL 299
           QV EE S L
Sbjct: 908 QVAEENSSL 916

>NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa] {ON}
            
          Length = 1515

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 99/206 (48%), Gaps = 28/206 (13%)

Query: 48   TGSDIVCLKRLIVP-----DKASLNTPRAEVDAMKLLRNFDH--VVSYIDSNAAKSGLHN 100
            T  +++ +K++ VP     D+A ++T  A    +  L++ DH  +V Y+       G  N
Sbjct: 1235 TTGEMMAVKQVEVPKYSSQDEAIISTVEALRSEVSTLKDLDHLNIVQYL-------GFEN 1287

Query: 101  GAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDI 160
                  L +E+ A G +   +  R+  R  E  I ++ +QV +G+A +HS    +LHRD+
Sbjct: 1288 KDNIYSLFLEYVAGGSVGSLI--RMYGRFDEPLIRHLNTQVLRGLAYLHSRG--ILHRDM 1343

Query: 161  KIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRH 220
            K +N+L+   G  K+ DFG         + + +  +   D+    T  + APEM+D  + 
Sbjct: 1344 KADNLLLDQDGVCKISDFGI--------SRKSKDIYSNSDMTMRGTVFWMAPEMVDTKQG 1395

Query: 221  LPIDEKSDIWALGVFLYKLCYYTTPF 246
                 K DIW+LG  + ++     P+
Sbjct: 1396 Y--SAKVDIWSLGCIVLEMFAGKRPW 1419

>NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5.406
          Length = 1015

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 93/219 (42%), Gaps = 27/219 (12%)

Query: 72  EVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQE 131
           EV  +  L+   ++  Y  S    + L        ++ME+CA G L   +      ++ E
Sbjct: 83  EVQFLSSLKQIPNITRYYGSYLKDTSL-------WIIMEYCAGGSLRSLLR---PGKIDE 132

Query: 132 FEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQ 191
             I  IM ++   +  +H     ++HRDIK  NVLI+N G  KLCDFG    + +    +
Sbjct: 133 KYIGVIMRELLVALKYIHKDN--VIHRDIKAANVLITNEGSVKLCDFGVAAQLNQSTLRR 190

Query: 192 QEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKA-- 249
           Q             T  + APE+I     +  D K DIW+LG+  Y++     P+ +   
Sbjct: 191 QTM---------AGTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEA 239

Query: 250 --GEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQR 286
                 I  S+   L    Y+  LK  I L L   P +R
Sbjct: 240 LRAMQLITKSKPPRLESRSYTPLLKEFIALCLDEDPKER 278

>TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.496
           YHL007C
          Length = 973

 Score = 73.9 bits (180), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 61/227 (26%), Positives = 111/227 (48%), Gaps = 30/227 (13%)

Query: 20  HHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLL 79
           H+  ++K +  G    V+ A     DSR  + +V +K++ +  +        E+  MK  
Sbjct: 676 HYKDLVK-IGQGASGGVFTAH----DSRDENRLVAIKQMNLQKQPKKELIINEIIVMKGS 730

Query: 80  RNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMS 139
           R+ +++V++IDS   K  L        ++ME+   G L D +   +   L E +I  +  
Sbjct: 731 RH-ENIVNFIDSYLMKGDL-------WVVMEYMEGGSLTDVVTHCI---LTEGQIGTVCK 779

Query: 140 QVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQH 199
           +   G+A +HS    ++HRDIK +N+L+S +G+ KL DFG  C  I       E +  + 
Sbjct: 780 ETLGGLAFLHSKG--VIHRDIKSDNILLSMNGDIKLTDFG-FCAQI------NEVHLKRT 830

Query: 200 DILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPF 246
            ++   T  + APE++    + P   K DIW+LG+ + ++     P+
Sbjct: 831 TMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 872

>NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON} 
          Length = 1210

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 59/211 (27%), Positives = 102/211 (48%), Gaps = 22/211 (10%)

Query: 107 LLMEFCAEGGLIDFMNTRLQN-RLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENV 165
           +L E+ + G L+D++   +Q+  L+E         +   +  +H+    ++HRD+KIEN+
Sbjct: 263 MLFEYVSGGQLLDYI---IQHGSLREHHARKFARGIASALEYIHANN--IVHRDLKIENI 317

Query: 166 LISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDE 225
           +IS SGE K+ DFG      R    +Q   F         +  + APE+  L  H     
Sbjct: 318 MISTSGEIKIIDFGLSNVFDR---KKQLHTFC-------GSLYFAAPEL--LKAHPYTGP 365

Query: 226 KSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEY--LAYP-HYSDNLKNLIRLMLANQ 282
           + D+W+ GV LY L     PF+    +++LH + +   + YP H S  + +L+  ML   
Sbjct: 366 EVDVWSFGVVLYVLVCGKVPFDDEN-SSVLHEKIKQGKVDYPNHLSIEVISLLSKMLVVD 424

Query: 283 PSQRPNICQVLEEVSRLQGIPCPIKNFYLER 313
           P +R ++ QV+E     +G   P  ++   R
Sbjct: 425 PLRRASLKQVVEHPWMTRGYDYPPPSYVPRR 455

>Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}
            complement(18696..23039) [4344 nt, 1448 aa]
          Length = 1447

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 72/268 (26%), Positives = 118/268 (44%), Gaps = 50/268 (18%)

Query: 48   TGSDIVCLKRLIVPDKASLN-TPRAEVDAMKL----LRNFDH--VVSYIDSNAAKSGLHN 100
            T  +++ +K++ VP     N T    VDA++L    L++ DH  +V Y+   A      N
Sbjct: 1161 TTGEMMAVKQVEVPKYGLQNETVVNTVDALRLEVSTLKDLDHLNIVQYLGFEA-----KN 1215

Query: 101  GAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDI 160
            G Y   L +E+ A G +   +  R+  R  +  I ++  QV QG++ +HS    +LHRD+
Sbjct: 1216 GIYS--LFLEYVAGGSVGSLI--RMYGRFDDILIRHLTIQVLQGLSYLHSRG--ILHRDM 1269

Query: 161  KIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNT------TAQYRAPEM 214
            K +N+L+   G  K+ DFG               +   +DI  N+      T  + APEM
Sbjct: 1270 KADNLLLDQDGVCKISDFG--------------ISRKSNDIYSNSEMTMKGTVFWMAPEM 1315

Query: 215  IDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFE---------KAGEAAILHSRYEYLAYP 265
            +D  +      K DIW+LG  + ++     P+          K G+A       E    P
Sbjct: 1316 VDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNFEVVAAMFKIGQAKSAPPIPED-TLP 1372

Query: 266  HYSDNLKNLIRLMLANQPSQRPNICQVL 293
              S+N K  +       P +RP   ++L
Sbjct: 1373 LISENAKEFLDCCFEIDPEKRPTADKLL 1400

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score = 73.9 bits (180), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 66/277 (23%), Positives = 122/277 (44%), Gaps = 35/277 (12%)

Query: 27  YLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDH-- 84
           +L  GG+A+ +Q K        G  I   K +      S  T +  +  +++ ++  H  
Sbjct: 84  FLGEGGFARCFQIK------DDGGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMRHTN 137

Query: 85  VVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQG 144
           +V ++D     +        V +L+E C  G L+D +  R    L E E+    +Q+   
Sbjct: 138 IVQFVDCFEDDTN-------VYILLEICPNGSLMDLLKRR--KMLTEPEVRFFTTQIVGA 188

Query: 145 VAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKN 204
           V  MHS    ++HRD+K+ N+        K+ DFG     +     ++++          
Sbjct: 189 VKYMHSRR--VIHRDLKLGNIFFDKHYNLKVGDFG--LAAVLANDRERKYTVC------- 237

Query: 205 TTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAY 264
            T  Y APE++   +H     + DIW+ GV +Y L     PF+ A E  I++ R +   +
Sbjct: 238 GTPNYIAPEVLT-GKHTGHSYEVDIWSCGVMIYALLIGKPPFQ-AKEVNIIYERIKCGDF 295

Query: 265 PHYSDNLKN-----LIRLMLANQPSQRPNICQVLEEV 296
               D   +     LI+ +L+  P +RP++ ++++ V
Sbjct: 296 VFPKDKFISPEALVLIKDILSIDPLERPSLDEIIDYV 332

>KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1142

 Score = 73.9 bits (180), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 97/214 (45%), Gaps = 28/214 (13%)

Query: 107 LLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVL 166
           +L E+ + G L+D++       L+E         +   +  +H     ++HRD+KIEN++
Sbjct: 285 MLFEYVSGGQLLDYIIQ--HGSLRERSARKFARGIASALQYLHLNN--IVHRDLKIENIM 340

Query: 167 ISNSGEYKLCDFGSVCGVIRPPTSQQEF----NFVQHDILKNTTAQYRAPEMIDLSRHLP 222
           IS SGE K+ DFG +  +  P      F     F   ++LK     Y  PE+        
Sbjct: 341 ISTSGEIKIIDFG-LSNMFNPKKQLHTFCGSLYFAAPELLK--ACPYTGPEV-------- 389

Query: 223 IDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEY--LAYP-HYSDNLKNLIRLML 279
                D+W+ GV LY L     PF+    +++LH + +   + YP H S  + +L+  ML
Sbjct: 390 -----DVWSFGVVLYVLVCGKVPFDDEN-SSVLHEKIKQGKVEYPQHLSIEVISLLSKML 443

Query: 280 ANQPSQRPNICQVLEEVSRLQGIPCPIKNFYLER 313
              PS+R  + QV+      +G   P  ++   R
Sbjct: 444 VVDPSKRATLKQVVNHQWMQRGYDFPAPSYIPHR 477

>KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1223

 Score = 73.9 bits (180), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 93/203 (45%), Gaps = 33/203 (16%)

Query: 105  VLLLMEFCAE-------------GGLIDFMN-TRLQNRLQEFEILNIMSQVTQGVAAMHS 150
            +L+L++F  +              G +D  +   L+  + E E   I  Q+  G+  +H 
Sbjct: 1031 ILMLLDFFEDDEYYYIETPIHGTSGSVDLFDLIELKTDMTEHEAKLIFKQIVSGIKHLH- 1089

Query: 151  LEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYR 210
             +  ++HRDIK ENV++ ++G  K+ DFGS   V   P           D+   T   Y 
Sbjct: 1090 -DNGIVHRDIKDENVIVDSNGFVKIIDFGSAAYVKSGP----------FDVFVGTI-DYA 1137

Query: 211  APEMIDLSRHLPIDEK-SDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSD 269
            APE++      P + K  DIWA+GV LY + +   PF    E  IL +     +    SD
Sbjct: 1138 APEVLGGE---PYEGKPQDIWAIGVLLYTIIFKENPFYNIDE--ILDADLRVDSNHRVSD 1192

Query: 270  NLKNLIRLMLANQPSQRPNICQV 292
                LIR +L    S+RP+I ++
Sbjct: 1193 ECIALIRKILNRPISKRPSISKI 1215

>Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W
           (REAL)
          Length = 1082

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 101/227 (44%), Gaps = 18/227 (7%)

Query: 72  EVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQE 131
           E  A++ L N   VV    +   +S L+        L+E+   G  +  M  +    L E
Sbjct: 229 EKTALQKLNNSHSVVRLFSTFQDESSLY-------FLLEYAPNGDFLSLM--KKNGSLDE 279

Query: 132 FEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS--VCGVIRPPT 189
                  +Q+   +  +HS    ++HRDIK EN+L+      KL DFG+  +       T
Sbjct: 280 NCACYYGAQIIDAIDYLHS--NGIIHRDIKPENILLDEEMRIKLTDFGTAKLLDSTVSST 337

Query: 190 SQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKA 249
           S+Q+++          TA+Y +PE+++ S     D + DIWA G  L+++     PF+  
Sbjct: 338 SKQKYDLSTRSKSFVGTAEYVSPELLNDSF---TDYRCDIWAFGCILFQMIAGKPPFKAT 394

Query: 250 GEAAILHS--RYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLE 294
            E        + +Y   P +   +++L++ +L     QR  I Q+ E
Sbjct: 395 NEYLTFQKVMKVQYAFTPGFPLIIRDLVKKILIKNLDQRLTISQIKE 441

>SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 400

 Score = 72.4 bits (176), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 90/197 (45%), Gaps = 29/197 (14%)

Query: 104 EVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIE 163
            V LLME+   G L  + + R+     +      ++Q+   +  MH     +LHRDIK E
Sbjct: 212 RVYLLMEYLVNGEL--YRHLRVNGPFNDILASYYVNQMADALNYMHDRN--VLHRDIKPE 267

Query: 164 NVLISNSGEYKLCDFG----SVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSR 219
           N+LI      KL DFG    S  G  R                   T  Y +PE++    
Sbjct: 268 NILIGFQNTLKLTDFGWSVISTTGAKRKTLC--------------GTLDYLSPELVKYRE 313

Query: 220 HLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRY--EYLAYP-HYSDNLKNLIR 276
           +   DEK D+WALGV  Y+L   T PFE+A +  + + R     L +P   S + ++LI 
Sbjct: 314 Y---DEKVDVWALGVLAYELLVGTPPFEEASK-ELTYKRIVRRDLRFPDQMSIDARDLIG 369

Query: 277 LMLANQPSQRPNICQVL 293
            +L N PS R ++  VL
Sbjct: 370 RLLENDPSTRISLKDVL 386

>SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weakly
           similar to uniprot|P47116 Saccharomyces cerevisiae
           YJR059W PTK2 Putative serine/threonine protein kinase
           involved in regulation of ion transport across plasma
           membrane enhances spermine uptake
          Length = 818

 Score = 73.6 bits (179), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 77/186 (41%), Gaps = 42/186 (22%)

Query: 107 LLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVL 166
            +ME+C  G L   +      R    E   +  QVTQG+  MH+    ++HRDIK ENVL
Sbjct: 371 FVMEYCPGGDLHSLITRTGWKRSPLKERFCLFKQVTQGLRFMHNQG--VVHRDIKPENVL 428

Query: 167 ISNSGEYKLCDFGSV------------------CGVIRPPTSQQEFNFVQHDILKNTTAQ 208
           IS  G  KL DFG                    C V  PP S  E        LKN    
Sbjct: 429 ISKDGIAKLTDFGISDWAHEDPDDLNSPMRVFDCYVGSPPFSPPEVM-----ALKNAKGD 483

Query: 209 YRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAY---- 264
              P       + P   K D WALG+ L+ L Y  TPF  A E++  H R   L+Y    
Sbjct: 484 AVKP-------YDPF--KMDCWALGMILFALVYQATPFLSA-ESSNAHYREYILSYDMFM 533

Query: 265 ---PHY 267
              PH+
Sbjct: 534 KQNPHF 539

>Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL045W
            (REAL)
          Length = 1101

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 83/184 (45%), Gaps = 18/184 (9%)

Query: 113  AEGGLIDFMNT-RLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSG 171
             E G ID  +    +  + E E   +  QV   +  +H+    ++HRDIK ENV++ + G
Sbjct: 930  GETGSIDLFDVIEFKKDMVEHEAKLVFKQVVASIKHLHN--QGIVHRDIKDENVIVDSHG 987

Query: 172  EYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWA 231
              KL DFGS   V   P           D+    T  Y APE++  S +    +  DIWA
Sbjct: 988  FVKLIDFGSAAYVKSGP----------FDVFVG-TMDYAAPEVLGGSSYK--GKPQDIWA 1034

Query: 232  LGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQ 291
            LGV LY + Y   P+    E  IL     +      S+    LI+ +L  +  +RP I +
Sbjct: 1035 LGVLLYTIIYKENPYYNIDE--ILEGELRFDKAEKVSEGCIGLIKRILTREVDKRPTIDE 1092

Query: 292  VLEE 295
            + E+
Sbjct: 1093 IYED 1096

>Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {ON}
           YHL007C (STE20) - serine/threonine protein kinase
           [contig 55] FULL
          Length = 955

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/217 (28%), Positives = 102/217 (47%), Gaps = 29/217 (13%)

Query: 84  HVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQ 143
           ++V++IDS   +  L        ++ME+   G L D +   +   L E +I  +  +  +
Sbjct: 723 NIVNFIDSYLLRGDL-------WVVMEYMEGGSLTDVVTHCI---LTEGQIGAVSRETLK 772

Query: 144 GVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILK 203
           G+  +HS    ++HRDIK +NVL+S SGE KL DFG  C  I       E N  +  ++ 
Sbjct: 773 GLQFLHS--KGVIHRDIKSDNVLLSMSGEIKLTDFG-FCAQI------NEINLKRTTMV- 822

Query: 204 NTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPF--EKAGEAAIL---HSR 258
             T  + APE++    + P   K DIW+LG+ + ++     P+  E    A  L   +  
Sbjct: 823 -GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGT 878

Query: 259 YEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEE 295
            E       SD+LK+ +   L   P +R    Q+L +
Sbjct: 879 PELKDADSLSDDLKSFLGWCLHVNPDERATASQLLSD 915

>SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] {ON}
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1274

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 86/190 (45%), Gaps = 21/190 (11%)

Query: 113  AEGGLIDFMN-TRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSG 171
             E G ID  +   L+  + E E   I  QV  G+  +H  +  ++HRDIK EN+++ N G
Sbjct: 1103 GETGSIDLFDLIELKTNMTEHEAKLIFKQVASGIKHLH--DNGIVHRDIKDENIIVDNKG 1160

Query: 172  EYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEK-SDIW 230
              KL DFGS   V   P           D+   T   Y APE++      P + K  DIW
Sbjct: 1161 FVKLIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGD---PYEGKPQDIW 1206

Query: 231  ALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNIC 290
            A+GV LY + +   PF    E  IL       +    S+    LIR +L     +RP I 
Sbjct: 1207 AIGVLLYTIIFKENPFYNIDE--ILDGDLRISSSVTVSEECIALIRRILNRSVPKRPTIE 1264

Query: 291  QVLEEVSRLQ 300
            ++  + S LQ
Sbjct: 1265 EIYND-SWLQ 1273

>AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YJL095W (BCK1)
          Length = 1423

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 66/272 (24%), Positives = 118/272 (43%), Gaps = 46/272 (16%)

Query: 48   TGSDIVCLKRLIVP-----DKASLNTPRAEVDAMKLLRNFDH--VVSYIDSNAAKSGLHN 100
            T  +++ +K++ VP     D+ ++N   A +  +  L++ DH  +V Y+       G  N
Sbjct: 1145 TTGEMMAVKQVEVPKFGSQDETTVNNAEALISEVSTLKDLDHLNIVQYL-------GFEN 1197

Query: 101  GAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDI 160
                  L +E+ A G +   +  RL     E  I  + +QV +G+A +H     +LHRD+
Sbjct: 1198 KNCIYSLFLEYVAGGSVGSLI--RLYGHFDEQLIRFLTTQVLEGLAYLHLRG--ILHRDM 1253

Query: 161  KIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFN-FVQHDILKNTTAQYRAPEMIDLSR 219
            K +N+L+ N G  K+ DFG          S++  N +   ++    T  + APEM+D ++
Sbjct: 1254 KADNLLLDNDGVCKISDFG---------ISRKSNNIYSNSEMTMRGTVFWMAPEMVDTTQ 1304

Query: 220  HLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLA--------YPHYSDNL 271
                  K DIW+LG  + ++     P+      A +    +  +         PH S + 
Sbjct: 1305 GY--SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFQIGKSKSAPPIPEDTLPHISQDG 1362

Query: 272  KNLIRLMLANQPSQRPN--------ICQVLEE 295
            +  +       P +RP          CQV +E
Sbjct: 1363 RAFLDDCFMIDPEERPTADTLLSHPFCQVPKE 1394

>TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1300

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 84/185 (45%), Gaps = 20/185 (10%)

Query: 113  AEGGLIDFMN-TRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSG 171
             E G ID  +    +  + E E   I  QV  G+  +HSL   ++HRDIK ENV+I + G
Sbjct: 1128 GESGCIDLFDLIEFRTDMTEDEAKLIFKQVASGLQHLHSL--GIVHRDIKDENVIIDSKG 1185

Query: 172  EYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEK-SDIW 230
              K+ DFGS   V   P           D+   T   Y APE++  +   P + K  DIW
Sbjct: 1186 YVKIIDFGSAAYVKNGP----------FDVFVGTI-DYAAPEVLAGN---PYEGKPQDIW 1231

Query: 231  ALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNIC 290
            ALG+ LY + +   PF    E  I+     +      +     LI+ ML     +RP+I 
Sbjct: 1232 ALGILLYTIIFKENPFYNIDE--IIEGNVNFDNEASVNPVCVQLIKKMLIKTVPKRPDIN 1289

Query: 291  QVLEE 295
            +V  +
Sbjct: 1290 EVFSD 1294

>TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.92
           YDR490C
          Length = 819

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 91/196 (46%), Gaps = 21/196 (10%)

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIEN 164
           +  ++E+   G L+  +  R    L      +  +Q+   + A+HS+   ++HRDIK EN
Sbjct: 219 LYFVLEYAPHGDLLALL--RRHGSLSRAVTCHYAAQLLSAIGALHSVG--VIHRDIKPEN 274

Query: 165 VLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKN--TTAQYRAPEMIDLSRHLP 222
           VL+ +    KL DFG+   +   P +      V   +  +   TA+Y  PE++       
Sbjct: 275 VLLDSHYRAKLTDFGTAALL---PQTHSNLEQVSRHVTTSFVGTAEYVPPELLAAGH--- 328

Query: 223 IDEKSDIWALGVFLYKLCYYTTPFEKAGEAA----ILHSRYEYLAYPHYSDNLKNLIRLM 278
            D   D+WA    +++L     PF+   E      ++  RY Y   P +  +LK+L+R +
Sbjct: 329 ADGTCDLWAWACVVFQLIAGRPPFQARNEFLTFQNVMAVRYTYP--PGFPSDLKDLLRRV 386

Query: 279 LANQPSQR---PNICQ 291
           L ++P QR   P I Q
Sbjct: 387 LRHEPRQRLLQPQITQ 402

>Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {ON}
           YDR523C (REAL)
          Length = 490

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 57/193 (29%), Positives = 89/193 (46%), Gaps = 18/193 (9%)

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIEN 164
           + ++ME+C  G   D +     N L E ++  I+ QVT G+  +H  E   +HRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHQVTLGLKYLH--EQRKIHRDIKAAN 146

Query: 165 VLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPID 224
           +L++  G  KL DFG V G IR    +  F           T  + APE++        +
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIRSTFKRDTF---------VGTPYWMAPEVVCCEVD-GYN 195

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKAGEAAIL----HSRYEYLAYPHYSDNLKNLIRLMLA 280
           EK+DIW+LG+  Y+L     P  K     ++      +   L  P +S+  K  +   L 
Sbjct: 196 EKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP-FSEAAKEFVAGCLV 254

Query: 281 NQPSQRPNICQVL 293
             P+ RP+   +L
Sbjct: 255 KTPADRPSAYDLL 267

>Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {ON}
           YDR490C (PKH1) - Ser/Thr protein kinase [contig 184]
           FULL
          Length = 984

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 95/193 (49%), Gaps = 16/193 (8%)

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIEN 164
           +  L+E+   G  +  +  +  +  QE  +    +Q+   +  +H     ++HRDIK EN
Sbjct: 232 LYFLLEYAPNGDFLSVIK-KFGSLSQECAVY-YSAQILDAIDYLH--HKGIVHRDIKPEN 287

Query: 165 VLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPID 224
           +L+    + KL DFG+   ++    + Q FN ++       TA+Y +PE+++ +    +D
Sbjct: 288 ILLDKDMKVKLTDFGT-ARILEKDETTQTFNLLERSKSFVGTAEYVSPELLNDNY---VD 343

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKAGE----AAILHSRYEYLA-YPHYSDNLKNLIRLML 279
            K DIWA G  L+++     PF+   E      ++  +Y + A +P     +++LI+ +L
Sbjct: 344 YKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLV---IRDLIKKIL 400

Query: 280 ANQPSQRPNICQV 292
              P QR +  Q+
Sbjct: 401 VKSPEQRLDASQI 413

>CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} similar
           to uniprot|P08458 Saccharomyces cerevisiae YDR523c SPS1
           ser/thr protein kinase
          Length = 521

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 94/192 (48%), Gaps = 16/192 (8%)

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIEN 164
           + + ME+C  G + D +     + L E +   I  ++ +G++ +HS     +HRDIK  N
Sbjct: 76  MWIAMEYCGGGSVGDLLKYHYTSGLPEHKTRFITREILKGLSYLHSQRK--IHRDIKAAN 133

Query: 165 VLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPID 224
           +L+++ G+ KL DFG V G +   +S +   FV        T  + APE++        D
Sbjct: 134 ILLTDEGKVKLSDFG-VSGKLL--SSFRRDTFVG-------TPYWMAPEIVAHDSE-GYD 182

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKAGEAAI---LHSRYEYLAYPHYSDNLKNLIRLMLAN 281
           E++DIW+LG+ + ++   + P  K     +   L  R     +  +SD+ K+ + L L  
Sbjct: 183 ERADIWSLGITVIEMLRGSPPLSKYDPMKVIANLPKRKPPKLHGDFSDDAKHFVALCLIK 242

Query: 282 QPSQRPNICQVL 293
           + + RP    +L
Sbjct: 243 ESAIRPTAADLL 254

>TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON}
           Anc_8.654 YPL141C
          Length = 790

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 98/201 (48%), Gaps = 30/201 (14%)

Query: 98  LHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLH 157
           L N  Y + +++E+ + G    ++  +   RL+E     + +Q+  GV  MHS    L+H
Sbjct: 117 LQNSKY-IGIVLEYASGGEFYKYIQKK--RRLKEAVACRLFAQLISGVQYMHSKG--LVH 171

Query: 158 RDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQ--YRAPEMI 215
           RD+K+EN+L+       + DFG V           EF F   +++K +     Y APE++
Sbjct: 172 RDLKLENLLLDKHENLVITDFGFV----------NEF-FAHSELMKTSCGSPCYAAPELV 220

Query: 216 DLSRHLPID-EKSDIWALGVFLYKLCYYTTPFE---KAGEAAILHSRYEY-----LAYPH 266
             S+  P +  K+DIW+ GV LY +     P++   K  +   +   Y+Y     L +P 
Sbjct: 221 VSSK--PYEARKADIWSCGVILYAMLAGYLPWDDDTKNPDGNDIGKLYQYITRTPLKFPE 278

Query: 267 YSDNL-KNLIRLMLANQPSQR 286
           Y   L ++L+R +L   P +R
Sbjct: 279 YITPLPRDLLRRILYPDPKRR 299

>Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {ON}
           YDR490C (REAL)
          Length = 756

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 98/201 (48%), Gaps = 19/201 (9%)

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIEN 164
           +  L+E+ + G  +  +  +    L E       SQ+   V ++H++   ++HRDIK EN
Sbjct: 199 LYFLLEYASHGDFLGLI--KKYGSLNEKCARYYASQIIDAVDSLHAIG--IIHRDIKPEN 254

Query: 165 VLISNSGEYKLCDFGSVCGVIRPPTSQQE----FNFVQHDILKNTTAQYRAPEMIDLSRH 220
           +L+    + KL DFG+   +   P++  +    F+          TA+Y +PE+++ S  
Sbjct: 255 ILLDKDMKVKLTDFGTAKILPEQPSNNADGKPCFDLYARSKSFVGTAEYVSPELLNDSY- 313

Query: 221 LPIDEKSDIWALGVFLYKLCYYTTPFEKAGE----AAILHSRYEYLA-YPHYSDNLKNLI 275
              D + DIWA G  LY++     PF+ A E      ++  +Y + A +P  +   K+L+
Sbjct: 314 --TDSRCDIWAFGCILYQMVAGKPPFKAANEYLTFQKVMKIQYAFTAGFPLIA---KDLV 368

Query: 276 RLMLANQPSQRPNICQVLEEV 296
           + +L  +P+ R  + Q+   V
Sbjct: 369 KKLLVREPNDRLTVEQIKAHV 389

>KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 993

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 100/199 (50%), Gaps = 28/199 (14%)

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILN------IMSQVTQGVAAMHSLEPPLLHR 158
           +  L+E+   G   DF++      ++++  LN        +Q+   +  +H  +  ++HR
Sbjct: 237 LYFLLEYAPNG---DFLSV-----IKKYGSLNQDCSVYYSAQILDAIDYLH--QKGVIHR 286

Query: 159 DIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLS 218
           DIK EN+L+    + KL DFG+   V +  T+Q  +N ++       TA+Y +PE+++ +
Sbjct: 287 DIKPENILLDKDMKVKLTDFGTAKLVEKDETTQT-YNLLERSKSFVGTAEYVSPELLNDN 345

Query: 219 RHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGE----AAILHSRYEYLA-YPHYSDNLKN 273
               +D K DIWA G  L+++     PF+   E      ++  +Y + A +P     +++
Sbjct: 346 Y---VDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLI---IRD 399

Query: 274 LIRLMLANQPSQRPNICQV 292
           LI+ +L   P QR +  QV
Sbjct: 400 LIKQILVKNPEQRLDTLQV 418

>NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {ON}
           Anc_8.279
          Length = 1049

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 101/224 (45%), Gaps = 30/224 (13%)

Query: 98  LHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLH 157
           +H  +    +L E+ + G L+D++       L+E        Q+   +  +HS    ++H
Sbjct: 168 MHTLSNHFYMLFEYVSGGQLLDYIIQ--HGSLKESRARTFTRQICSALKYLHSHN--IVH 223

Query: 158 RDIKIENVLISNSGEYKLCDFG-----SVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAP 212
           RD+KIEN++IS  G  KL DFG       C  ++  T      F   ++LK T   Y  P
Sbjct: 224 RDLKIENIMISKDGNIKLIDFGLSNLYDKCNKLK--TYCGSLYFAAPELLKATP--YIGP 279

Query: 213 EMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEY--LAYPHY-SD 269
           E+             D+W+ GV LY L     PF+    + +LH + +   + YP + S 
Sbjct: 280 EI-------------DVWSFGVVLYVLVCGKVPFDDEN-SNVLHEKIKQGKVFYPQFLSI 325

Query: 270 NLKNLIRLMLANQPSQRPNICQVLEEVSRLQGIPCPIKNFYLER 313
            + +L+  ML   P +R  + QV+     ++    P K++  +R
Sbjct: 326 EVISLLSKMLVVDPFKRATLDQVMNHHWMVRDCDGPPKSYIPDR 369

>KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} similar to
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1433

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 61/236 (25%), Positives = 109/236 (46%), Gaps = 30/236 (12%)

Query: 48   TGSDIVCLKRLIVP-----DKASLNTPRAEVDAMKLLRNFDHV--VSYIDSNAAKSGLHN 100
            T  +++ +K++ VP     D+ +L+   A    +  L++ DHV  V Y+       G  N
Sbjct: 1167 TTGEMMAVKQVEVPRYGSQDETTLSVLEALKSEVSTLKDLDHVNIVQYL-------GFEN 1219

Query: 101  GAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDI 160
              +   L +E+ A G +   +  RL  R  E  I  +  QV +G+A +HS    +LHRD+
Sbjct: 1220 KNHVYSLFLEYVAGGSVGSLI--RLFGRFDEDLIRFLAVQVLRGLAYLHSKG--ILHRDM 1275

Query: 161  KIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFN-FVQHDILKNTTAQYRAPEMIDLSR 219
            K +N+L+   G  K+ DFG          S++  N +   D+    T  + APEM+D  +
Sbjct: 1276 KADNLLLDVDGICKISDFG---------ISKKSNNIYSNSDMTMRGTVFWMAPEMVDTKQ 1326

Query: 220  HLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLI 275
                  K DIW+LG  + ++     P+      A +    ++ + P   ++ + L+
Sbjct: 1327 GY--SAKVDIWSLGCVVLEMFAGKRPWSNFEVVAAMFKIGKFKSAPPIPEDTQKLL 1380

>CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa]
           {ON} similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007c STE20 Serine/threonine-protein kinase
          Length = 915

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/225 (28%), Positives = 103/225 (45%), Gaps = 31/225 (13%)

Query: 78  LLRNFDH--VVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEIL 135
           ++R   H  +V++IDS  AK  L        ++ME+   G L D +   L   L E +I 
Sbjct: 668 VMRESKHSNIVNFIDSYLAKGDL-------WIVMEYMEGGSLTDVVTHCL---LSEGQIG 717

Query: 136 NIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFN 195
            +  +  +G+  +HS    +LHRDIK +N+L+S  G  KL DFG  C  I       E N
Sbjct: 718 AVCRETLKGLQFLHS--KGVLHRDIKSDNILLSLKGNIKLTDFG-FCAQI------NENN 768

Query: 196 FVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAIL 255
             +  ++   T  + APE++    + P   K DIW+LG+ + ++     P+        L
Sbjct: 769 LKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRAL 823

Query: 256 H----SRYEYLAYPH-YSDNLKNLIRLMLANQPSQRPNICQVLEE 295
           +    +    L  P   SD L   +   L   PS+R    ++L++
Sbjct: 824 YLIATNGTPKLKEPEALSDTLTKFLDWCLKVDPSERATATELLDD 868

>Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL045W
            (REAL)
          Length = 1101

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 82/184 (44%), Gaps = 18/184 (9%)

Query: 113  AEGGLIDFMNT-RLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSG 171
             E G ID  +    +  + E E   +  QV   +  +H     ++HRDIK ENV++ + G
Sbjct: 930  GETGSIDLFDVIEFKKDMVEHEAKLVFKQVVASIKHLHG--QGIVHRDIKDENVIVDSHG 987

Query: 172  EYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWA 231
              KL DFGS   +   P           D+    T  Y APE++  S +    +  DIWA
Sbjct: 988  FVKLIDFGSAAYIKSGP----------FDVFVG-TMDYAAPEVLGGSSYK--GKPQDIWA 1034

Query: 232  LGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQ 291
            LGV LY + Y   P+    E  IL     +      S+    LI+ +L  +  +RP I +
Sbjct: 1035 LGVLLYTIIYKENPYYNIDE--ILEGELRFDKSEKVSEECIGLIKRILTREVDKRPTIDE 1092

Query: 292  VLEE 295
            + E+
Sbjct: 1093 IYED 1096

>NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {ON}
           Anc_2.496
          Length = 909

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 64/222 (28%), Positives = 105/222 (47%), Gaps = 37/222 (16%)

Query: 84  HVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQ 143
           ++V++IDS      L +G  ++ ++ME+   G L D +   +   L E +I  +  +   
Sbjct: 683 NIVNFIDSY-----LLDG--DLWVIMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLS 732

Query: 144 GVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILK 203
           G+  +HS    +LHRDIK +N+L+S +G  KL DFG  C  +   T            LK
Sbjct: 733 GLQFLHSKG--VLHRDIKSDNILLSINGNIKLTDFG-FCAQVNETT------------LK 777

Query: 204 NTTA----QYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPF--EKAGEAAIL-- 255
            TT      + APE++    + P   K DIW+LG+ + ++     P+  E    A  L  
Sbjct: 778 RTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIA 834

Query: 256 -HSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEV 296
            +   E       SD LK+ +   L+  P QR +  ++LE+V
Sbjct: 835 TNGTPELKEREKLSDVLKHFLDWCLSVNPDQRASATELLEDV 876

>Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {ON}
            YJL095W (REAL)
          Length = 1484

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 99/206 (48%), Gaps = 28/206 (13%)

Query: 48   TGSDIVCLKRLIVP-----DKASLNTPRAEVDAMKLLRNFDH--VVSYIDSNAAKSGLHN 100
            T  +++ +K++ VP     ++A L+T  A    +  L++ DH  +V Y+       G  N
Sbjct: 1202 TTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLNIVQYL-------GFEN 1254

Query: 101  GAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDI 160
                  L +E+ A G +   +  R+  R  E  I ++ +QV +G+A +HS    +LHRD+
Sbjct: 1255 KNSIYSLFLEYVAGGSVGSLI--RMYGRFDESLIKHLTTQVLRGLAYLHSKG--ILHRDM 1310

Query: 161  KIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRH 220
            K +N+L+   G  K+ DFG         + + +  +   D+    T  + APEM+D  + 
Sbjct: 1311 KADNLLLDQDGICKISDFGI--------SRKSKDIYSNSDMTMRGTVFWMAPEMVDTKQG 1362

Query: 221  LPIDEKSDIWALGVFLYKLCYYTTPF 246
                 K DIW+LG  + ++     P+
Sbjct: 1363 Y--SAKVDIWSLGCIVLEMFAGKRPW 1386

>Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} similar
           to Ashbya gossypii ACL104C
          Length = 1003

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 88/195 (45%), Gaps = 22/195 (11%)

Query: 104 EVLLLMEFCAEGGLIDFMN-TRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKI 162
           ++ ++ME+CA G L   +   ++  +     + N++      VA ++  +  ++HRDIK 
Sbjct: 94  KLWVIMEYCAGGSLRTLLRPGKIDEKYLGVIVRNLL------VALLYIHKDNVIHRDIKA 147

Query: 163 ENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLP 222
            NVLI+N G  KLCDFG    +      +Q             T  + APE+I     + 
Sbjct: 148 ANVLITNGGHVKLCDFGVAAQLTTANHKRQTM---------AGTPYWMAPEVI--MEGVY 196

Query: 223 IDEKSDIWALGVFLYKLCYYTTPFEKA----GEAAILHSRYEYLAYPHYSDNLKNLIRLM 278
            + K+DIW+LG+  Y++     P+           I  S+   L   +YS  LK  I L 
Sbjct: 197 YNTKADIWSLGITTYEIATGNPPYCDVEALRAMQLITKSKPPRLEGRNYSPLLKEFIALC 256

Query: 279 LANQPSQRPNICQVL 293
           L   P  RP   ++L
Sbjct: 257 LDEDPEARPTAEELL 271

>Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (REAL)
          Length = 1356

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 83/181 (45%), Gaps = 18/181 (9%)

Query: 113  AEGGLIDFMN-TRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSG 171
             E G ID  +    +  + EFE   I  QV  G+  +H  +  ++HRDIK ENV++ + G
Sbjct: 1185 GETGCIDLFDLIEFKTNMTEFEAKLIFKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKG 1242

Query: 172  EYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWA 231
              K+ DFGS   V   P           D+   T   Y APE++  + +    +  DIWA
Sbjct: 1243 FVKIIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGNPYE--GQPQDIWA 1289

Query: 232  LGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQ 291
            +G+ LY + +   PF    E  IL    ++      S++   LI+ +L  +   RP I  
Sbjct: 1290 IGILLYTVVFKENPFYNIDE--ILEGDLKFNNAEEVSEDCIELIKSILNRRVPNRPTIDD 1347

Query: 292  V 292
            +
Sbjct: 1348 I 1348

>Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {ON}
           complement(61987..64668) [2682 nt, 894 aa]
          Length = 893

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 126/279 (45%), Gaps = 36/279 (12%)

Query: 28  LTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDHVVS 87
           L  G + +V       P S          +LI  DK   N+ +     +K+ R  + +  
Sbjct: 50  LGEGEFGKVKLGWTRNPTSNQEVSKQVAIKLIRRDKIVKNSEKE----IKIFREINALKH 105

Query: 88  YIDSNAAK--SGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGV 145
               N  K    L N  Y + +++E+ + G    ++  + + RL+E     + +Q+  GV
Sbjct: 106 LTHPNIVKLEEVLQNSKY-IGIVLEYASGGEFYRYI--QRKRRLKETAGCRLFTQLVSGV 162

Query: 146 AAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNT 205
             MHS    L+HRD+K+EN+L+       + DFG V   ++            +D++K +
Sbjct: 163 NYMHS--KGLVHRDLKLENLLLDKHENLVITDFGFVNEFLK-----------DNDLMKTS 209

Query: 206 TAQ--YRAPEMIDLSRHLPID-EKSDIWALGVFLYKLCYYTTPFE---KAGEAAILHSRY 259
                Y APE++  ++  P +  K+DIW+ G+ LY +     P++   +  E   +   Y
Sbjct: 210 CGSPCYAAPELVISTK--PYEARKADIWSCGIILYAMLAGYLPWDDDPQNPEGDDIARLY 267

Query: 260 EY-----LAYPHYSDNL-KNLIRLMLANQPSQRPNICQV 292
            +     L +P Y   + ++L+R +L + P +R NI Q+
Sbjct: 268 YFITRTSLKFPEYISPIPRDLLRRLLVSDPRKRLNIRQI 306

>Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054W
           (REAL)
          Length = 388

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/227 (26%), Positives = 103/227 (45%), Gaps = 34/227 (14%)

Query: 21  HATILKYLTSGGYAQVYQAKI---SPPDSRTGSDIVCLKRL--IVPDKASLNTPRAEVDA 75
           H  I+++L  G Y  V   K    +PP        + +K++  I   +  L     E+  
Sbjct: 37  HYEIIQFLGKGAYGTVCSVKFKGQNPPAK------IAVKKISNIFNKEILLKRAIRELKF 90

Query: 76  MKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEIL 135
           M   +   ++V+ ID     S  ++G Y    L+++     L   +++ +Q  L EF I 
Sbjct: 91  MNFFKGHKNIVNLIDLEIVSSSPYDGLYCYQELIDY----DLAKVIHSSVQ--LSEFHIK 144

Query: 136 NIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGV------IRPPT 189
             + Q+  G+  +HS +  ++HRD+K  N+L + +G  K+CDFG   G+        P  
Sbjct: 145 YFLYQILCGLKYIHSAD--VIHRDLKPGNILCTLNGCLKICDFGLARGIHAEFFQCNPSV 202

Query: 190 SQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFL 236
                N+V        T  YRAPE+  L  + P ++  DIWA+G  L
Sbjct: 203 QPHITNYV-------ATRWYRAPEL--LLSNQPYNKSIDIWAVGCIL 240

>Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054W
           (REAL)
          Length = 398

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 103/223 (46%), Gaps = 23/223 (10%)

Query: 21  HATILKYLTSGGYAQVYQAKI---SPPDSRTGSDIVCLKRL--IVPDKASLNTPRAEVDA 75
           +  I+++L  G Y  V   K    +PP        + +K++  I   +  L     E+  
Sbjct: 45  YYEIIQFLGKGAYGTVCSVKFKGQTPPAK------IAVKKISNIFNKEILLKRAIRELKF 98

Query: 76  MKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEIL 135
           M   +   ++V+ ID     S  ++G Y    L+++     L   +++ +Q  L EF I 
Sbjct: 99  MNFFKGHKNIVNLIDLEIVSSSPYDGLYCYQELIDY----DLAKVIHSSVQ--LSEFHIK 152

Query: 136 NIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFN 195
             + Q+  G+  +HS +  ++HRD+K  N+L + +G  K+CDFG   G+       Q  N
Sbjct: 153 YFLYQILCGLKYIHSAD--VIHRDLKPGNILCTLNGCLKICDFGLARGIHTEFFQCQTTN 210

Query: 196 FVQHDILKNTTA--QYRAPEMIDLSRHLPIDEKSDIWALGVFL 236
                 + N  A   YRAPE+  L  + P D+  DIWA+G  L
Sbjct: 211 SAVQPHITNYVATRWYRAPEL--LLSNQPYDKAIDIWAVGCIL 251

>KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {ON}
           Anc_5.406 YHR102W
          Length = 1027

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 102/230 (44%), Gaps = 33/230 (14%)

Query: 72  EVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQE 131
           E+  +  L+   +V  Y  S    + L        ++ME+CA G L   +      ++ E
Sbjct: 87  EIQFLASLKQLPNVTRYYGSYLKNTSL-------WIIMEYCAGGSLRSLLR---PGKIDE 136

Query: 132 FEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQ 191
             I  IM ++   +  +H     ++HRDIK  NVLI+N G  KLCDFG            
Sbjct: 137 KYIGVIMRELLVALKFIHKDN--IIHRDIKAANVLITNEGGVKLCDFGVAA--------- 185

Query: 192 QEFNFVQHDILKNT---TAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPF-- 246
                 Q  + + T   T  + APE+I    +   D K DIW+LG+  Y++     P+  
Sbjct: 186 ---QLNQRTLRRQTMAGTPYWMAPEVIMEGVYY--DTKVDIWSLGITAYEISTGNPPYCD 240

Query: 247 EKAGEAA--ILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLE 294
            +A  A   I  S+   L   +Y+  +K  I L L   P++R +  ++L+
Sbjct: 241 VEALRAMQLITKSKPPRLEGRNYTPLIKEFIALCLDEDPNERLSADELLK 290

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 97/202 (48%), Gaps = 37/202 (18%)

Query: 104 EVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIE 163
           +V +  E+C    L D +   LQ R+     + + +Q+   V   HSL    +HRD+K+E
Sbjct: 103 KVWMAQEYCPGKDLYDHV-LSLQ-RVPSSACIELFTQIVGAVYYAHSLN--CVHRDLKLE 158

Query: 164 NVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNT------TAQYRAPEMIDL 217
           N+L+  +G  KL DFG                F +  + K +      T  Y APE+I  
Sbjct: 159 NILLDKNGNAKLTDFG----------------FTRECMTKTSLETICGTTVYMAPELIKR 202

Query: 218 SRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYL-AYPHYSDNL----- 271
             +     K DIW+LGV LY +   + PF++  E     + ++ +   P ++D +     
Sbjct: 203 ESYDGF--KIDIWSLGVILYTMLNGSMPFDEDDETK---TEWKIMNEMPVFNDTILSEDA 257

Query: 272 KNLIRLMLANQPSQRPNICQVL 293
           K+L+  +L+  P++RP++ ++L
Sbjct: 258 KDLLIKLLSKDPNERPSMQEIL 279

>YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON}
           FRK1Protein kinase of unknown cellular role; similar to
           Kin4p; green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm; interacts with rRNA
           transcription and ribosome biogenesis factors and the
           long chain fatty acyl-CoA synthetase Faa3
          Length = 865

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 67/247 (27%), Positives = 118/247 (47%), Gaps = 30/247 (12%)

Query: 57  RLIVPDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGG 116
           +LI  D  S N  R EV   + +    H+ S+ +    +  L N  Y + +++E+   G 
Sbjct: 80  KLIKRDSIS-NDYRKEVKIYREINALKHL-SHPNIVKLEEVLQNSRY-IGIVLEYACGGE 136

Query: 117 LIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLC 176
              ++  +   RL+E     + SQ+  GV  +HS    L+HRD+K+EN+L+  +    + 
Sbjct: 137 FYKYIQKK--RRLKEMNACRLFSQLISGVHYIHSKG--LVHRDLKLENLLLDKNENLVIT 192

Query: 177 DFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQ--YRAPEMIDLSRHLPIDEKSDIWALGV 234
           DFG V           EF   +++++K +     Y APE++ +S       K+DIW+ GV
Sbjct: 193 DFGFV----------NEF-CSRNELMKTSCGSPCYAAPELV-ISAEPYEARKADIWSCGV 240

Query: 235 FLYKLCYYTTPFEKA---GEAAILHSRYEY-----LAYPHYSDNL-KNLIRLMLANQPSQ 285
            LY +     P++      E + +   Y Y     L +P Y   + ++L+R ML + P +
Sbjct: 241 ILYAILAGYLPWDDDPNNPEGSDIGRLYNYINSTPLKFPDYILPIPRDLLRRMLVSDPKK 300

Query: 286 RPNICQV 292
           R N+ Q+
Sbjct: 301 RINLKQI 307

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 70/284 (24%), Positives = 132/284 (46%), Gaps = 38/284 (13%)

Query: 27  YLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDH-- 84
           +L  GG+A+ +Q K    DS     I   K +      S  T +  +  +++ ++  H  
Sbjct: 82  FLGEGGFARCFQMK---DDS---GKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMKHPN 135

Query: 85  VVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQG 144
           +V +ID     +        V +L+E C  G L+D +  R    L E E+    +Q+   
Sbjct: 136 IVQFIDCFEDDTN-------VYILLEICPNGSLMDLLKKR--KVLTEPEVRYFTTQIVGA 186

Query: 145 VAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKN 204
           +  MH+    ++HRD+K+ N+   ++   K+ DFG     +     ++++          
Sbjct: 187 IKYMHNRR--VIHRDLKLGNIFFDSNYNLKIGDFG--LAAVLANDRERKYTVC------- 235

Query: 205 TTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRY---EY 261
            T  Y APE++   +H     + DIW++GV +Y L     PF+ A E  I++ R    +Y
Sbjct: 236 GTPNYIAPEVL-AGKHSGHSYEVDIWSIGVMIYALLIGKPPFQ-AKEVNIIYERIKSGDY 293

Query: 262 LAYPH---YSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQGI 302
           + +P     S  +  LI+ +L+  P +RP++ ++++ V   +GI
Sbjct: 294 I-FPREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYVW-FRGI 335

>Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL095W
            (REAL)
          Length = 1481

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 98/206 (47%), Gaps = 28/206 (13%)

Query: 48   TGSDIVCLKRLIVP-----DKASLNTPRAEVDAMKLLRNFDH--VVSYIDSNAAKSGLHN 100
            T  +++ +K++ VP     ++A L T  A    +  L++ DH  +V Y+       G  N
Sbjct: 1199 TTGEMMAVKQVEVPKYSSQNEAILGTVEALRSEVSTLKDLDHLNIVQYL-------GFEN 1251

Query: 101  GAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDI 160
                  L +E+ A G +   +  R+  R  E  I ++ +QV +G+A +HS    +LHRD+
Sbjct: 1252 KNNIYSLFLEYVAGGSVGSLI--RMYGRFDESLIRHLTTQVLKGLAYLHS--KGILHRDM 1307

Query: 161  KIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRH 220
            K +N+L+   G  K+ DFG         + + +  +   D+    T  + APEM+D  + 
Sbjct: 1308 KADNLLLDQDGICKISDFGI--------SRKSKDIYSNSDMTMRGTVFWMAPEMVDTKQG 1359

Query: 221  LPIDEKSDIWALGVFLYKLCYYTTPF 246
                 K DIW+LG  + ++     P+
Sbjct: 1360 Y--SAKVDIWSLGCIVLEMFAGKRPW 1383

>Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}
           (4910..5845,5849..7711) [2799 nt, 933 aa]
          Length = 932

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 88/181 (48%), Gaps = 27/181 (14%)

Query: 117 LIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLC 176
           L DF+  +  +++ E E   I  Q+  G+  +H L   ++HRDIK EN++I + G  ++ 
Sbjct: 766 LFDFIEKK--DKIDEVEQKLIFKQIVAGIKHIHGL--GIIHRDIKTENIIIDSEGCVQVI 821

Query: 177 DFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEK-SDIWALGVF 235
           DFGS       P        V H      T  Y +PE++   +  P + K  D+WALG+ 
Sbjct: 822 DFGSAAYATNGPFQ------VFH-----GTIDYASPEVL---KGEPYEGKPQDVWALGIL 867

Query: 236 LYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKN----LIRLMLANQPSQRPNICQ 291
           LY + +  TPF    E  I+ +  E    P +S+N+ +    LI  ML  +   RP I +
Sbjct: 868 LYIITFKQTPFNSVAE--IIENELE--IDPAHSENVSDQCRVLIHKMLDKKAWARPKISE 923

Query: 292 V 292
           +
Sbjct: 924 I 924

>TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.591
           YDR466W
          Length = 694

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 71/285 (24%), Positives = 121/285 (42%), Gaps = 41/285 (14%)

Query: 20  HHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLL 79
           H     + L  G Y+ VY+A      +R  +  VC K+ I+ +K  +     E + + LL
Sbjct: 10  HDFVFKQELGHGSYSTVYKAVDRTNANRVYAIKVCSKQHIIKEK-KVKYVTIEKNTLNLL 68

Query: 80  RNFDHVVSYIDSNAAKSGLHNGAYE---VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILN 136
               H             LH   ++   +  ++++   G L+  ++ R++    E    +
Sbjct: 69  TRARH--------PGIVKLHYTFHDEENLYFVLDYAPGGELLSLLH-RMKT-FSEMWACH 118

Query: 137 IMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNF 196
              Q+   +  +HS    ++HRD+K EN+L++N G   + DFG+  G     T  +  +F
Sbjct: 119 FTCQLIDSMQFLHSQG--IIHRDLKPENLLLNNEGRLMITDFGTATG-----TDSRGSSF 171

Query: 197 VQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILH 256
           V        TA+Y +PE++    H   D  SDIWALG  +Y+    + PF    E     
Sbjct: 172 V-------GTAEYVSPELL---LHNQCDVSSDIWALGCMIYQFLQGSPPFRGENELQTFE 221

Query: 257 SRYEYLAYPHYSDNLK---------NLIRLMLANQPSQRPNICQV 292
                L YP  +  +          +L R +L   PS RP + Q+
Sbjct: 222 KTVS-LDYPWNNPQVTPKGINPVVVDLTRRILVLDPSVRPTLQQI 265

>CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa]
           {ON} highly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141c or uniprot|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4
          Length = 756

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/207 (27%), Positives = 100/207 (48%), Gaps = 30/207 (14%)

Query: 98  LHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLH 157
           L N  Y + +++E+ A G    F+  +   RL+E     + SQ+   V  +HS    L+H
Sbjct: 136 LQNSKY-IGIVLEYAAGGEFYKFIQRK--RRLKENHACRLFSQLISAVHYIHS--KGLVH 190

Query: 158 RDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQ--YRAPEMI 215
           RD+K+EN+L+ N     + DFG V   +R           Q+ ++K +     Y APE++
Sbjct: 191 RDLKLENLLLDNEENLIITDFGFVNEFLR-----------QNGMMKTSCGSPCYAAPELV 239

Query: 216 DLSRHLPID-EKSDIWALGVFLYKLCYYTTPFE---KAGEAAILHSRYEY-----LAYPH 266
             +R  P D  K+D W+ G+ L+ +     P++   K  +   +   Y Y     L +P 
Sbjct: 240 VSNR--PYDARKADTWSCGIILFAMLAGYLPWDDDPKNPDGHDISRLYNYILNTPLKFPE 297

Query: 267 YSDNL-KNLIRLMLANQPSQRPNICQV 292
           Y + + ++L+R +L   P +R NI  +
Sbjct: 298 YINPVPRDLLRKILVIDPKKRINIRSI 324

>Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W
           (REAL)
          Length = 1066

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 104/224 (46%), Gaps = 46/224 (20%)

Query: 107 LLMEFCAEGGLIDFMNTRLQN-RLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENV 165
           +L E+ + G L+D++   +Q+  ++E +       +   +  +H+    ++HRD+KIEN+
Sbjct: 219 MLFEYVSGGQLLDYI---IQHGSIREHQARKFARGIASALMYLHANN--IVHRDLKIENI 273

Query: 166 LISNSGEYKLCDFG------------SVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPE 213
           +IS+S E K+ DFG            + CG +          F   ++LK     Y  PE
Sbjct: 274 MISDSSEIKIIDFGLSNLYDSRKQLHTFCGSLY---------FAAPELLK--AHPYTGPE 322

Query: 214 MIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEY--LAYP-HYSDN 270
           +             D+W+ GV L+ L     PF+    +++LH + +   + YP H S  
Sbjct: 323 V-------------DVWSFGVVLFVLVCGKVPFDDEN-SSVLHEKIKQGKVEYPQHLSIE 368

Query: 271 LKNLIRLMLANQPSQRPNICQVLEEVSRLQGIPCPIKNFYLERA 314
           + +L+  ML   P +R  + QV+E    ++G   P  ++  +R 
Sbjct: 369 VISLLSKMLVVDPKRRATLKQVVEHHWMVRGFNAPPPSYLPKRV 412

>Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {ON}
           YDR122W (KIN1) - Serine/threonine protein kinase [contig
           174] PARTIAL
          Length = 858

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/214 (26%), Positives = 98/214 (45%), Gaps = 28/214 (13%)

Query: 107 LLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVL 166
           +L E+ + G L+D++       L+E         +   +  +H     ++HRD+KIEN++
Sbjct: 10  MLFEYVSGGQLLDYIIQ--HGSLRERSARKFARGIASALQYLHMNN--IVHRDLKIENIM 65

Query: 167 ISNSGEYKLCDFGSVCGVIRPPTSQQEF----NFVQHDILKNTTAQYRAPEMIDLSRHLP 222
           IS SGE K+ DFG +  +  P      F     F   ++LK     Y  PE+        
Sbjct: 66  ISTSGEIKIIDFG-LSNMYNPKKQLHTFCGSLYFAAPELLK--ACPYTGPEV-------- 114

Query: 223 IDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEY--LAYP-HYSDNLKNLIRLML 279
                D+W+ GV L+ L     PF+    +++LH + +   + YP H S  + +L+  ML
Sbjct: 115 -----DVWSFGVVLFVLVCGKVPFDDEN-SSVLHEKIKQGKVEYPQHLSIEVISLLSKML 168

Query: 280 ANQPSQRPNICQVLEEVSRLQGIPCPIKNFYLER 313
              P++R ++ QV+      +G   P  ++   R
Sbjct: 169 VVDPTKRASLKQVVNHQWMQRGYDFPAPSYIPHR 202

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 92/195 (47%), Gaps = 27/195 (13%)

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIEN 164
           V L+ME+   G L   +  +    + +    N + Q+T  +  MH  +  ++HRD+K EN
Sbjct: 191 VYLVMEYLIGGELYKLL--KKNGPMNDITASNYVYQMTDALNYMHKRK--IIHRDLKPEN 246

Query: 165 VLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPID 224
           +LI  + + KL DFG     I  P +Q+             T  Y +PE+I    +   D
Sbjct: 247 ILIGFNNQIKLTDFG---WSIYNPNNQKRKTLC-------GTIDYLSPELISSREY---D 293

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAY------PHYSDNLKNLIRLM 278
           E  D+WALG+  Y+L     PFE+  +       Y+ +A       P+ S   ++LI  +
Sbjct: 294 ENVDVWALGILTYELVVGAPPFEEDTKEQT----YKRIAKSDLKFPPNVSSEARDLITNL 349

Query: 279 LANQPSQRPNICQVL 293
           L   PS+R N+ QV+
Sbjct: 350 LKVVPSERFNLQQVM 364

>YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}
           PKH1Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh2p
          Length = 766

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 92/194 (47%), Gaps = 13/194 (6%)

Query: 105 VLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIEN 164
           +  L+E+   G  +  +  +    L E       SQ+   V ++H++   ++HRDIK EN
Sbjct: 199 LYFLLEYAPHGDFLGLI--KKYGSLNETCARYYASQIIDAVDSLHNIG--IIHRDIKPEN 254

Query: 165 VLISNSGEYKLCDFGSVCGVIRPPTSQQE----FNFVQHDILKNTTAQYRAPEMIDLSRH 220
           +L+  + + KL DFG+   +   P++  +    F+          TA+Y +PE+++ +  
Sbjct: 255 ILLDKNMKVKLTDFGTAKILPEEPSNTADGKPYFDLYAKSKSFVGTAEYVSPELLNDNY- 313

Query: 221 LPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHS--RYEYLAYPHYSDNLKNLIRLM 278
              D + DIWA G  LY++     PF+ A E        + +Y     +   +K+L++ +
Sbjct: 314 --TDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTAGFPQIVKDLVKKL 371

Query: 279 LANQPSQRPNICQV 292
           L   P+ R  I Q+
Sbjct: 372 LVRDPNDRLTIKQI 385

>YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}
           PKH2Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh1p
          Length = 1081

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 66/285 (23%), Positives = 121/285 (42%), Gaps = 22/285 (7%)

Query: 15  LQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVD 74
           ++ G+        +  G Y+ V  A       R  + ++  + LI   K    +   E  
Sbjct: 172 IKKGIKDFKFGSVIGDGAYSTVMLATSIDTKKRYAAKVLNKEYLIRQKKVKYVS--IEKT 229

Query: 75  AMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEI 134
           A++ L N   VV    +   +S L+        L+E+   G  +  M  +    L E   
Sbjct: 230 ALQKLNNSPSVVRLFSTFQDESSLY-------FLLEYAPNGDFLSLM--KKYGSLDETCA 280

Query: 135 LNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRP---PTSQ 191
               +Q+   +  +HS    ++HRDIK EN+L+    + KL DFG+   ++ P     S+
Sbjct: 281 RYYAAQIIDAIDYLHS--NGIIHRDIKPENILLDGEMKIKLTDFGT-AKLLNPTNNSVSK 337

Query: 192 QEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGE 251
            E++          TA+Y +PE+++ S     D + DIWA G  L+++     PF+   E
Sbjct: 338 PEYDLSTRSKSFVGTAEYVSPELLNDSF---TDYRCDIWAFGCILFQMIAGKPPFKATNE 394

Query: 252 AAILHS--RYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLE 294
                   + +Y   P +   +++L++ +L     +R  I Q+ E
Sbjct: 395 YLTFQKVMKVQYAFTPGFPLIIRDLVKKILVKNLDRRLTISQIKE 439

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 68/290 (23%), Positives = 125/290 (43%), Gaps = 61/290 (21%)

Query: 27  YLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNTPRAEVDAMKLLRNFDHV- 85
           +L  GG+A+ +Q +    DS     I   K +      S  T +  +  +++ ++  HV 
Sbjct: 100 FLGEGGFARCFQIR---DDS---GKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMKHVN 153

Query: 86  -VSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQG 144
            V +ID     +        V +L+E C  G L+D +  R    L E E+    +Q+   
Sbjct: 154 IVQFIDCFEDDTN-------VYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGA 204

Query: 145 VAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFG-------------SVCGVIRPPTSQ 191
           +  MHS +  ++HRD+K+ N+        K+ DFG             +VCG        
Sbjct: 205 IKYMHSRK--VIHRDLKLGNIFFDRKYNLKIGDFGLAATLANDRERKYTVCG-------- 254

Query: 192 QEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGE 251
                         T  Y APE++ + +H     + DIW++GV +Y L     PF+ + +
Sbjct: 255 --------------TPNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALIIGRPPFQ-SKD 298

Query: 252 AAILHSRYEYLAYPHYSDNL-----KNLIRLMLANQPSQRPNICQVLEEV 296
              ++ R +   +    D L     K LI+ +L+  P +RP++ ++++ +
Sbjct: 299 VNTIYERIKCRDFSFPKDKLISSEAKILIQDILSLDPLERPSVNEIMDYI 348

>Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON}
           similar to Ashbya gossypii AGR058W
          Length = 1145

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 95/202 (47%), Gaps = 20/202 (9%)

Query: 107 LLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVL 166
           +L E+ + G L+D++       L+E         +   +  +H     ++HRD+KIEN++
Sbjct: 218 MLFEYVSGGQLLDYIIQ--HGSLRERHARKFARGIASALQYLHMNN--IVHRDLKIENIM 273

Query: 167 ISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEK 226
           IS+SGE ++ DFG +  +  P      F           +  + APE+  L  H     +
Sbjct: 274 ISSSGEIRIIDFG-LSNLYDPKKQLHTF---------CGSLYFAAPEL--LKAHPYTGPE 321

Query: 227 SDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEY--LAYP-HYSDNLKNLIRLMLANQP 283
            DIW+ GV LY L     PF+    A++LH + +   + YP H S ++ +L+  ML   P
Sbjct: 322 VDIWSFGVVLYVLVCGKVPFDDEN-ASVLHEKIKQGKVEYPQHLSIDVISLLSKMLVVDP 380

Query: 284 SQRPNICQVLEEVSRLQGIPCP 305
            +R  + QV+      +G   P
Sbjct: 381 LKRATLKQVVNHQWMQKGYDFP 402

>TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {ON}
           Anc_5.406 YHR102W
          Length = 996

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 65/241 (26%), Positives = 110/241 (45%), Gaps = 29/241 (12%)

Query: 72  EVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQE 131
           E+  + LLR   ++  Y  S            ++ ++ME+C  G + + +      R  E
Sbjct: 52  EIKFLSLLRYAPNITYYYHSYLINR-------KIWIIMEYCNGGSVRNLIKI---GRFNE 101

Query: 132 FEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQ 191
             I  I+ ++   +  +H     ++HRDIK  N+LI+ +G  KLCDFG    +       
Sbjct: 102 IYISVILRELLYALEYIH--HDNIIHRDIKAANILINQNGGIKLCDFGIAAKL------- 152

Query: 192 QEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEK--A 249
            EF+  +   +   T  + APE+I  S     D K+DIW++G+  Y++     P+ +  A
Sbjct: 153 -EFSKPKRQTMAG-TPYWMAPEVIIESSLY--DTKADIWSVGITAYEITTGNPPYCEYDA 208

Query: 250 GEAAILHSRYE--YLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEE--VSRLQGIPCP 305
            +A  L ++ +   L    YS +LK  I L L   PS+R    ++LE   +   Q  P  
Sbjct: 209 TKAMQLITKLKPPRLEGKMYSKSLKEFIALCLDEDPSERLTSTKLLETEFIKEYQETPTK 268

Query: 306 I 306
           I
Sbjct: 269 I 269

>YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}
            BCK1Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway, which
            controls cell integrity; upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1478

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 99/206 (48%), Gaps = 28/206 (13%)

Query: 48   TGSDIVCLKRLIVP-----DKASLNTPRAEVDAMKLLRNFDH--VVSYIDSNAAKSGLHN 100
            T  +++ +K++ VP     ++A L+T  A    +  L++ DH  +V Y+       G  N
Sbjct: 1196 TTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLNIVQYL-------GFEN 1248

Query: 101  GAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDI 160
                  L +E+ A G +   +  R+  R  E  I ++ +QV +G+A +HS    +LHRD+
Sbjct: 1249 KNNIYSLFLEYVAGGSVGSLI--RMYGRFDEPLIKHLTTQVLKGLAYLHSKG--ILHRDM 1304

Query: 161  KIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRH 220
            K +N+L+   G  K+ DFG         + + +  +   D+    T  + APEM+D  + 
Sbjct: 1305 KADNLLLDQDGICKISDFGI--------SRKSKDIYSNSDMTMRGTVFWMAPEMVDTKQG 1356

Query: 221  LPIDEKSDIWALGVFLYKLCYYTTPF 246
                 K DIW+LG  + ++     P+
Sbjct: 1357 Y--SAKVDIWSLGCIVLEMFAGKRPW 1380

>TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1.271
            YJL095W
          Length = 1429

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 97/206 (47%), Gaps = 28/206 (13%)

Query: 48   TGSDIVCLKRLIVPDKASLN-----TPRAEVDAMKLLRNFDH--VVSYIDSNAAKSGLHN 100
            T  +++ +K++ VP   S N     T  A    M  L+N DH  +V Y+       G   
Sbjct: 1145 TTGEMMAVKQVEVPKYGSQNEQIIHTVEALRAEMSTLKNLDHLNIVQYL-------GFEA 1197

Query: 101  GAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDI 160
              +   L +E+ A G +   +  R+  R  E  I ++ +QV +G++ +HS    +LHRD+
Sbjct: 1198 KDHMNSLFLEYVAGGSVGSLI--RMYGRFDEVMIKHLTTQVLRGLSYLHSRG--ILHRDM 1253

Query: 161  KIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRH 220
            K +N+L+   G  K+ DFG         + + +  +   ++    T  + APEM+D ++ 
Sbjct: 1254 KADNLLLDQEGVCKISDFGI--------SRKSKDIYSNSEMTMRGTVFWMAPEMVDTAQG 1305

Query: 221  LPIDEKSDIWALGVFLYKLCYYTTPF 246
                 K DIW++G  + ++     P+
Sbjct: 1306 Y--SAKVDIWSMGCVVLEMFAGKRPW 1329

>KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {ON}
           weakly similar to uniprot|Q03306 YDR466W Saccharomyces
           cerevisiae YDR466W Protein kinase with similarity to
           mammalian phosphoinositide-dependent kinase 1 (PDK1) and
           yeast Pkh1p and Pkh2p, two redundant upstream activators
           of Pkc1p; identified as a multicopy suppressor of a pkh1
           pkh2 double mutant
          Length = 647

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 124/290 (42%), Gaps = 50/290 (17%)

Query: 28  LTSGGYAQVYQAKISPPDSRTGSDI---VCLKRLIVPDKASLNTPRAEVDAMKLLRNFDH 84
           L  G Y+ VY+A     D  TG      VC K+ I+ +   +     E + + LL + +H
Sbjct: 16  LGHGSYSTVYKAV----DRSTGQLFAIKVCSKKHIISEN-KVKYVTIEKNTLNLLAHGNH 70

Query: 85  ------VVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIM 138
                   ++ DS             +  +++F   G L+  + T  Q R  E    + M
Sbjct: 71  PGIIKLYYTFHDSE-----------NLYFVLDFAPGGELLQLLQT--QGRFNEAWTKHFM 117

Query: 139 SQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQ 198
            Q+   +  +H  +  ++HRD+K EN+L+S+ G+  + DFG    +          +FV 
Sbjct: 118 CQLIDALEYIHGCK--VVHRDLKPENLLLSSEGKLMITDFGVASNLAATDNLSSTSSFV- 174

Query: 199 HDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAI---- 254
                  TA+Y +PE++  ++    +  SDIWA+G  LY+    T PF    E A     
Sbjct: 175 ------GTAEYVSPELLLQNKS---NFCSDIWAVGCMLYQFTQGTPPFRGENELAAFEKI 225

Query: 255 --LHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQGI 302
             L   + Y+   H +D    L+  +L   P  R  + Q+ +  +  QGI
Sbjct: 226 VNLDYHWIYMVSQHITD----LVSKILVLDPDSRYTLPQI-KNHAWFQGI 270

>YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One of two
            (see also PSK2) PAS domain containing S/T protein
            kinases; coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1356

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 83/181 (45%), Gaps = 18/181 (9%)

Query: 113  AEGGLIDFMN-TRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSG 171
             E G ID  +    +  + EFE   I  QV  G+  +H  +  ++HRDIK ENV++ + G
Sbjct: 1185 GETGCIDLFDLIEFKTNMTEFEAKLIFKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKG 1242

Query: 172  EYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWA 231
              K+ DFGS   V   P           D+   T   Y APE++  + +    +  DIWA
Sbjct: 1243 FVKIIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGNPYE--GQPQDIWA 1289

Query: 232  LGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQ 291
            +G+ LY + +   PF    E  IL    ++      S++   LI+ +L     +RP I  
Sbjct: 1290 IGILLYTVVFKENPFYNIDE--ILEGDLKFNNAEEVSEDCIELIKSILNRCVPKRPTIDD 1347

Query: 292  V 292
            +
Sbjct: 1348 I 1348

>ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} similar
           to Saccharomyces cerevisiae YPL141C and to YOR233W
           uniprot|Q01919 Saccharomyces cerevisiae YOR233W KIN4
           Nonessential protein kinase with unknown cellular role
          Length = 843

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 97/202 (48%), Gaps = 32/202 (15%)

Query: 98  LHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLH 157
           L N  Y + +++E+ + G    ++  +   RL+E     + +Q+  GV  MHS    L+H
Sbjct: 113 LQNSKY-IGIVLEYASGGEFYKYIQRK--RRLKEAIACRLFAQLVSGVNYMHSKG--LVH 167

Query: 158 RDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQ---YRAPEM 214
           RD+K+EN+L+       + DFG V              FV H+ L  T+     Y APE+
Sbjct: 168 RDLKLENLLLDKHENLVITDFGFVN------------EFVSHNELMKTSCGSPCYAAPEL 215

Query: 215 IDLSRHLPID-EKSDIWALGVFLYKLCYYTTPFE---KAGEAAILHSRYEY-----LAYP 265
           +  ++  P +  KSD+W+ GV LY +     P++   K  +   +   Y Y     L +P
Sbjct: 216 VVSTK--PYEARKSDVWSCGVILYAMLAGYLPWDDDPKNPDGNDIVRLYYYITRTPLKFP 273

Query: 266 HYSDNL-KNLIRLMLANQPSQR 286
            Y   L ++L+R +L + P +R
Sbjct: 274 EYITPLSRDLLRRILVSDPKKR 295

>TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1218

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 120/250 (48%), Gaps = 37/250 (14%)

Query: 63  KASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYE---------------VLL 107
           +ASL  P++E +A++  +N +  +S       ++ L    Y                  +
Sbjct: 196 EASLPPPKSEEEALERQKNLEKEISRDKRTIREASLGQILYHPHICRLFEICTMSNHFYM 255

Query: 108 LMEFCAEGGLIDFMNTRLQN-RLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVL 166
           L E+ + G L+D++   +Q+  L+E         +   +  +H     ++HRD+KIEN++
Sbjct: 256 LFEYVSGGQLLDYI---IQHGSLREHHARKFTRGIASALQYLHGNN--IVHRDLKIENIM 310

Query: 167 ISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEK 226
           IS SG+ K+ DFG +  +     S+++ N     +       + APE++  + +  +  +
Sbjct: 311 ISTSGDIKIIDFG-LSNLY---DSKKQLNTFCGSLY------FAAPELLKANPY--VGPE 358

Query: 227 SDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEY--LAYP-HYSDNLKNLIRLMLANQP 283
            DIW+ GV LY L     PF+    +++LH + +   + YP H S  + +L+  ML   P
Sbjct: 359 VDIWSFGVVLYVLACGKVPFDDEN-SSVLHEKIKQGKVDYPQHLSIEVISLLSKMLVVDP 417

Query: 284 SQRPNICQVL 293
            +R ++ Q++
Sbjct: 418 KKRASLQQIV 427

>Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL095W
            (REAL)
          Length = 1478

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 99/206 (48%), Gaps = 28/206 (13%)

Query: 48   TGSDIVCLKRLIVP-----DKASLNTPRAEVDAMKLLRNFDH--VVSYIDSNAAKSGLHN 100
            T  +++ +K++ VP     ++A L+T  A    +  L++ DH  +V Y+       G  N
Sbjct: 1196 TTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLNIVQYL-------GFEN 1248

Query: 101  GAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDI 160
                  L +E+ A G +   +  R+  R  E  I ++ +QV +G+A +HS    +LHRD+
Sbjct: 1249 KDNIYSLFLEYVAGGSVGSLI--RMYGRFDEPLIKHLTTQVLKGLAYLHS--KGILHRDM 1304

Query: 161  KIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRH 220
            K +N+L+   G  K+ DFG         + + +  +   D+    T  + APEM+D  + 
Sbjct: 1305 KADNLLLDQDGICKISDFGI--------SRKSKDIYSNSDMTMRGTVFWMAPEMVDTKQG 1356

Query: 221  LPIDEKSDIWALGVFLYKLCYYTTPF 246
                 K DIW+LG  + ++     P+
Sbjct: 1357 Y--SAKVDIWSLGCIVLEMFAGKRPW 1380

>CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31
          Length = 1336

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 81/179 (45%), Gaps = 20/179 (11%)

Query: 113  AEGGLIDFMN-TRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSG 171
             E G ID  +    +  + E E   +  QV  GV  +H  +  ++HRDIK EN+++ + G
Sbjct: 1165 GETGSIDLFDLIEFKTNMTEIEAKLLFKQVVSGVKHLH--DQGIVHRDIKDENIIVDSQG 1222

Query: 172  EYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEK-SDIW 230
              K+ DFGS   V   P           D+   T   Y APE++  S   P + K  DIW
Sbjct: 1223 FVKIIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGS---PYEGKPQDIW 1268

Query: 231  ALGVFLYKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNI 289
            A+G+ LY + +   PF    E  IL    ++ +    S+    LI  +L     +RP I
Sbjct: 1269 AIGILLYTIVFKENPFYNIDE--ILEGELKFNSSELVSEQCTTLIAKILNRNVQKRPTI 1325

>Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON}
           YHL007C (REAL)
          Length = 939

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 107/229 (46%), Gaps = 30/229 (13%)

Query: 72  EVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQE 131
           E+  MK  R+  ++V++IDS   K  L        ++ME+   G L D +   +   L E
Sbjct: 667 EILVMKGSRH-PNIVNFIDSYVLKGDL-------WVIMEYMEGGSLTDVVTHCI---LTE 715

Query: 132 FEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQ 191
            +I  +  +   G+  +HS    +LHRDIK +N+L+S  G+ KL DFG  C  I      
Sbjct: 716 GQIGAVCRETLSGLKFLHSKG--VLHRDIKSDNILLSMEGDIKLTDFG-FCAQI------ 766

Query: 192 QEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGE 251
            E N  +  ++   T  + APE++    + P   K DIW+LG+ + ++     P+     
Sbjct: 767 NELNLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETP 821

Query: 252 AAILH----SRYEYLAYP-HYSDNLKNLIRLMLANQPSQRPNICQVLEE 295
              L+    +    L  P + S +LK  +   L  +P +R +  ++L +
Sbjct: 822 LRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEERASATELLHD 870

>Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W
           (REAL)
          Length = 1089

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 55/222 (24%), Positives = 101/222 (45%), Gaps = 44/222 (19%)

Query: 107 LLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVL 166
           +L E+ + G L+D++       ++E +       +   +  +H+    ++HRD+KIEN++
Sbjct: 232 MLFEYVSGGQLLDYIIQ--HGSIREHQARKFARGIASALMYLHANN--IVHRDLKIENIM 287

Query: 167 ISNSGEYKLCDFG------------SVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEM 214
           IS+S E K+ DFG            + CG +          F   ++LK     Y  PE+
Sbjct: 288 ISDSSEIKIIDFGLSNLYDSRKQLHTFCGSLY---------FAAPELLKANP--YTGPEV 336

Query: 215 IDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEKAGEAAILHSRYEY--LAYP-HYSDNL 271
                        D+W+ GV L+ L     PF+    +++LH + +   + YP H S  +
Sbjct: 337 -------------DVWSFGVVLFVLVCGKVPFDDEN-SSVLHEKIKQGKVEYPQHLSIEV 382

Query: 272 KNLIRLMLANQPSQRPNICQVLEEVSRLQGIPCPIKNFYLER 313
            +L+  ML   P +R  + QV+E    ++G   P  ++  +R
Sbjct: 383 ISLLSKMLVVDPKRRATLKQVVEHHWMVRGFDGPPPSYLPKR 424

>ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOL045W and
            YAL017W (FUN31)
          Length = 1259

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 49/141 (34%), Positives = 67/141 (47%), Gaps = 18/141 (12%)

Query: 113  AEGGLIDFMN-TRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSG 171
             E G ID  +   L+  + E E   +  QV  G+  +H  E  ++HRDIK ENV++ N G
Sbjct: 1088 GETGSIDLFDLIELKTNMTEHEAKLLFKQVASGLRHLH--ENGIVHRDIKDENVIVDNRG 1145

Query: 172  EYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEK-SDIW 230
              K+ DFGS   V R P           D+   T   Y APE++      P + K  D+W
Sbjct: 1146 RVKIIDFGSAAYVKRGP----------FDVFVGTI-DYAAPEVLGGD---PYEGKPQDVW 1191

Query: 231  ALGVFLYKLCYYTTPFEKAGE 251
            A+GV LY + Y   PF    E
Sbjct: 1192 AVGVLLYTIIYKENPFYNIDE 1212

>KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly
           similar to uniprot|P27636 Saccharomyces cerevisiae
           YAR019C CDC15 Protein kinase of the Mitotic Exit Network
           that is localized to the spindle pole bodies at late
           anaphase promotes mitotic exit by directly switching on
           the kinase activity of Dbf2p
          Length = 797

 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 60/217 (27%), Positives = 102/217 (47%), Gaps = 35/217 (16%)

Query: 31  GGYAQVYQAKISPPDSRTGSDIVC-LKRLIVPDKASLNTPRAEVDAMKLLRNFDHVVSYI 89
           G Y  VY+A       + G++  C +K++   D++ LN    E+D +K LR+  ++V Y 
Sbjct: 19  GAYGVVYRA------VKRGTNKPCAIKQIEFEDESELNEHMLEIDLLKNLRH-QNIVEY- 70

Query: 90  DSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMH 149
                  G    A+E+ +++E+CA G L D +       L E + +N ++Q   G+  +H
Sbjct: 71  ------RGFIQKAHELYIILEYCARGSLRDILK---HGPLLEDDTVNYVTQTLYGLQYLH 121

Query: 150 SLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQY 209
             E  ++HRDIK  N+L++  G  KL DFG    + R   +               +  +
Sbjct: 122 --EQGVIHRDIKAANLLLTEEGIVKLADFGVSTRINRMAMTYA------------GSPNW 167

Query: 210 RAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPF 246
            APE++       +   SDIW+LG  + +L     PF
Sbjct: 168 MAPEVMTGQGASTV---SDIWSLGATVVELLTGNPPF 201

>Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C
           (REAL)
          Length = 865

 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 57/206 (27%), Positives = 101/206 (49%), Gaps = 28/206 (13%)

Query: 98  LHNGAYEVLLLMEFCAEGGLIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLH 157
           L N  Y + +++E+   G    ++  R   RL+E     + SQ+  GV  +HS    L+H
Sbjct: 119 LQNSRY-IGIVLEYACGGEFYRYIQKR--RRLKEINACRLFSQLISGVHYIHS--KGLVH 173

Query: 158 RDIKIENVLISNSGEYKLCDFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQ--YRAPEMI 215
           RD+K+EN+L+  +    + DFG V           EF   +++++K +     Y APE++
Sbjct: 174 RDLKLENLLLDKNENLVITDFGFV----------NEF-CSRNELMKTSCGSPCYAAPELV 222

Query: 216 DLSRHLPIDEKSDIWALGVFLYKLCYYTTPFE---KAGEAAILHSRYEY-----LAYPHY 267
            +S       K+DIW+ GV LY +     P++      E + +   Y Y     L +P Y
Sbjct: 223 -ISAEPYEARKADIWSCGVILYAMLAGYLPWDDDPNNPEGSDIGRLYNYISLTPLKFPDY 281

Query: 268 SDNL-KNLIRLMLANQPSQRPNICQV 292
              + ++L+R +L + P +R N+ Q+
Sbjct: 282 ILPIPRDLLRRILVSDPKRRINLKQI 307

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 67,970,432
Number of extensions: 2802573
Number of successful extensions: 10374
Number of sequences better than 10.0: 1830
Number of HSP's gapped: 9276
Number of HSP's successfully gapped: 1869
Length of query: 713
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 596
Effective length of database: 40,065,477
Effective search space: 23879024292
Effective search space used: 23879024292
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)