Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1003.342.283ON38836019170.0
Smik_14.2962.283ON38935812641e-174
Suva_14.3112.283ON38934712601e-173
Skud_14.2982.283ON38935412501e-171
YNL035C2.283ON38935412481e-171
TDEL0G021402.283ON39234712401e-170
KAFR0H033402.283ON36734411971e-164
ZYRO0A01804g2.283ON37634511961e-163
KLTH0G10296g2.283ON42634911871e-161
TPHA0C033702.283ON41335211821e-161
NDAI0G006302.283ON39734811701e-159
KLLA0E08449g2.283ON42233611711e-159
SAKL0E07766g2.283ON39835511631e-158
Kwal_27.115502.283ON40734911621e-158
TBLA0B059202.283ON40335711551e-157
KNAG0H020402.283ON39935111371e-154
Ecym_33212.283ON40934511281e-153
NCAS0G038702.283ON38935011031e-149
ADL218C2.283ON40334510781e-145
CAGL0G01628g2.283ON37635310461e-141
TBLA0A071206.9ON4071771462e-09
ZYRO0F00462g6.9ON3931191283e-07
KLTH0E12694g8.548ON418751256e-07
KLTH0C11550g6.9ON3981301222e-06
Skud_5.336.9ON4011851222e-06
Suva_5.126.9ON4011811203e-06
ACR017W6.9ON4231241194e-06
Ecym_30126.9ON3971751176e-06
CAGL0B03575g6.9ON4191751142e-05
KNAG0E009806.9ON4141791142e-05
Kpol_1045.786.9ON392631142e-05
TBLA0H036508.548ON4191911132e-05
Kwal_27.120708.548ON418731113e-05
SAKL0E00814g6.9ON3981801104e-05
KAFR0L003206.9ON3911991052e-04
NDAI0K029006.9ON4381411025e-04
Smik_5.316.9ON4271201017e-04
KLLA0D00814g6.9ON408981007e-04
KNAG0F038707.534ON465109970.002
Ecym_70428.548ON41475970.002
NCAS0G036001.399ON327186960.002
NCAS0G011206.276ON494169960.002
Kpol_1041.202.401ON515195960.003
Skud_7.5615.104ON59362960.003
KNAG0H016901.399ON303149930.004
Suva_7.519na 1ON20562900.007
CAGL0G04345g1.247ON711122920.008
KAFR0H031401.399ON303149910.009
ZYRO0E04620g1.399ON303149910.009
CAGL0H03729g1.399ON303149910.009
YEL056W (HAT2)6.9ON401120900.012
TBLA0H030601.247ON73081900.015
KLTH0F19338g3.22ON129065900.018
Suva_7.5185.104ON59362890.020
Suva_16.606.276ON52652890.021
Kwal_56.236858.288ON110245890.021
KNAG0A012503.25ON452150880.021
KLLA0E23541g8.548ON41782880.026
ZYRO0A08690g2.401ON516197880.026
Kpol_487.71.399ON303149860.033
KLTH0G13068g8.288ON110145870.036
TDEL0B059701.399ON303149860.036
Suva_14.3421.399ON303149850.041
Skud_14.3211.399ON303149850.041
ZYRO0F11484g7.338ON29481850.044
Smik_14.3221.399ON303149850.044
YNL006W (LST8)1.399ON303149850.044
Kpol_1036.658.316ON371185850.046
TPHA0M001906.9ON39177850.048
TPHA0D035906.276ON59872850.058
KLTH0H12122g1.399ON303149840.059
NDAI0C026001.399ON303155830.076
Kpol_467.202.469ON581144840.080
SAKL0D08756g1.399ON303149830.080
KLLA0F19734g8.288ON113345840.081
YPL247C6.276ON523210840.084
NCAS0F001906.9ON411158830.097
Smik_6.4516.276ON523121830.10
TPHA0G018408.631ON43168830.10
Kpol_1013.377.534ON468109830.11
Skud_16.326.276ON52252830.11
Smik_16.795.104ON59362830.11
KLTH0D15840g4.309ON69781830.12
YGR225W (AMA1)5.104ON59362830.12
Kpol_1060.246.276ON486120820.14
Kwal_55.220763.22ON128665820.16
NCAS0A151707.534ON474111810.16
KAFR0F010606.276ON553116810.16
Kwal_27.122398.585ON31668800.18
KLLA0E04819g7.534ON459146810.18
SAKL0H16390g8.288ON114045810.19
SAKL0C13332g3.22ON135365810.19
Kpol_1054.601.534ON71938810.19
Kwal_26.87008.651ON38176800.19
NDAI0F012406.276ON52452810.19
KLTH0D05346g2.469ON50758810.20
KNAG0D007406.276ON50452800.21
TDEL0A068906.276ON447166800.21
AFL157C6.276ON43896800.21
Suva_13.3112.401ON510197800.21
SAKL0H08932g8.585ON31477800.22
KLLA0D04840g1.399ON303138790.23
KLLA0D02530g4.309ON70745800.23
TPHA0O007101.399ON304149790.25
Ecym_42808.288ON113232800.25
ZYRO0E08184g6.276ON50652800.25
KLTH0A00880g7.534ON471114800.26
TDEL0E019605.429ON45246790.26
Smik_5.200na 2ON391224790.27
NCAS0F019702.401ON511197790.28
Kwal_47.173108.133ON553101790.29
Kwal_26.77362.469ON50758790.31
Suva_10.3027.338ON29780780.31
Skud_12.2727.338ON29780780.31
TBLA0A023106.276ON53149790.31
TPHA0G026502.401ON516195790.34
YLR208W (SEC13)7.338ON29780780.35
NDAI0H022402.469ON51483790.35
Kwal_56.223456.9ON39678780.36
CAGL0G09845g7.534ON500112780.37
Skud_6.638.67ON781210790.37
Smik_6.708.67ON783210790.37
CAGL0H08932g6.239ON902170790.38
NDAI0E015008.631ON42856780.39
Suva_6.518.67ON763210780.46
KLLA0F15598g5.201ON47824780.46
Kwal_0.2121.399ON303149770.47
Skud_12.2858.435ON817150780.47
KLLA0F10263g6.363ON68266780.48
Smik_16.4427.534ON47084770.49
TPHA0D011308.651ON451151770.53
CAGL0A00561g4.119ON41253770.53
Ecym_20243.22ON131765780.53
KNAG0E024702.469ON509122770.54
Smik_12.2667.338ON29780760.54
Suva_11.71.534ON719200770.56
ZYRO0D06556g8.288ON114750770.58
TPHA0D013908.699ON573110770.61
YDR128W (MTC5)8.288ON114839770.61
Smik_4.3748.288ON115239770.63
Smik_13.3292.401ON509197760.63
Suva_2.2918.288ON115139770.64
KAFR0A006902.469ON508131760.64
Kpol_530.397.338ON29483760.65
ZYRO0F09372g8.721ON448111760.68
KLTH0E13552g8.585ON31654760.68
Skud_4.3898.288ON115139770.68
KLTH0A02750g8.67ON753169760.70
Ecym_12931.399ON303229750.70
KAFR0F033404.119ON40946760.72
ZYRO0E07392g6.239ON89787760.76
Suva_5.178na 2ON322208750.77
Ecym_74032.469ON51753760.83
Suva_2.3038.316ON377179750.87
AFL118W6.239ON832190760.89
KNAG0E021802.401ON517198750.91
CAGL0K00275g1.534ON71566750.91
NCAS0I024903.95ON62665750.92
TPHA0A003803.22ON131054760.93
Kwal_47.175554.119ON41743750.94
KAFR0A033801.247ON666126750.95
Skud_13.2912.401ON509186750.98
YMR131C (RRB1)2.401ON511197750.98
KNAG0I010508.288ON115968750.98
ACR085Cna 3ON954118750.99
KLTH0G12276g8.324ON93732751.1
KAFR0A064804.122ON568124741.1
CAGL0K03861g2.401ON513186741.1
NCAS0H007007.338ON29779741.2
CAGL0J08778g7.338ON29880731.2
TDEL0A052908.585ON31956731.3
NCAS0A078602.469ON51053741.3
KAFR0L014407.338ON30479731.3
ZYRO0G10406g4.119ON39151731.4
CAGL0M02277g8.672ON427176731.5
Kwal_27.115858.435ON82389741.5
NDAI0G033108.67ON885209741.5
NDAI0D006307.338ON30079731.5
ZYRO0F05808g7.310ON128259741.6
NCAS0B078401.247ON589152731.6
NDAI0J011808.288ON113439741.6
KLLA0E20967g3.22ON132165741.6
NCAS0B036908.288ON114536741.6
YFL009W (CDC4)8.67ON779210731.6
KLTH0D10648g8.651ON44957731.7
NDAI0C057708.585ON33556721.7
YLR222C (UTP13)8.435ON817149731.8
SAKL0F10010gna 4ON334124721.8
ADL186C3.22ON136165731.8
NCAS0B035508.316ON37530721.9
CAGL0J01265g2.469ON517115731.9
CAGL0M05291g8.548ON41973721.9
KLLA0F17237g2.401ON52364722.0
AGR067W8.288ON112545722.3
KLTH0H02134g7.310ON129965722.3
KAFR0A003802.401ON516207722.3
Smik_13.2772.469ON51375722.4
KAFR0B055808.288ON112039722.5
ZYRO0G03146g2.469ON51086712.5
NCAS0F033405.429ON44841712.6
KLLA0A08866g4.119ON423200712.6
TDEL0G033402.401ON514197712.7
NCAS0E037507.310ON127658722.7
KLLA0D12760g6.276ON49365712.7
TDEL0A024502.469ON51075712.9
Skud_4.637.310ON127359722.9
NDAI0H027502.401ON512197712.9
TDEL0C020807.338ON29480702.9
Kwal_23.50358.67ON744176713.0
Kwal_26.76552.450ON74334713.0
Kpol_1038.203.22ON131354713.0
Suva_4.537.310ON127159713.1
TDEL0H003707.534ON46552713.1
KLTH0D04950g2.450ON78064713.2
AAL009C1.399ON303138703.2
TPHA0G025002.450ON94575713.4
Smik_12.525.201ON48953703.4
Kpol_1058.318.67ON675213713.4
KAFR0A043506.176ON1114113713.5
ACR097W8.631ON46797703.6
KLTH0D04466g2.431ON31940703.6
AGL190W8.316ON37032703.8
Kpol_1033.198.288ON113950703.8
Kwal_23.53517.534ON474125703.8
KNAG0D034604.119ON41258703.9
SAKL0G01628gna 3ON95981704.0
Kwal_26.75702.431ON21840684.0
NDAI0G038303.25ON510159704.2
SAKL0F15972g7.534ON470111704.3
Smik_12.2798.435ON817149704.3
YOR272W (YTM1)8.721ON460174694.3
KAFR0G019708.631ON42556694.3
KAFR0I006408.585ON31558694.3
TPHA0L016908.544ON83265704.4
Sklu_YGOB_Anc_2.4012.401ON520197694.4
KNAG0B055504.122ON617174704.5
Kpol_1072.418.631ON42057694.5
Skud_4.4018.316ON37636694.6
KLTH0D12672g8.737ON44584694.6
Ecym_21396.276ON43596694.7
NCAS0C044303.22ON131163704.7
NCAS0A093301.295ON122789704.8
Kwal_56.244787.310ON1296179704.9
Ecym_42558.324ON93732695.0
KNAG0G024508.324ON942164695.0
SAKL0H07656g8.631ON42675695.0
TDEL0G046206.9ON392197695.1
TBLA0A039508.324ON93629695.3
AFR199C2.431ON33445685.4
Kpol_1011.68.67ON762211695.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1003.34
         (388 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...   743   0.0  
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...   491   e-174
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...   489   e-173
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...   486   e-171
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...   485   e-171
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...   482   e-170
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...   465   e-164
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...   465   e-163
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...   461   e-161
TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {O...   459   e-161
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...   455   e-159
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...   455   e-159
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...   452   e-158
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...   452   e-158
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...   449   e-157
KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.2...   442   e-154
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...   439   e-153
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283    429   e-149
ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...   419   e-145
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...   407   e-141
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...    61   2e-09
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...    54   3e-07
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...    53   6e-07
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...    52   2e-06
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)    52   2e-06
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)    51   3e-06
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...    50   4e-06
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...    50   6e-06
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...    49   2e-05
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...    49   2e-05
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...    49   2e-05
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...    48   2e-05
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...    47   3e-05
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...    47   4e-05
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...    45   2e-04
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9      44   5e-04
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)    44   7e-04
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...    43   7e-04
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    42   0.002
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...    42   0.002
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...    42   0.002
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    42   0.002
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    42   0.003
Skud_7.561 Chr7 (920014..921196,921300..921898) [1782 bp, 593 aa...    42   0.003
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    40   0.004
Suva_7.519 Chr7 (900889..901503) [615 bp, 205 aa] {ON} YGR225W (...    39   0.007
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    40   0.008
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...    40   0.009
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...    40   0.009
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...    40   0.009
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...    39   0.012
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    39   0.015
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    39   0.018
Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa...    39   0.020
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    39   0.021
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    39   0.021
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    39   0.021
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...    39   0.026
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    39   0.026
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    38   0.033
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    38   0.036
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....    38   0.036
Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W...    37   0.041
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...    37   0.041
ZYRO0F11484g Chr6 complement(943018..943902) [885 bp, 294 aa] {O...    37   0.044
Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...    37   0.044
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...    37   0.044
Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa] ...    37   0.046
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...    37   0.048
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    37   0.058
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...    37   0.059
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}      37   0.076
Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,...    37   0.080
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...    37   0.080
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    37   0.081
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    37   0.084
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...    37   0.097
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    37   0.10 
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    37   0.10 
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    37   0.11 
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    37   0.11 
Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782...    37   0.11 
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    37   0.12 
YGR225W Chr7 (945145..946327,946421..947019) [1782 bp, 593 aa] {...    37   0.12 
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    36   0.14 
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    36   0.16 
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    36   0.16 
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    36   0.16 
Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa] ...    35   0.18 
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    36   0.18 
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    36   0.19 
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    36   0.19 
Kpol_1054.60 s1054 (148854..151013) [2160 bp, 719 aa] {ON} (1488...    36   0.19 
Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W...    35   0.19 
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    36   0.19 
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    36   0.20 
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    35   0.21 
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    35   0.21 
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    35   0.21 
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    35   0.21 
SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar...    35   0.22 
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...    35   0.23 
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    35   0.23 
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    35   0.25 
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    35   0.25 
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    35   0.25 
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    35   0.26 
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    35   0.26 
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    35   0.27 
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    35   0.28 
Kwal_47.17310 s47 (345235..346896) [1662 bp, 553 aa] {ON} YER124...    35   0.29 
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    35   0.31 
Suva_10.302 Chr10 (532343..533236) [894 bp, 297 aa] {ON} YLR208W...    35   0.31 
Skud_12.272 Chr12 (506157..507050) [894 bp, 297 aa] {ON} YLR208W...    35   0.31 
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    35   0.31 
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    35   0.34 
YLR208W Chr12 (559551..560444) [894 bp, 297 aa] {ON}  SEC13Struc...    35   0.35 
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    35   0.35 
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...    35   0.36 
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    35   0.37 
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    35   0.37 
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    35   0.37 
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    35   0.38 
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    35   0.39 
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    35   0.46 
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    35   0.46 
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...    34   0.47 
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...    35   0.47 
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...    35   0.48 
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    34   0.49 
TPHA0D01130 Chr4 (236199..237554) [1356 bp, 451 aa] {ON} Anc_8.6...    34   0.53 
CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON...    34   0.53 
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    35   0.53 
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    34   0.54 
Smik_12.266 Chr12 (506562..507455) [894 bp, 297 aa] {ON} YLR208W...    34   0.54 
Suva_11.7 Chr11 complement(15456..17615) [2160 bp, 719 aa] {ON} ...    34   0.56 
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    34   0.58 
TPHA0D01390 Chr4 (289408..291129) [1722 bp, 573 aa] {ON} Anc_8.6...    34   0.61 
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    34   0.61 
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    34   0.63 
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    34   0.63 
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    34   0.64 
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    34   0.64 
Kpol_530.39 s530 (90456..91340) [885 bp, 294 aa] {ON} (90456..91...    34   0.65 
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    34   0.68 
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    34   0.68 
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    34   0.68 
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    34   0.70 
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...    33   0.70 
KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.1...    34   0.72 
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    34   0.76 
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    33   0.77 
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    34   0.83 
Suva_2.303 Chr2 complement(535706..536839) [1134 bp, 377 aa] {ON...    33   0.87 
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    34   0.89 
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    33   0.91 
CAGL0K00275g Chr11 complement(26129..28276) [2148 bp, 715 aa] {O...    33   0.91 
NCAS0I02490 Chr9 complement(465916..467796) [1881 bp, 626 aa] {O...    33   0.92 
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    34   0.93 
Kwal_47.17555 s47 complement(453984..455237) [1254 bp, 417 aa] {...    33   0.94 
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    33   0.95 
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    33   0.98 
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    33   0.98 
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    33   0.98 
ACR085C Chr3 complement(508364..511228) [2865 bp, 954 aa] {ON} N...    33   0.99 
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...    33   1.1  
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    33   1.1  
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    33   1.1  
NCAS0H00700 Chr8 (125259..126152) [894 bp, 297 aa] {ON} Anc_7.33...    33   1.2  
CAGL0J08778g Chr10 (868299..869195) [897 bp, 298 aa] {ON} highly...    33   1.2  
TDEL0A05290 Chr1 complement(933493..934452) [960 bp, 319 aa] {ON...    33   1.3  
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    33   1.3  
KAFR0L01440 Chr12 complement(266463..267377) [915 bp, 304 aa] {O...    33   1.3  
ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {...    33   1.4  
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    33   1.5  
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...    33   1.5  
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    33   1.5  
NDAI0D00630 Chr4 (139065..139967) [903 bp, 300 aa] {ON} Anc_7.33...    33   1.5  
ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa] ...    33   1.6  
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    33   1.6  
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    33   1.6  
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    33   1.6  
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    33   1.6  
YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box ...    33   1.6  
KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 ...    33   1.7  
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    32   1.7  
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...    33   1.8  
SAKL0F10010g Chr6 (767640..768644) [1005 bp, 334 aa] {ON} simila...    32   1.8  
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    33   1.8  
NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {O...    32   1.9  
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    33   1.9  
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...    32   1.9  
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    32   2.0  
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    32   2.3  
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    32   2.3  
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    32   2.3  
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    32   2.4  
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    32   2.5  
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    32   2.5  
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    32   2.6  
KLLA0A08866g Chr1 (776960..778231) [1272 bp, 423 aa] {ON} simila...    32   2.6  
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    32   2.7  
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    32   2.7  
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    32   2.7  
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    32   2.9  
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    32   2.9  
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    32   2.9  
TDEL0C02080 Chr3 (360056..360940) [885 bp, 294 aa] {ON} Anc_7.33...    32   2.9  
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    32   3.0  
Kwal_26.7655 s26 complement(460957..463188) [2232 bp, 743 aa] {O...    32   3.0  
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    32   3.0  
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    32   3.1  
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    32   3.1  
KLTH0D04950g Chr4 complement(449060..451402) [2343 bp, 780 aa] {...    32   3.2  
AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON} Sy...    32   3.2  
TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.4...    32   3.4  
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    32   3.4  
Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON} (85899....    32   3.4  
KAFR0A04350 Chr1 (865961..869305) [3345 bp, 1114 aa] {ON} Anc_6....    32   3.5  
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    32   3.6  
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    32   3.6  
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    32   3.8  
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    32   3.8  
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    32   3.8  
KNAG0D03460 Chr4 (622817..624055) [1239 bp, 412 aa] {ON} Anc_4.1...    32   3.9  
SAKL0G01628g Chr7 complement(133626..136505) [2880 bp, 959 aa] {...    32   4.0  
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    31   4.0  
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      32   4.2  
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    32   4.3  
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...    32   4.3  
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    31   4.3  
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    31   4.3  
KAFR0I00640 Chr9 (128872..129819) [948 bp, 315 aa] {ON} Anc_8.58...    31   4.3  
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    32   4.4  
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    31   4.4  
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    32   4.5  
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    31   4.5  
Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON...    31   4.6  
KLTH0D12672g Chr4 (1039205..1040542) [1338 bp, 445 aa] {ON} simi...    31   4.6  
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    31   4.7  
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    32   4.7  
NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_...    32   4.8  
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    32   4.9  
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...    31   5.0  
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...    31   5.0  
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    31   5.0  
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...    31   5.1  
TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.3...    31   5.3  
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    31   5.4  
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    31   5.5  
TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657) [...    31   5.6  
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    31   5.7  
SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]...    31   5.7  
NDAI0B04880 Chr2 complement(1193217..1195928) [2712 bp, 903 aa] ...    31   5.7  
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    31   5.8  
YNL092W Chr14 (450871..452073) [1203 bp, 400 aa] {ON} Putative S...    31   5.8  
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    31   5.9  
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    31   5.9  
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    31   6.1  
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...    31   6.4  
Kwal_0.40 s0 complement(16823..19411) [2589 bp, 862 aa] {ON} YBR...    31   6.5  
NCAS0A01850 Chr1 complement(356138..358243) [2106 bp, 701 aa] {O...    31   6.7  
TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.4...    31   6.8  
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    31   6.9  
NDAI0H02330 Chr8 complement(564240..567221) [2982 bp, 993 aa] {O...    31   7.0  
NCAS0A00740 Chr1 (143564..144946) [1383 bp, 460 aa] {ON} Anc_1.1...    31   7.0  
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    31   7.2  
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    31   7.2  
KLLA0F10934g Chr6 (1008727..1009773) [1047 bp, 348 aa] {ON} weak...    30   7.4  
Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar t...    31   7.6  
TBLA0B05250 Chr2 (1235961..1240076) [4116 bp, 1371 aa] {ON} Anc_...    31   7.7  
Kwal_56.24596 s56 complement(1068314..1069198) [885 bp, 294 aa] ...    30   7.9  
KLLA0F13772g Chr6 (1276532..1278094) [1563 bp, 520 aa] {ON} high...    30   7.9  
YGR145W Chr7 (781767..783890) [2124 bp, 707 aa] {ON}  ENP2Essent...    31   8.0  
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    31   8.0  
NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa] ...    30   8.3  
NDAI0E03580 Chr5 (769293..771641) [2349 bp, 782 aa] {ON} Anc_7.168     30   8.3  
Skud_7.467 Chr7 (764555..766681) [2127 bp, 708 aa] {ON} YGR145W ...    30   8.3  
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    30   8.5  
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...    30   8.6  
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    30   8.8  
Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247...    30   9.3  
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    30   9.4  
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    30   9.4  
NCAS0B01910 Chr2 (312479..313456) [978 bp, 325 aa] {ON} Anc_8.585      30   9.5  
KLLA0F12694g Chr6 complement(1174812..1175954) [1143 bp, 380 aa]...    30   9.7  

>Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {ON}
           complement(85833..86999) [1167 nt, 389 aa]
          Length = 388

 Score =  743 bits (1917), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/360 (100%), Positives = 360/360 (100%)

Query: 1   MSSYSLLHSNSLGRTDWCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSIN 60
           MSSYSLLHSNSLGRTDWCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSIN
Sbjct: 1   MSSYSLLHSNSLGRTDWCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSIN 60

Query: 61  RMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACG 120
           RMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACG
Sbjct: 61  RMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACG 120

Query: 121 TELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           TELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL
Sbjct: 121 TELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180

Query: 181 TQVEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGD 240
           TQVEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGD
Sbjct: 181 TQVEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGD 240

Query: 241 IRGTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDV 300
           IRGTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDV
Sbjct: 241 IRGTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDV 300

Query: 301 FISPKSQNIMYSCGEDGSVKTWKIENNSLQVPPGFWDYSTQINVLDDNIDEQNIEQSTRN 360
           FISPKSQNIMYSCGEDGSVKTWKIENNSLQVPPGFWDYSTQINVLDDNIDEQNIEQSTRN
Sbjct: 301 FISPKSQNIMYSCGEDGSVKTWKIENNSLQVPPGFWDYSTQINVLDDNIDEQNIEQSTRN 360

>Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  491 bits (1264), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 229/358 (63%), Positives = 278/358 (77%), Gaps = 4/358 (1%)

Query: 1   MSSYSLLHSNSLGRTDWCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSIN 60
           M+SYSL+ SN  G  +WCL+LQP Y+HGLL+ LSNG++ LLDW T   ++ +KA  T+IN
Sbjct: 1   MASYSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAIN 60

Query: 61  RMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACG 120
            ++V+DSD+  G + S A  DAVKV D+R   NS +A + NE  +PFLSLDSRHG+LACG
Sbjct: 61  DLKVIDSDFSAGHLVSSASIDAVKVFDIRT--NSCIATIQNESNSPFLSLDSRHGLLACG 118

Query: 121 TELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           TEL G+DA +HIYDIR +D P+R L+DSHHDDVT IKFHPSD N+LLSGSTDGYTN+YDL
Sbjct: 119 TELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDL 178

Query: 181 TQVEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGD 240
            Q EEEDALHQVINY S+HSCGWLSPKRIYTLSHMETFAIHELN+KSDEL EP+PLDFGD
Sbjct: 179 KQDEEEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGD 238

Query: 241 IRGTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDV 300
           +R  WDCDYVVD+YPG IA GK++EN G L++IPF NE +       IP+AHGDEVVRD+
Sbjct: 239 VRKAWDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDI 298

Query: 301 FISPKSQNIMYSCGEDGSVKTWKIENNSLQVPPGFWDYSTQINVLDDNIDEQ--NIEQ 356
           FIS    +++YSCGEDG VK WK     L  P  FWDYS ++NVL D+  E   N+E+
Sbjct: 299 FISAHQSDMLYSCGEDGYVKIWKSTQGPLNTPETFWDYSEKMNVLGDDSKEAFTNLEE 356

>Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  489 bits (1260), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 226/347 (65%), Positives = 282/347 (81%), Gaps = 2/347 (0%)

Query: 1   MSSYSLLHSNSLGRTDWCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSIN 60
           M+SYSL+  NS G  +WCL+LQP Y+HGLL+ LSNG++ LLDWNTG  ++ ++A  T+IN
Sbjct: 1   MNSYSLVDLNSFGSENWCLKLQPAYKHGLLTGLSNGEICLLDWNTGKPLQKIRASETAIN 60

Query: 61  RMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACG 120
            M+++DSD+  G++ S A  D+VKV D+R   N  VA++NNE  +PFLSLDSRHG+LACG
Sbjct: 61  DMKIIDSDFVAGNLISSASIDSVKVFDIR--SNDCVAKINNETNSPFLSLDSRHGLLACG 118

Query: 121 TELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           TEL G+DA IHIYD+R +D P+R LVDSHHDDVT IKFHPSD NVLLSGSTDGYTN+YDL
Sbjct: 119 TELQGIDAAIHIYDVRKWDAPLRSLVDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178

Query: 181 TQVEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGD 240
            Q +EEDALHQVINY S+HSCGWLSPKRIYTLSHMETF+IHELN+KSDEL EP+PLDFGD
Sbjct: 179 KQDDEEDALHQVINYASIHSCGWLSPKRIYTLSHMETFSIHELNDKSDELKEPQPLDFGD 238

Query: 241 IRGTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDV 300
           IR  W+CDYVVDVYPG+IA GK++E  G L+++PF +E ++  + I IP+AHGDEVVRDV
Sbjct: 239 IRKAWNCDYVVDVYPGFIATGKTQEGAGELRLLPFKDEKIDTGNGIVIPHAHGDEVVRDV 298

Query: 301 FISPKSQNIMYSCGEDGSVKTWKIENNSLQVPPGFWDYSTQINVLDD 347
           F+S ++ +++YSCGEDG VK WK     L  P  FWDYS +I+VL+D
Sbjct: 299 FVSEQNTDVLYSCGEDGCVKIWKNSLGCLNTPASFWDYSERISVLED 345

>Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  486 bits (1250), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 225/354 (63%), Positives = 280/354 (79%), Gaps = 2/354 (0%)

Query: 1   MSSYSLLHSNSLGRTDWCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSIN 60
           MSSYSL+ SNS G  +WCL+LQP Y++GLL+ LSNG++ LLDWN+G  ++ +KA  TSIN
Sbjct: 1   MSSYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSIN 60

Query: 61  RMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACG 120
            ++V+DSD+  G + S A  DAVKV D+R   N+ VA+++NE  +PF+SLDSRHG+LACG
Sbjct: 61  DLKVIDSDFAAGHLVSSASIDAVKVFDIRT--NACVAKIHNEANSPFISLDSRHGLLACG 118

Query: 121 TELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           TEL G+DA ++IYDIR +D P+R ++DSHHDDVT IKFHPSD NVLLSGSTDGYTN+YDL
Sbjct: 119 TELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178

Query: 181 TQVEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGD 240
            Q EEEDALHQVINY S+HSCGWLS KRIYTLSHMETFAIHELN+KSDE  EP+P DFGD
Sbjct: 179 KQDEEEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGD 238

Query: 241 IRGTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDV 300
           IR  W+CDYVVDVYPG IA GK++E  G L+++PF +E ++  + I IP AHGDEVVRDV
Sbjct: 239 IREAWNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDV 298

Query: 301 FISPKSQNIMYSCGEDGSVKTWKIENNSLQVPPGFWDYSTQINVLDDNIDEQNI 354
           FIS    +++YSCGEDG VK WK     L  P  FWDYS ++NVLD++  + +I
Sbjct: 299 FISALQSDLLYSCGEDGFVKIWKNNLGPLNTPESFWDYSEKLNVLDEDHKQSSI 352

>YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON}
           Putative protein of unknown function with similarity to
           proteins containing WD-40 domains; green fluorescent
           protein (GFP)-fusion protein localizes to the nucleus;
           YNL035C is not an essential gene
          Length = 389

 Score =  485 bits (1248), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 223/354 (62%), Positives = 282/354 (79%), Gaps = 2/354 (0%)

Query: 1   MSSYSLLHSNSLGRTDWCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSIN 60
           M+SYSL+ SNS G  +WCL+LQP Y+HGLL+ LSNG++ LLDW+TG  ++ +KA  T+IN
Sbjct: 1   MASYSLVESNSFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWSTGKSVQKIKASETAIN 60

Query: 61  RMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACG 120
            M+V+ SD+  G + S A  DAVKV D+R   N  +A++ NE  +PF+SLDSRHG+LACG
Sbjct: 61  DMKVIGSDFSAGHLVSSASIDAVKVFDIRT--NDRIAQIQNEANSPFISLDSRHGLLACG 118

Query: 121 TELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           TEL G+DA ++IYDIR +D P+R L+DSHHDDVT IKFHPSD N+LLSGSTDGYTN+YDL
Sbjct: 119 TELQGIDAAVYIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDL 178

Query: 181 TQVEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGD 240
            Q EEEDALHQVINY S+HSCGWLSPKRI+TLSHMETFAIHELN+KSDEL EP+PLDFGD
Sbjct: 179 KQDEEEDALHQVINYASIHSCGWLSPKRIFTLSHMETFAIHELNDKSDELKEPQPLDFGD 238

Query: 241 IRGTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDV 300
           +R  W+CDYVVD+YPG IA GK++EN G L ++PF +E ++  + I IP+AHGDEVVRD+
Sbjct: 239 VREIWNCDYVVDIYPGLIATGKTQENCGELCLLPFKDEKVDTENGIVIPHAHGDEVVRDI 298

Query: 301 FISPKSQNIMYSCGEDGSVKTWKIENNSLQVPPGFWDYSTQINVLDDNIDEQNI 354
           FI  +  N++YSCGEDG VK W+ +   L +P  FWDYS ++NVL D+  E +I
Sbjct: 299 FIPAQHSNMLYSCGEDGCVKIWENKQGPLDIPENFWDYSKKMNVLGDDDREGSI 352

>TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {ON}
           Anc_2.283 YNL035C
          Length = 392

 Score =  482 bits (1240), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 219/347 (63%), Positives = 278/347 (80%), Gaps = 2/347 (0%)

Query: 1   MSSYSLLHSNSLGRTDWCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSIN 60
           M+SYS LH+   G  +WCL LQP Y H LL+SLSNG+V+ +DW TG  +R  +AGN+SIN
Sbjct: 1   MASYSNLHTQDFGSDNWCLGLQPFYNHHLLTSLSNGEVHHIDWVTGKSVRVDQAGNSSIN 60

Query: 61  RMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACG 120
           +++++DS+++ GS ++VA ND+V +LD+R +    +A L N+K  PFLSLDSRHGMLACG
Sbjct: 61  KLKIIDSNFNEGSSYAVASNDSVNILDVRSRDK--LASLKNDKNAPFLSLDSRHGMLACG 118

Query: 121 TELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           TELSGVDAE+HIYD+RN+  P+R  VDSHHDDVTDI+FHPSD NVLLSGSTDGYTNVYDL
Sbjct: 119 TELSGVDAELHIYDVRNWSTPIRSFVDSHHDDVTDIRFHPSDRNVLLSGSTDGYTNVYDL 178

Query: 181 TQVEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGD 240
            Q EE+DALHQVINY S+HSCGWLSPKRI+TLSHMET A+HELN+KSDEL EP+PLDFGD
Sbjct: 179 KQQEEDDALHQVINYASIHSCGWLSPKRIFTLSHMETLAMHELNDKSDELREPQPLDFGD 238

Query: 241 IRGTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDV 300
           IR  W C YVVD+YPGY+AVG S+E +  LK++   NE +    S+ IP+AHG+EVVRDV
Sbjct: 239 IREKWGCSYVVDLYPGYVAVGSSQERSSFLKLMALENEQIETEKSLVIPSAHGEEVVRDV 298

Query: 301 FISPKSQNIMYSCGEDGSVKTWKIENNSLQVPPGFWDYSTQINVLDD 347
            I P++ N++YSCGEDG+VK WK ++    + PGFWDYS +++V  +
Sbjct: 299 LIPPQNCNMLYSCGEDGTVKIWKTKDTGFHIEPGFWDYSKKMDVFSE 345

>KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.283
           YNL035C
          Length = 367

 Score =  465 bits (1197), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 213/344 (61%), Positives = 270/344 (78%), Gaps = 2/344 (0%)

Query: 3   SYSLLHSNSLGRTDWCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRM 62
           SYSL+   S G  +WCL+ QPLY HGLL+SLSNG+V LLDW T N +R  K    SIN M
Sbjct: 2   SYSLVQEQSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSM 61

Query: 63  RVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTE 122
           +++++DY+N S+F+ A  ++VK+ D++   N  +A + N+KK+PFLSLDSRH MLACGTE
Sbjct: 62  KLINNDYNNASLFATATLNSVKIYDIK--SNDCIATITNDKKSPFLSLDSRHDMLACGTE 119

Query: 123 LSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQ 182
           L GVDAE++IYD+RN+  PV+  VDSHHDD+TDIKFHPSD N LLSGSTDGYTNVYDLTQ
Sbjct: 120 LQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ 179

Query: 183 VEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGDIR 242
            EE+DAL+QVINY S+HSCGWLSP+RIYTLSHMETF+I ELN+++DEL EP+PLDFGDIR
Sbjct: 180 QEEDDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIR 239

Query: 243 GTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFI 302
             W+CDYV+D+YPGYIA G+S+E NGNL+IIP   E +  + +I+I  AH DEV+RDVFI
Sbjct: 240 DQWNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFI 299

Query: 303 SPKSQNIMYSCGEDGSVKTWKIENNSLQVPPGFWDYSTQINVLD 346
                N++YSCGEDG+VK+WK  ++       FWDYS + NV +
Sbjct: 300 PRNHHNVLYSCGEDGTVKSWKSPHSQSTALEEFWDYSQRFNVFE 343

>ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 376

 Score =  465 bits (1196), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 209/345 (60%), Positives = 275/345 (79%), Gaps = 2/345 (0%)

Query: 3   SYSLLHSNSLGRTDWCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRM 62
           SYSL++S S G  +WCL LQP Y+H LL+SLSNG V+ LDW TG  I  +K G  ++N++
Sbjct: 2   SYSLVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNKL 61

Query: 63  RVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTE 122
           +++++D++N S ++ A   AVK+ D+R   N+ +A ++N+K  PFLSLDSRH MLACGTE
Sbjct: 62  KLINNDHENESTYATATMGAVKIWDIR--SNNCLATISNDKNAPFLSLDSRHNMLACGTE 119

Query: 123 LSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQ 182
           LSG DAE+HIYD+R +D P+R LVDSHHDD+TDI FHPSDPNVL+SGSTDGYTN+YDL Q
Sbjct: 120 LSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQ 179

Query: 183 VEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGDIR 242
            EEEDALHQVIN+ S+HSCGWL+P+RI+TLSHMETF+IHELN+KSDE  EP+P++F D+R
Sbjct: 180 AEEEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDVR 239

Query: 243 GTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFI 302
            +W CDYVVD++PGY+A G S+E  G L+I+PF  E ++ N++I I  AHGDEVVRDVF+
Sbjct: 240 ESWGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDTNNAIDINAAHGDEVVRDVFV 299

Query: 303 SPKSQNIMYSCGEDGSVKTWKIENNSLQVPPGFWDYSTQINVLDD 347
             ++  ++YSCGEDGSVKTW+ ++  L V   FWDYS  +NVLD+
Sbjct: 300 PARNSKLLYSCGEDGSVKTWENKSGPLNVTDEFWDYSQLLNVLDE 344

>KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 426

 Score =  461 bits (1187), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 215/349 (61%), Positives = 266/349 (76%), Gaps = 2/349 (0%)

Query: 3   SYSLLHSNSLGRTDWCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRM 62
           SYS L S   G  +WCL+LQP+Y  GLL+SLSNG V L+DW T   I  ++   TS+N M
Sbjct: 21  SYSKLESIEFGPNNWCLKLQPIYNSGLLTSLSNGRVELIDWATHKSILQIQTHATSVNDM 80

Query: 63  RVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTE 122
            ++++D  NGS+ + A  DAVK+ DL+   N  VA L N K  PFLSLDSRHG+L CGTE
Sbjct: 81  VIINNDRMNGSLIATAAEDAVKIYDLK--SNDCVATLKNGKSAPFLSLDSRHGLLGCGTE 138

Query: 123 LSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQ 182
           LSGVDAE+H+YDIR++ +P+R LVDSHHDD+T IKFHPSDPNVLLSGSTDGY N+YDLTQ
Sbjct: 139 LSGVDAELHVYDIRSWQQPLRSLVDSHHDDITSIKFHPSDPNVLLSGSTDGYVNIYDLTQ 198

Query: 183 VEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGDIR 242
            EE+DALHQVIN+ S+HSCGWLSPKRIYTLSHMET+ IHELN+K DE TEPKP+DFGD+R
Sbjct: 199 QEEDDALHQVINFASIHSCGWLSPKRIYTLSHMETYGIHELNDKRDEPTEPKPVDFGDVR 258

Query: 243 GTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFI 302
             WDC+YV+DVYPG+IA GKSEE  G LK+IP  +E   +  +I+IP+AH DEVVRDV +
Sbjct: 259 KPWDCNYVIDVYPGFIATGKSEEGRGELKLIPLDHEKPELQSAITIPSAHDDEVVRDVLV 318

Query: 303 SPKSQNIMYSCGEDGSVKTWKIENNSLQVPPGFWDYSTQINVLDDNIDE 351
             + ++++YSCGEDGS+K WK     L VP  FW YS +I+V    + E
Sbjct: 319 PFQHEDLLYSCGEDGSLKVWKSSAGPLNVPQEFWQYSEKIDVFSGTVAE 367

>TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {ON}
           Anc_2.283 YNL035C
          Length = 413

 Score =  459 bits (1182), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 220/352 (62%), Positives = 274/352 (77%), Gaps = 7/352 (1%)

Query: 3   SYSLLHSNSLGRTDWCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRM 62
           S  L++  + G  +WCLEL+PLY  GLL S SNG VNL+DWN+ + I+  + G T+IN +
Sbjct: 2   SAKLVNQITFGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSL 61

Query: 63  RVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTE 122
           RV+++D++NG +F+     +VK+ D+R  G+S VA + N+K + FLSL+SRH ML CGTE
Sbjct: 62  RVINNDFENGCIFAATSLASVKIYDVR-NGDSPVATIKNDKNSVFLSLESRHDMLVCGTE 120

Query: 123 LSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQ 182
           L+GVDAE+ IYD+R F KPVR  VDSHHDD+TDIKFHPSD N+LLSGSTDGYTN+YDL Q
Sbjct: 121 LTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQ 180

Query: 183 VEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGDIR 242
            +E++ALHQVINY S+HSCGWLSPKRIYTLSHMETFAIHELN+KSDELTEP+PLDFGDIR
Sbjct: 181 EDEDEALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIR 240

Query: 243 GTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFI 302
           G WDCDYVVD+YPGY+A+GKS EN G LKI  F NE++N  + I IPNAHGDEV+RDVFI
Sbjct: 241 GQWDCDYVVDLYPGYVAMGKSAENAGELKICGFENEIMNTENHIIIPNAHGDEVIRDVFI 300

Query: 303 SPKSQN----IMYSCGEDGSVKTWKIENNS--LQVPPGFWDYSTQINVLDDN 348
            P + N    I+YSCGEDG+V  W     S  L V   FW+ + Q++VL D+
Sbjct: 301 PPGNLNNHSDIIYSCGEDGNVNIWHAPRCSSILNVSKDFWNATEQLDVLSDD 352

>NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {ON}
           Anc_2.283 YNL035C
          Length = 397

 Score =  455 bits (1170), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 216/348 (62%), Positives = 276/348 (79%), Gaps = 3/348 (0%)

Query: 1   MSSYSLLHSNSLGRTDWCLELQPLYR-HGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSI 59
           +S YSLL+S+S G  +WC + QPL + +GLL SLSNG+++ LD+ T    ++++  N SI
Sbjct: 3   ISPYSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSI 62

Query: 60  NRMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLAC 119
           N +++L+SD+  GS+FS A  ++VK+ D+    N  +A L+N+K  PFLSLDSRHG+LA 
Sbjct: 63  NDLKILNSDFHCGSLFSTATAESVKIFDIN-SNNGPIATLHNDKNVPFLSLDSRHGLLAM 121

Query: 120 GTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYD 179
           GTEL GVDA+I+IYDIR +D P+R L+DSHHDDVT +KFHPSDP VLLSGSTDGYTNVYD
Sbjct: 122 GTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYD 181

Query: 180 LTQVEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFG 239
           LTQ +E+DALHQV+NY S+HSCGWLSP RI+TLSHMETFAIHELN+KS+EL EP+PLDFG
Sbjct: 182 LTQQDEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDFG 241

Query: 240 DIRGTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRD 299
           D+R  W CDYV+DVYPGYIA GKS+E NG LK+IP + E +++ DS+ IP+AHGDEV+RD
Sbjct: 242 DVREKWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRD 301

Query: 300 VFISPKSQNIMYSCGEDGSVKTWKIENNSLQVPPGFWDYSTQ-INVLD 346
           VFI P    ++YSCGEDG V  WK  N +L VP  FWDYS + ++VLD
Sbjct: 302 VFIPPSHSELVYSCGEDGFVNLWKNNNGALNVPEQFWDYSKRTMHVLD 349

>KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 422

 Score =  455 bits (1171), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 204/336 (60%), Positives = 262/336 (77%), Gaps = 2/336 (0%)

Query: 16  DWCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLDSDYDNGSVF 75
           +WCL+LQPLY+HGL++S+S+G V+LLDW     I +++   TSIN M+V++SD+D G+VF
Sbjct: 15  NWCLKLQPLYQHGLMTSISDGSVHLLDWGNLKTISSIQCHTTSINDMKVINSDFDTGAVF 74

Query: 76  SVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTELSGVDAEIHIYDI 135
           + A  D VKV D+R + N  VA L N+K +PF SLDSRH MLACGTEL   DAE+HIYDI
Sbjct: 75  ATAAEDGVKVWDIRARNN--VASLQNDKASPFFSLDSRHNMLACGTELKDYDAELHIYDI 132

Query: 136 RNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEEDALHQVINY 195
           RN+ KPVR  VDSHHDD+TDIKFHP D N+L+SGSTDGY N+YDLTQ +EEDALHQVIN+
Sbjct: 133 RNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDLTQDDEEDALHQVINF 192

Query: 196 ESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGDIRGTWDCDYVVDVYP 255
            S+HSCGWL PKRI++LSHMETF IHELN+KSDE+ EPKPL+FGD+R  W CDYV+D+YP
Sbjct: 193 ASIHSCGWLGPKRIWSLSHMETFGIHELNDKSDEMIEPKPLEFGDVRDKWGCDYVIDIYP 252

Query: 256 GYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFISPKSQNIMYSCGE 315
            +IA GK+ E+ G LKIIPF NE ++++ ++ IP+AHG+EV+RDV I     +++YSCGE
Sbjct: 253 SFIATGKTHESQGELKIIPFQNEQVDVSSALVIPDAHGNEVIRDVLIPKNQTSLLYSCGE 312

Query: 316 DGSVKTWKIENNSLQVPPGFWDYSTQINVLDDNIDE 351
           DG V  WK   NSL VP  FWDY+      ++++ E
Sbjct: 313 DGYVNVWKDTTNSLNVPHNFWDYTLPFTAFENSVRE 348

>SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 398

 Score =  452 bits (1163), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 203/355 (57%), Positives = 273/355 (76%), Gaps = 2/355 (0%)

Query: 3   SYSLLHSNSLGRTDWCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRM 62
           SYS LH+ S G  +WCL+LQPLY  GLL+SLSNG ++L+DW TG  I    A + SI+ +
Sbjct: 2   SYSKLHTASFGCENWCLQLQPLYNRGLLTSLSNGHIHLVDWCTGEIIHEFAAHSASISNL 61

Query: 63  RVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTE 122
           +VL++++ N  +F+ A  D+VK+ D+R   +S VA L+N+K  PFLSLDSRH MLACGTE
Sbjct: 62  KVLNNEFTNSDLFASASKDSVKIFDVRT--SSCVATLHNDKSAPFLSLDSRHDMLACGTE 119

Query: 123 LSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQ 182
           LSGVDAE+HIYDI+   KP+R  VDSHHDD+TD KFHP DP VL+SGSTDGY N+YDLT 
Sbjct: 120 LSGVDAELHIYDIKKLSKPLRSFVDSHHDDITDTKFHPGDPGVLMSGSTDGYVNIYDLTN 179

Query: 183 VEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGDIR 242
            +EEDALHQVIN+ SVHSCGWL+P+RIYTLSHMETFAIHELN+KSD+L EPKP++FGD+R
Sbjct: 180 SDEEDALHQVINFASVHSCGWLAPRRIYTLSHMETFAIHELNDKSDDLREPKPVEFGDVR 239

Query: 243 GTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFI 302
             W CDY++++ PG+IA G+S+E  G LK+I F++E ++  + ++IP AHGDE++RDV I
Sbjct: 240 QPWGCDYIININPGFIAAGRSQETQGELKLIAFNDEKVDTTNVLTIPQAHGDEIIRDVLI 299

Query: 303 SPKSQNIMYSCGEDGSVKTWKIENNSLQVPPGFWDYSTQINVLDDNIDEQNIEQS 357
             ++ +++YSCGEDG +  WK +   L +   FWDYS + NV +D + E +++ +
Sbjct: 300 PDQTTDMLYSCGEDGCLNIWKSQTGPLNISRDFWDYSKRFNVFEDTVVEVDMDDT 354

>Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035C -
           Hypothetical ORF [contig 27] FULL
          Length = 407

 Score =  452 bits (1162), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 211/349 (60%), Positives = 268/349 (76%), Gaps = 2/349 (0%)

Query: 3   SYSLLHSNSLGRTDWCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRM 62
           SYS + S + G  +WCL+LQPLY  GLL+SLSNG V L+DW     I  ++A  T+I+ M
Sbjct: 2   SYSKVDSINFGADNWCLKLQPLYNRGLLASLSNGSVQLIDWVKNKQISQIQAHGTTISDM 61

Query: 63  RVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTE 122
            VL++D +NG + + A  D+VK+ DLR   +  VA L NEK  PFLSLDSRHGMLACGTE
Sbjct: 62  VVLNNDRNNGFLIATAAEDSVKIFDLR--SSDTVATLKNEKSAPFLSLDSRHGMLACGTE 119

Query: 123 LSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQ 182
           LSGVDAE+HIYD++ + +P+R LVDSHHDD+T+IKFHP+DPNVLLSGSTDGY N+YDLTQ
Sbjct: 120 LSGVDAELHIYDMKAWHQPLRSLVDSHHDDITNIKFHPTDPNVLLSGSTDGYVNIYDLTQ 179

Query: 183 VEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGDIR 242
            EE+DALHQVIN+ S+HS GW +PKRIYTLSHMETF IHELN+K +E TEP P DFGDIR
Sbjct: 180 PEEDDALHQVINFASIHSSGWCAPKRIYTLSHMETFGIHELNDKLEEPTEPHPKDFGDIR 239

Query: 243 GTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFI 302
            +W CDYVVDVYPG+IA GKS+E  G +K+IPF  E L+++ +++IP+AHGDEVVRDV +
Sbjct: 240 QSWGCDYVVDVYPGFIATGKSQEGQGEVKLIPFTGEDLDLDSAVTIPSAHGDEVVRDVLV 299

Query: 303 SPKSQNIMYSCGEDGSVKTWKIENNSLQVPPGFWDYSTQINVLDDNIDE 351
             + ++++Y+CGEDG V  WK     L VP  FW Y+ QI+V   ++ E
Sbjct: 300 PFQHEDMLYTCGEDGCVNAWKSNRGPLNVPQEFWSYADQIDVFSGSVAE 348

>TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa]
           {ON} Anc_2.283 YNL035C
          Length = 403

 Score =  449 bits (1155), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 211/357 (59%), Positives = 280/357 (78%), Gaps = 9/357 (2%)

Query: 11  SLGRTDWCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLDSDYD 70
           S G  +WCL+ +PLY +GLL+SLSNG++++LDW T      +K G TSIN   +++++Y+
Sbjct: 10  SFGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYN 69

Query: 71  NGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTELSGVDAEI 130
            GS+   A N++VK+ DL+   N  +  + NEK +PFLSLDS H M+ACGTELSGVDAE+
Sbjct: 70  GGSLMVTATNESVKIYDLK--SNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAEL 127

Query: 131 HIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEEDALH 190
           +IYDIR++D P+R  VDSHHDD+TDIKFHP+D  VL+SGSTDGYTN+YDLT+ EEED+LH
Sbjct: 128 YIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLH 187

Query: 191 QVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGDIRGTWDCDYV 250
           QVINY S+HSCGWLS +RI+TLSHMETFAIH+LN+KS+ L EPKP++FGDIR  W C+YV
Sbjct: 188 QVINYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRNDWGCNYV 247

Query: 251 VDVYPGYIAVGKSEENNGNLKIIPFHNELLNI--NDSISIPNAHGDEVVRDVFISPKSQN 308
           +DVYPGYIA GK+EE+ G LKI PF+NE +++  +++I IP AHGDEV+RDVFI+P   +
Sbjct: 248 IDVYPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVFINPNDPS 307

Query: 309 IMYSCGEDGSVKTWKIE--NNSLQVPPGFWDYSTQINVLD---DNIDEQNIEQSTRN 360
            MYSCGEDG+VK WKI+    SL++P  F+DYS ++NVLD   +N D+  ++  T N
Sbjct: 308 NMYSCGEDGNVKLWKIDTTTKSLKIPEHFFDYSLRLNVLDEINENDDDIEVDMGTEN 364

>KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.283
           YNL035C
          Length = 399

 Score =  442 bits (1137), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 205/351 (58%), Positives = 270/351 (76%), Gaps = 3/351 (0%)

Query: 1   MSSYSLLHSNSLGRTDWCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSIN 60
           MS  S + S   G  +WC ++QPLY+ G+L+SLSNG+V+L+DW +   I   K+  T+IN
Sbjct: 1   MSQCSQIGSYFFGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAIN 60

Query: 61  RMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACG 120
            ++++++D+ N + F  A   AVK+ D+R   N+ +  ++NE   PFLSLDSR+  +ACG
Sbjct: 61  ALQIVNTDWHNETRFITASMHAVKLFDVR--SNACIGTIHNEVGAPFLSLDSRYDKIACG 118

Query: 121 TELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           TEL GVDA++HI+D+R  D P + LVDSHHDD+T IKFHPSD NVLLSGSTDGYTN+YDL
Sbjct: 119 TELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDL 178

Query: 181 TQVEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGD 240
           +Q EE+D+LHQVIN+ S+HSCGW++PKRIYTLSHMETFAIHELNNKSDELTEP+PLDFGD
Sbjct: 179 SQEEEDDSLHQVINFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGD 238

Query: 241 IRGTWDCDYVVDVYPGYIAVGKS-EENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRD 299
           IR  W CDYVVD+YPGY+A GKS EE  G LK+IP   E + I+++ISIP+AHGDEV+RD
Sbjct: 239 IRAAWGCDYVVDIYPGYVATGKSHEEGKGELKLIPLKGENVVIDNTISIPSAHGDEVIRD 298

Query: 300 VFISPKSQNIMYSCGEDGSVKTWKIENNSLQVPPGFWDYSTQINVLDDNID 350
           VFI  ++  ++YSCGEDG +  W+  +  L VP  FW+Y   +NVLD+++D
Sbjct: 299 VFIPEQNSEVVYSCGEDGYLNIWRNNSGPLNVPEKFWNYDIPMNVLDESLD 349

>Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL218C
          Length = 409

 Score =  439 bits (1128), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 207/345 (60%), Positives = 261/345 (75%), Gaps = 3/345 (0%)

Query: 3   SYSLLHSNSLGRTDWCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRM 62
           SY+   + S G  +WCL+LQPLY  GLLS+LSNG V+L+DWN+   I+ +    TSI+ +
Sbjct: 2   SYTKCDTISFGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISAL 61

Query: 63  RVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTE 122
           +VLD+D D+G+ F  A  D+VK+ DLR+  N  VA + N K +PF+SLDSRHGMLACGTE
Sbjct: 62  KVLDNDVDSGNTFVTASEDSVKIFDLRL--NQCVATVQNAKNSPFISLDSRHGMLACGTE 119

Query: 123 LSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQ 182
           LSG DAEIH+YD++  D P+R   DSHHDD+TDIKFH SDP+VLLSGSTDGY NVYDL Q
Sbjct: 120 LSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQ 179

Query: 183 VEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGDIR 242
            EEE+ALHQVIN+ S+HSCGWLSPKRI+ LSHMETF+IHELN+KSDEL EPKPL+FGDIR
Sbjct: 180 QEEEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIR 239

Query: 243 GTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFI 302
             W+CDYVVD++PG I  G ++E +  L+++PF NE ++  +SI IP AHGDEVVRD  I
Sbjct: 240 KPWNCDYVVDIFPGCIITGSTQEQSM-LQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALI 298

Query: 303 SPKSQNIMYSCGEDGSVKTWKIENNSLQVPPGFWDYSTQINVLDD 347
              +  + YS GEDG++  WK    SL VP  FW+Y  ++NVL D
Sbjct: 299 HKTTSELFYSGGEDGNIVLWKSNRGSLNVPTEFWNYQEKLNVLHD 343

>NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283
          Length = 389

 Score =  429 bits (1103), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 203/350 (58%), Positives = 268/350 (76%), Gaps = 4/350 (1%)

Query: 2   SSYSLLHSNSLGRTDWCLELQPLYR--HGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSI 59
           SSYSL++S S G  +W L+LQPL    +GLL+SLSNG+V+ LD +T   I+      TSI
Sbjct: 3   SSYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSI 62

Query: 60  NRMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLAC 119
           N +++++ +  +  +F+ A +++VK+ D  +     VA ++++   PF SLDSRHG+LAC
Sbjct: 63  NDLQLINHNPTSSPLFTTATSNSVKIFD--IHSTKEVATIHSQGNVPFPSLDSRHGLLAC 120

Query: 120 GTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYD 179
           GTEL GVDA I+IYDIR +D+PVR LVDSHHDDVT +K+HP+DPN+LLSGSTDGYTNVYD
Sbjct: 121 GTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYD 180

Query: 180 LTQVEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFG 239
           L++ EEED+LHQVIN+ S+HSCGWLSP+RI+TLSHMETFAIHELN+KSD L EP+P+D G
Sbjct: 181 LSEAEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMG 240

Query: 240 DIRGTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRD 299
           D+R  W CDYVVDVYPG+IA GKS+E  G LK+IP  +E +++ +SI IP AH DEV+RD
Sbjct: 241 DVREKWGCDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRD 300

Query: 300 VFISPKSQNIMYSCGEDGSVKTWKIENNSLQVPPGFWDYSTQINVLDDNI 349
           V+I      +MY+CGEDG+VK WK  N  L VP   WDYS ++N+L+D +
Sbjct: 301 VYIPSHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSKRVNMLEDTL 350

>ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL035C
          Length = 403

 Score =  419 bits (1078), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 195/345 (56%), Positives = 253/345 (73%), Gaps = 2/345 (0%)

Query: 3   SYSLLHSNSLGRTDWCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRM 62
           SY L    S G  +WCL L+PLY+ G+L++LSNG V+L+DW TG  +  V A  +SIN +
Sbjct: 2   SYILQQKVSFGADNWCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSINGL 61

Query: 63  RVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTE 122
           +VLDS +D G+VF+ A +D VK+ D+R +G   VA L +    P LSLDSRHGMLA GTE
Sbjct: 62  QVLDSAHDRGTVFATAADDGVKLFDIRTRG--CVATLTDANGAPALSLDSRHGMLAFGTE 119

Query: 123 LSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQ 182
           L GVDA + ++ +  + +P+R  VDSHHDDVTD+KFHP+D N+LLSGSTDGY NVYDL Q
Sbjct: 120 LVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQ 179

Query: 183 VEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGDIR 242
            EE++ALHQVIN+ S+HSCGWLSPKRI++LSHMETFAIHELN+KS+   EP+P  FGD+R
Sbjct: 180 SEEDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVR 239

Query: 243 GTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFI 302
             W CDYVVDVYPG+IA G + EN G L+++P  +E ++  ++I +P AHGDEVVRDV +
Sbjct: 240 EPWACDYVVDVYPGFIAAGSTRENAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLV 299

Query: 303 SPKSQNIMYSCGEDGSVKTWKIENNSLQVPPGFWDYSTQINVLDD 347
              S  ++YS GEDG++  WK     L VP  FWDYS +  VL+D
Sbjct: 300 PASSPELLYSAGEDGNMAIWKSTLGPLNVPVDFWDYSKKETVLED 344

>CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035c
          Length = 376

 Score =  407 bits (1046), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 200/353 (56%), Positives = 258/353 (73%), Gaps = 8/353 (2%)

Query: 4   YSLLHSNSLGRTDWCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMR 63
           YSL  S + G  +WCL+LQP++ +G+L+S+S+G+V+LL  +      + K G TSIN + 
Sbjct: 2   YSLAGSCNFGSNNWCLKLQPVH-NGILTSVSSGEVHLLGLDLSKQ-DSFKVGETSINALS 59

Query: 64  VLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTEL 123
            +D   +   +F+ +  + VKV DLR   N  VA L  E     LSL S HGMLA G+E 
Sbjct: 60  RVDGQEN---LFAASNGNKVKVFDLR--ENKEVATLEQENGANVLSLGSGHGMLAYGSEQ 114

Query: 124 SGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQV 183
            GVDA +H++DIRN+ KPVR  VDSH DD+T I FHP+D NVLLSGSTDGYTNVYDL + 
Sbjct: 115 QGVDAHLHLFDIRNWSKPVRSFVDSHQDDITSIAFHPADANVLLSGSTDGYTNVYDLLEP 174

Query: 184 EEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGDIRG 243
           EEEDALHQVINY S+HSCGWL+P+RI+TLSHMETFAIHELN+KS+EL EP+PLDFGDIR 
Sbjct: 175 EEEDALHQVINYASIHSCGWLAPRRIFTLSHMETFAIHELNDKSEELREPQPLDFGDIRQ 234

Query: 244 TWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFIS 303
            WDC+YVVD+YPGYI+ G SEE  G L+IIPF NE +   D+I+I  AHGDE+VRD +I 
Sbjct: 235 PWDCNYVVDIYPGYISAGVSEEGKGALRIIPFRNEHVQAKDTITISQAHGDEIVRDTYIL 294

Query: 304 PKSQNIMYSCGEDGSVKTWKIENNSLQVPPGFWDYSTQINVLDDNIDEQNIEQ 356
           P   +++YSCGEDG VK W+  +  L +P  FWDYST++++L D + E  +E+
Sbjct: 295 PSQSDMLYSCGEDGQVKAWR-NDIKLDIPETFWDYSTKMSLLSDEVPEVQLEK 346

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 84/177 (47%), Gaps = 17/177 (9%)

Query: 17  WCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSI-NRMRVLDSDYDNGSVF 75
           + L   PL +  LLSS  +G V    WN    I  +    TSI N +R   + ++     
Sbjct: 173 YGLAFNPLDKGKLLSSSDDGSVAY--WNIQKSIPLLTLQETSIINDVRW--NQFNQNLFG 228

Query: 76  SVAMNDAVKVLDLRVQGNSIVAELNNEKKTP------FLSLDSRHGMLACGTELSGVDAE 129
            V  +  + + D+R   N +    N++ KTP        S  S + M A     SG D+ 
Sbjct: 229 YVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAA-----SGEDSL 283

Query: 130 IHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEE 186
           I++YD RN ++P+  +   H D VT + FH  +  +++SG +D    V+DL Q+ +E
Sbjct: 284 IYLYDTRNLNQPLHYM-RGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQE 339

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 64/119 (53%), Gaps = 5/119 (4%)

Query: 68  DYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTELSGVD 127
           ++D     SV+ +  +++ D R++ ++ V ++  +K    L+  +    L      +G D
Sbjct: 210 NFDQNIFGSVSEDSTLQLHDQRIR-DAAVEKVQAKKPYNTLAFSAHSTNLFAA---AGTD 265

Query: 128 AEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEE 186
           + +++YD R   KP+ M+   H D VT ++FHP +  VL+S  +D  T ++DL ++  E
Sbjct: 266 SMVYLYDRRRASKPLHMM-PGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAE 323

 Score = 30.0 bits (66), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query: 120 GTELSGVD-AEIHIYDIR-NFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNV 177
           G  LSG D + I ++D+     +P+    D H D V D K+H  D N+  S S D    +
Sbjct: 168 GKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQL 227

Query: 178 YD 179
           +D
Sbjct: 228 HD 229

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 49/75 (65%), Gaps = 6/75 (8%)

Query: 116 MLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTD-GY 174
           ML C  + +G    I+++DIRNF +P++ L+  H+D ++ ++++P +P VL +G  D G 
Sbjct: 304 MLLCSADSAG---RINLWDIRNFTQPLKTLL--HNDSISVLQWNPREPTVLATGGQDGGL 358

Query: 175 TNVYDLTQVEEEDAL 189
             ++DL+Q E ++ +
Sbjct: 359 VKIWDLSQPEGQELI 373

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 65/130 (50%), Gaps = 19/130 (14%)

Query: 124 SGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQV 183
           +G D+++ +YD+R  + P+  +   HHD VT ++F P    +L SGS+D    ++DL Q+
Sbjct: 267 AGTDSQVQLYDLRKPEAPIHSM-SGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQI 325

Query: 184 ----EEEDALHQVINYESVH----------SCGWLSPKRIYTLSHMETFAIHELNNKSDE 229
               ++EDA   V     +H          SC   SP   + ++ +E   + ++   S +
Sbjct: 326 GAEQQQEDADDGVPELLMMHAGHKSPVNDFSC---SPNIPWLMASVEEENVVQIWKASKK 382

Query: 230 LTEPK-PLDF 238
           LT P  P D+
Sbjct: 383 LTSPYIPRDY 392

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 85/185 (45%), Gaps = 32/185 (17%)

Query: 17  WCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLD---SDYDNGS 73
           + L   PL +  LLS   +  V L D         V  G+ S   +R  D   SD  N S
Sbjct: 164 YALSFSPLIKGHLLSGSDDHSVALWD---------VSGGSDSTTPIRTWDDLHSDIVNDS 214

Query: 74  VF---------SVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRH---GMLACGT 121
            +         +V+ +  +K+ D+R +  +I      +   PF +L   H    +LA   
Sbjct: 215 KWHNFNKDLFGTVSEDSLLKINDIRAENTTIDTA---KCPQPFNTLAFSHHSSNILAA-- 269

Query: 122 ELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLT 181
             +G+D+ +++YD+RN  +P+  +   H D VT+++F P    V++S  +D    ++DL 
Sbjct: 270 --AGMDSHVYLYDLRNMKEPLHHM-SGHEDAVTNLEFSPHVDGVVVSSGSDNRLIMWDLK 326

Query: 182 QVEEE 186
           Q+  E
Sbjct: 327 QIGAE 331

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 54/181 (29%), Positives = 85/181 (46%), Gaps = 24/181 (13%)

Query: 17  WCLELQPLYRHGLLSSLSNGDVNLLDWNTGNC-----IRTVKAGNTSINRMRVLDSDYDN 71
           + L   PL    LLS   +  V L D N GN      IRT    ++ I    V DS + N
Sbjct: 164 YALSFSPLVEGLLLSGSDDHTVALWDVN-GNSDSTRPIRTWSDLHSDI----VNDSKWHN 218

Query: 72  --GSVFSVAMNDAV-KVLDLRVQGNSIVAELNNEKKTPFLSLDSRH---GMLACGTELSG 125
               +F     D++ K+ DLRV+  +       E   PF +L   H    +LA     +G
Sbjct: 219 FNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPE---PFNTLAFSHHSSNLLAA----AG 271

Query: 126 VDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEE 185
            D+ +++YD+RN  +P+  +   H D VT+++F P    V++S  +D    ++DL Q+  
Sbjct: 272 TDSHVYLYDLRNMKEPLHHM-SGHEDAVTNLEFSPHVDGVVVSSGSDNRLIMWDLKQIGA 330

Query: 186 E 186
           E
Sbjct: 331 E 331

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 69/124 (55%), Gaps = 11/124 (8%)

Query: 68  DYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLD-SRHG--MLACGTELS 124
           ++++    +V+ +  ++V D RV+    V +L     +PF +L  S+H   +LA     +
Sbjct: 240 EFESNVFGTVSEDKTLQVHDKRVRLEP-VKKLPT--ASPFNTLSFSKHSRNLLAA----A 292

Query: 125 GVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVE 184
           GVD++I++YD+R+   P+ ++   H D VT ++F P    ++ S  +D    ++DLTQ+ 
Sbjct: 293 GVDSQIYLYDMRDMSSPLHVM-SGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIG 351

Query: 185 EEDA 188
            E +
Sbjct: 352 AEQS 355

 Score = 33.5 bits (75), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 32/62 (51%), Gaps = 2/62 (3%)

Query: 119 CGTELSGVD-AEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNV 177
            G  LSG D   + ++DI    KP  +L  SH D V D+K+H  + NV  + S D    V
Sbjct: 199 SGELLSGSDDTTVALWDIEAAKKPKSILT-SHDDIVNDVKWHEFESNVFGTVSEDKTLQV 257

Query: 178 YD 179
           +D
Sbjct: 258 HD 259

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 77/175 (44%), Gaps = 12/175 (6%)

Query: 17  WCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLDS---DYDNGS 73
           + L   P     LLS+  +  V L D N+ +   ++   +T I    V DS   ++D   
Sbjct: 164 YGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDI----VNDSKWHEFDENI 219

Query: 74  VFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTELSGVDAEIHIY 133
             +V+ +  ++V D R   NS    L  EK    L+       L      +G D  +++Y
Sbjct: 220 FGTVSEDKTLQVHDKRSLSNSAQV-LPVEKPLNALAFSKHSKNLIAA---AGTDTRVYLY 275

Query: 134 DIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEEDA 188
           D+R   +P+  +   H D VT I+F      +L S  +D    ++DLTQ+  E A
Sbjct: 276 DLRRLSEPLHTMA-GHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQA 329

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 82/175 (46%), Gaps = 19/175 (10%)

Query: 26  RHGLLSSLSNGDVNLLDWNTGNCIRTVK-------AGNTSINRMRVLDSDYDNGSVF-SV 77
           ++ LLS   + D N+  W+  N  + +K       A    IN ++   S+     +F SV
Sbjct: 192 KYSLLSG--SDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSE---AHIFGSV 246

Query: 78  AMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTELSGVDAEIHIYDIRN 137
           + +  +K+ D R   + I+  +N +K    L+       L      +G D  +++YDIR+
Sbjct: 247 SEDSTMKLFDKR--SSQIIHNINTKKPYNTLAFSPFSSNLFAA---AGTDNLVYLYDIRD 301

Query: 138 FDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEEDALHQV 192
              P+  +   H D VT I+F P++  +L S  +D  T V+DL ++  E    ++
Sbjct: 302 VSNPLYAMT-GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEI 355

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 86/179 (48%), Gaps = 17/179 (9%)

Query: 17  WCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLDSDYDN--GSV 74
           + L   PL +  LLS   + +V L D  +       K  N  I+   V D  + N   S+
Sbjct: 180 YGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWEN--IHSDIVNDCQWHNFQKSL 237

Query: 75  F-SVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRH---GMLACGTELSGVDAEI 130
           F +V+ + ++++ D R   +  VA +N  K  PF +L   H    +LA G    GV++E+
Sbjct: 238 FGTVSEDSSLQIHDTR--ESKPVATINGTK--PFNTLSFSHHSENLLATG----GVNSEV 289

Query: 131 HIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEEDAL 189
           ++YD R  ++P+  L+  H D VT + F   D  ++LS   D    ++D+  +  E  L
Sbjct: 290 YLYDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVL 347

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 43/100 (43%), Gaps = 11/100 (11%)

Query: 130 IHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEEDAL 189
           ++IYD  N      + +  H D+   + F+P     LLSGS D    ++D+T    E   
Sbjct: 156 VYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNE--- 212

Query: 190 HQVINYESVHS-----CGW--LSPKRIYTLSHMETFAIHE 222
             V  +E++HS     C W         T+S   +  IH+
Sbjct: 213 -PVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHD 251

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 38/63 (60%), Gaps = 1/63 (1%)

Query: 124 SGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQV 183
           +G+D  I++YD R   KP+ ++   H D +T ++FHP +  +L+SG  D    ++DL ++
Sbjct: 261 AGLDTNIYLYDRRQTTKPLHVMA-GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEI 319

Query: 184 EEE 186
             E
Sbjct: 320 GAE 322

>TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 90/191 (47%), Gaps = 30/191 (15%)

Query: 18  CLELQ--PLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLDSDYD----- 70
           CL +   P     LLS  SNG+++L D+      +   + N  IN   + D+++D     
Sbjct: 198 CLSIAWNPQQEGQLLSCESNGNIHLWDFQ-----KEFSSKNREINNT-IWDTNFDDLGCN 251

Query: 71  -----NG--SVFSV-AMNDAVKVLDLRVQG--NSIVAELNNEKKTPFLSLDSRHGMLACG 120
                NG  S+F+    N+ + V D R +G  NSI  + N+         +  + ML   
Sbjct: 252 EVTWMNGHNSIFATCGENNKMAVFDTRKEGIVNSI-EQGNHNGGINSCKFNYENAMLLAS 310

Query: 121 TELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGST-DGYTNVYD 179
            + +G+   I+++DIR  +KP+R L   H   ++ I++ P    ++ SG   DG   ++D
Sbjct: 311 GDSNGI---INLWDIRKLNKPIRNLY--HGSSISTIEWSPLMNEMIASGGQEDGLVKLWD 365

Query: 180 LTQVEEEDALH 190
           ++  EE   +H
Sbjct: 366 ISNEEEPIFIH 376

>Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR195C
           (MSI1) - p50 subunit of the yeast Chromatin Assembly
           Factor-I (CAF-I) negative regulator of ras-mediated cAMP
           induction; homologous to beta subunit of GTP-binding
           proteins [contig 24] FULL
          Length = 418

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 45/73 (61%), Gaps = 7/73 (9%)

Query: 116 MLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLL-SGSTDGY 174
           +L C  + +G    I+++DIR+F  P+R L   HH  V+ ++++P  P +L  +G  DG 
Sbjct: 304 LLLCSADSAG---RINLWDIRDFSSPIRSL--DHHGSVSALQWNPHHPTILATAGQDDGL 358

Query: 175 TNVYDLTQ-VEEE 186
             ++DL+Q V++E
Sbjct: 359 VKIWDLSQPVDQE 371

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 78/180 (43%), Gaps = 26/180 (14%)

Query: 19  LELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLDSDYDNGSVF--- 75
           L   P  +  LLS   +G + L  WN       V   NTS ++      D  N   +   
Sbjct: 167 LSFNPRTKGELLSCSDDGTIAL--WN-------VMGTNTSPSKAVTTHEDIVNDCTWHEF 217

Query: 76  ------SVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLD-SRHGMLACGTELSGVDA 128
                 SV+ +  +++ D R   NS V  L     +PF +LD S+H         +G D+
Sbjct: 218 NENLFGSVSEDKTLQIHDKRT--NSTVHRLT--LSSPFNTLDFSKHSQNLFAA--AGTDS 271

Query: 129 EIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEEDA 188
            +++YD+RN    +  +   H D VT ++F P    +L S  +D    ++DL Q+  E A
Sbjct: 272 LVYLYDLRNTADALHTM-SGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQA 330

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 83/199 (41%), Gaps = 35/199 (17%)

Query: 1   MSSYSLLHSNSLGRTDWCLELQPLYRHGLLSSLSNGDVNLLDWN------------TGNC 48
           + +YS    N  G     L   P+ +  LLS+  +G + + D N            T NC
Sbjct: 144 VKTYSYHKDNGYG-----LSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNC 198

Query: 49  I-RTVKAGNTSINRMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPF 107
           I   +K  +        +  + +  S++ +   D V  +++    NS+            
Sbjct: 199 IINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFNSLA----------- 247

Query: 108 LSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLL 167
            S  S++   A GT     D  +++YD+RN  K +  +   H   VT+++FH S   +L+
Sbjct: 248 FSKHSKNLFSAAGT-----DQNVYLYDLRNTRKTLHSM-SGHEGPVTNLEFHDSVDGILV 301

Query: 168 SGSTDGYTNVYDLTQVEEE 186
           S S D    ++DL ++  E
Sbjct: 302 SSSEDRRIIIWDLMEIGSE 320

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 67/141 (47%), Gaps = 15/141 (10%)

Query: 71  NGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKT-PFLSLD-SRHGMLACGTELSGVDA 128
           N +VF+    D+   L  + + N+I+   N+ K T PF +L  S+H         +G D+
Sbjct: 257 NSNVFASVSEDSTLQLHDQREQNTII---NSIKTTDPFNTLAFSKHSQYLMAA--AGTDS 311

Query: 129 EIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQV----- 183
            +++YD RN   P+  + + H D +T+++F P    VL+S   D    ++D+  +     
Sbjct: 312 LVYLYDSRNLSVPLYSM-NGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQI 370

Query: 184 --EEEDALHQVINYESVHSCG 202
             + ED   +VI   + H   
Sbjct: 371 PDDAEDGAPEVIMIHAGHRSA 391

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 83/199 (41%), Gaps = 37/199 (18%)

Query: 149 HHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEEDALHQVINYESVHS-----CGW 203
           H ++   + F+P+D   LLSGS DG   ++D+ Q     A   +  ++SVH+     C W
Sbjct: 195 HKENGYGLSFNPNDKGKLLSGSDDGTIALWDI-QENSTLAKKPLKIWDSVHNDIVNDCKW 253

Query: 204 --LSPKRIYTLSHMETFAIHELNNKSDELTEPKPLD-FGDIRGTWDCDYVVDVYPGYIAV 260
              +     ++S   T  +H+   ++  +   K  D F  +  +    Y++       A 
Sbjct: 254 NEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLM------AAA 307

Query: 261 GKSEENNGNLKIIPFHNELLNINDS--ISIP----NAHGDEVVRDVFISPKSQNIMYSCG 314
           G               + L+ + DS  +S+P    N H D +    F SP +  ++ S G
Sbjct: 308 GT--------------DSLVYLYDSRNLSVPLYSMNGHEDSITNLEF-SPHTDGVLISSG 352

Query: 315 EDGSVKTWKIEN-NSLQVP 332
            D  V  W I +  + Q+P
Sbjct: 353 NDRRVIMWDINDIGAEQIP 371

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 61/120 (50%), Gaps = 12/120 (10%)

Query: 71  NGSVFSVAMNDAV-KVLDLRVQGNSIVAELNNEKKTPFLSLDSRH---GMLACGTELSGV 126
           N  +F     D++ K+ D+R    +I A    +   PF +L   H    +LA     +G+
Sbjct: 246 NEKLFGTVSEDSLLKINDVRAHNITIDAV---KCPQPFNTLAFSHHSSNLLAA----AGM 298

Query: 127 DAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEE 186
           D+ +++YD+RN  +P+  +   H D VT+I+F      V++S  +D    ++DL Q+  E
Sbjct: 299 DSHVYLYDLRNMREPLHHM-SGHEDAVTNIEFSTHVDGVVVSSGSDNRLIMWDLKQIGAE 357

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 47/98 (47%), Gaps = 7/98 (7%)

Query: 95  IVAELNNEKKTPFLSLDSRHGMLACGTE------LSGVDAEIHIYDIRNFDKPVRMLVDS 148
           I+ + N+++    LS+ S    LA           +G D+ +++YD+R   KP+  +   
Sbjct: 241 IIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMA-G 299

Query: 149 HHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEE 186
           H D VT ++F P    +L S  +D    ++DL  +  E
Sbjct: 300 HEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAE 337

>KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 52/109 (47%), Gaps = 6/109 (5%)

Query: 70  DNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTELSGVDAE 129
           D   + S  ++    V DLR  G +IV    + K    +   S    LA G    G D  
Sbjct: 319 DGALICSGGLDSLAMVWDLR-SGKNIVTLQGHAKPVYCVDWSSNSHQLATG----GGDGV 373

Query: 130 IHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVY 178
           ++++D+R  ++P   L+ +H   V+ ++F  +  +VL+SG  D   NVY
Sbjct: 374 VNVWDLRKLEQPATKLL-AHKSIVSSLRFERNRGDVLVSGGYDRALNVY 421

>Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to
           Ashbya gossypii AEL250C
          Length = 414

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 40/75 (53%), Gaps = 8/75 (10%)

Query: 116 MLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLS-GSTDGY 174
            L C  +  G    ++I DIR  + PV+    SH D V+ I+++P  P V+ S G  DG 
Sbjct: 299 FLLCSADSEGT---LNICDIRQLEHPVKTW--SHLDAVSTIQWNPKFPTVIASAGQNDGL 353

Query: 175 TNVYDLTQVEEEDAL 189
             ++DL Q  E+D L
Sbjct: 354 VKIWDLAQ--EDDPL 366

>NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON}
           Anc_1.399
          Length = 327

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 82/186 (44%), Gaps = 19/186 (10%)

Query: 9   SNSLGRTDWCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLDSD 68
           SNS GR    ++ + +    L+S+  +  +   +  TG C RT++  ++ +NR+ +    
Sbjct: 8   SNSKGRQ---IKTRNIMSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEIT--- 61

Query: 69  YDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEK-KTPFLSLDSRHGMLACGTELSGVD 127
            ++  + + A    V++ D+R    + VA     K     +S    +  +   +E    D
Sbjct: 62  -NDKKLLAAAGYQNVRLYDIRTTNPNAVATFEGHKGNVTSVSFQQDNKWMVTSSE----D 116

Query: 128 AEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEED 187
             I ++D+R+   P       H+  V ++  HP+    L+S   DG   ++DL    E  
Sbjct: 117 GTIKVWDVRSPSVPRNY---KHNAPVNEVVIHPNQGE-LISCDRDGTIKIWDLG---ENQ 169

Query: 188 ALHQVI 193
             HQ+I
Sbjct: 170 CTHQLI 175

>NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {ON}
           Anc_6.276
          Length = 494

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 80/169 (47%), Gaps = 13/169 (7%)

Query: 23  PLYRHGLLSSLSNGDVNLLDWNTGNCIRT-VKAGNTSINRMRVLDSDYDNGSVFSVAMND 81
           P+  + L+SS  +    + D  + N ++T + A ++ +  +R L     +  +F+    D
Sbjct: 242 PIDTNLLISSSIDTTCIVWDLQSSNYVKTQLIAHDSEVYDVRFLT---QSTQLFASCGGD 298

Query: 82  -AVKVLDLRVQGNSI------VAELN-NEKKTPFLSLDSRHGMLACGTELSGVDAEIHIY 133
            +V+V DLR   +S       V++LN +  +   L L+            +    +I I 
Sbjct: 299 GSVRVFDLRSLAHSTIIYEPPVSDLNPDTSQFALLRLEPSPHDPNVMATFAADSNKILIL 358

Query: 134 DIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQ 182
           D+RN + P+ M+++ H   V  IK+HP   NVLLSG  D     +DL +
Sbjct: 359 DMRNPESPL-MILEGHSASVNQIKWHPIKRNVLLSGGDDCQVLYWDLNK 406

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 85/195 (43%), Gaps = 19/195 (9%)

Query: 8   HSNSLGRTDWCLELQPLYRHG-LLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLD 66
           H N  G   + L+  PL R G LL+   +G V     +T   + T K   T  N   + D
Sbjct: 276 HGNVEG---YALDWSPLIRSGALLTGDCSGQVYFTQRHTSKWV-TDKQPFTVSNNKSIED 331

Query: 67  SDYDN--GSVFSVAMNDA-VKVLDLRVQGNS-IVAELNNEKKTPFLSLDSRHGMLACGTE 122
             +     +VF+ A  D  ++V D R + +   ++   +      +S + + G L    +
Sbjct: 332 IQWSRTEATVFATAGCDGYIRVWDTRSKKHKPAISTKASNTDVNVISWNEKMGYLLASGD 391

Query: 123 LSGVDAEIHIYDIRNFD------KPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTN 176
            +G      ++D+R F       +PV    D H   +T I FHP+D +++   S D    
Sbjct: 392 DNGT---WGVWDLRQFSPSNENAQPVAQY-DFHKGAITSISFHPTDESIVAVASEDNTVT 447

Query: 177 VYDLTQVEEEDALHQ 191
           ++DL+   +++ + Q
Sbjct: 448 LWDLSVEADDEEIKQ 462

>Skud_7.561 Chr7 (920014..921196,921300..921898) [1782 bp, 593 aa]
           {ON} YGR225W (REAL)
          Length = 593

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 32/62 (51%), Gaps = 4/62 (6%)

Query: 108 LSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLL 167
           +SL+   G+LA G    G D    ++DI N DKPV+  V  H   V  I F P   ++L 
Sbjct: 396 ISLNEHSGLLAVG----GNDNSCSLWDISNLDKPVKKFVLPHKAAVKAIAFCPWSKSLLA 451

Query: 168 SG 169
           +G
Sbjct: 452 TG 453

>KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.399
           YNL006W
          Length = 303

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 66/149 (44%), Gaps = 16/149 (10%)

Query: 45  TGNCIRTVKAGNTSINRMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEK- 103
           TG C RT++  ++ +NR+ +     ++  + + A +  V++ D+R    + VA     K 
Sbjct: 21  TGVCSRTIQHSDSQVNRLEIT----NDKKLLAAAGHQNVRLYDIRTTNPNPVASFEGHKG 76

Query: 104 KTPFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDP 163
               LS    +  +   +E    D  I ++D+R+   P       H+  V ++  HP+  
Sbjct: 77  NVTSLSFQQDNKWMVSSSE----DGTIKVWDVRSPSIPRNY---KHNAPVNEVVIHPNQG 129

Query: 164 NVLLSGSTDGYTNVYDLTQVEEEDALHQV 192
             L+S   DG   ++DL    E    HQ+
Sbjct: 130 E-LISCDRDGNIRIWDLG---ENQCTHQL 154

>Suva_7.519 Chr7 (900889..901503) [615 bp, 205 aa] {ON} YGR225W
           (REAL)
          Length = 205

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 4/62 (6%)

Query: 108 LSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLL 167
           +SL+    +LA G    G D    ++DI N DKPV+  V  H   V  I F P   ++L 
Sbjct: 8   ISLNEHSNLLAVG----GNDNSCSLWDISNLDKPVKKFVLPHKAAVKAIAFCPWSKSLLA 63

Query: 168 SG 169
           +G
Sbjct: 64  TG 65

>CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} similar
           to uniprot|P47025 Saccharomyces cerevisiae YJL112w MDV1
          Length = 711

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 60/122 (49%), Gaps = 14/122 (11%)

Query: 105 TPFL-SLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDP 163
           TP + S+ S    LA GT+    D  I ++D+R   + VR+L + H D +T +KF   D 
Sbjct: 564 TPIIGSIQSFDAALATGTK----DGLIRLWDMRT-GEVVRVL-EGHMDAITSLKF---DA 614

Query: 164 NVLLSGSTDGYTNVYDLTQVEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHEL 223
             ++SGS DG   ++DL      + L  +I+YE   S      K I   S+     I++ 
Sbjct: 615 TTIISGSLDGTIRLWDL----RSNNLTDIISYEKPISSLDFDAKHIVVASNEHNTHIYDR 670

Query: 224 NN 225
           N+
Sbjct: 671 ND 672

>KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON}
           Anc_1.399 YNL006W
          Length = 303

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 65/149 (43%), Gaps = 16/149 (10%)

Query: 45  TGNCIRTVKAGNTSINRMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEK- 103
           TG C RT++  ++ +NR+ +     ++  +   A +  V++ D+R    + VA     K 
Sbjct: 21  TGVCSRTIQHSDSQVNRLEIT----NDKKLLGAAGHQNVRLYDIRTTNPNPVATFEGHKG 76

Query: 104 KTPFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDP 163
               LS    +  +   +E    D  I ++D+R+   P       H+  V ++  HP+  
Sbjct: 77  NVTSLSFQQDNRWMVTSSE----DGTIKVWDVRSPSVPRNY---KHNAPVNEVVIHPNQG 129

Query: 164 NVLLSGSTDGYTNVYDLTQVEEEDALHQV 192
             L+S   DG   ++DL    E    HQ+
Sbjct: 130 E-LISCDRDGNIRIWDLG---ENQCTHQL 154

>ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 68/149 (45%), Gaps = 16/149 (10%)

Query: 45  TGNCIRTVKAGNTSINRMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEK- 103
           TG C RT++  ++ +NR+ +     ++  + + A +  V++ D+R    + VA     + 
Sbjct: 21  TGVCSRTIQHSDSQVNRLEIT----NDKKLLAAAGHQNVRLYDIRTTNPNPVASFEGHRG 76

Query: 104 KTPFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDP 163
               +S    +  +A  +E    D  I ++D+R    P    +++    V ++  HP+  
Sbjct: 77  NVTSVSFQQDNKWMATSSE----DGTIKVWDVRAPSIPRNYKLNA---PVNEVVIHPNQG 129

Query: 164 NVLLSGSTDGYTNVYDLTQVEEEDALHQV 192
             L+S   DG+  ++DL    E    HQ+
Sbjct: 130 E-LISCDRDGHIRIWDLG---ENQCTHQL 154

>CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006w LST8
          Length = 303

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 32/149 (21%), Positives = 68/149 (45%), Gaps = 16/149 (10%)

Query: 45  TGNCIRTVKAGNTSINRMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEK- 103
           TG C+RT++  ++ +NR+ +     ++  + + A +  +++ D++   ++ VA     + 
Sbjct: 21  TGVCLRTIQHPDSQVNRLEIT----NDKKLLAAAGHQNIRLYDIKTSNSNPVASFEGHRG 76

Query: 104 KTPFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDP 163
               +S    +  +   +E    D  I ++DIR+   P       H+  V ++  HP+  
Sbjct: 77  NVTSVSFQQDNKWMVTSSE----DGTIKVWDIRSPSVPRNY---KHNAPVNEVVIHPNQG 129

Query: 164 NVLLSGSTDGYTNVYDLTQVEEEDALHQV 192
             L+S   DG   ++DL    E    HQ+
Sbjct: 130 E-LISCDRDGNIRIWDLG---ENQCTHQL 154

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 59/120 (49%), Gaps = 12/120 (10%)

Query: 71  NGSVFSVAMNDAV-KVLDLRVQGNSIVAELNNEKKTPFLSLDSRH---GMLACGTELSGV 126
           N  +F     D++ K+ D+R    +I      +   PF +L   H    +LA     +G+
Sbjct: 220 NKDLFGTVSEDSLLKINDVRANNTTIDTV---KCPQPFNTLAFSHHSSNLLAA----AGM 272

Query: 127 DAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEE 186
           D+ +++YD+RN  +P+  +   H D V +++F      V++S  +D    ++DL Q+  E
Sbjct: 273 DSYVYLYDLRNMKEPLHHM-SGHEDAVNNLEFSTHVDGVVVSSGSDNRLMMWDLKQIGAE 331

>TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {ON}
           Anc_1.247 YKR036C
          Length = 730

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 9/81 (11%)

Query: 102 EKKTPFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPS 161
           E K    +L      LA GT+    D  I ++D+R+ +   +++   H D +T +KF   
Sbjct: 579 ENKPIIGALQCFDSALATGTK----DGIIRLWDLRSGEIARKLI--GHQDAITSLKF--- 629

Query: 162 DPNVLLSGSTDGYTNVYDLTQ 182
           D N ++SGS DG T ++DL Q
Sbjct: 630 DTNNIISGSLDGSTRIWDLRQ 650

>KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1290

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 8/65 (12%)

Query: 119 CGTELSGVDAEIHIYDIRN---FDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYT 175
           CGT  S     + IYDI      D P  M++  H   +  + F+ +  ++L+SGS DG  
Sbjct: 184 CGTSTS-----VSIYDINRANLVDGPASMVLSKHTRSINSVDFNMAQTSLLISGSQDGCI 238

Query: 176 NVYDL 180
            V+DL
Sbjct: 239 KVWDL 243

>Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa]
           {ON} YGR225W (REAL)
          Length = 593

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 4/62 (6%)

Query: 108 LSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLL 167
           +SL+    +LA G    G D    ++DI N DKPV+  V  H   V  I F P   ++L 
Sbjct: 396 ISLNEHSNLLAVG----GNDNSCSLWDISNLDKPVKKFVLPHKAAVKAIAFCPWSKSLLA 451

Query: 168 SG 169
           +G
Sbjct: 452 TG 453

>Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}
           YPL247C (REAL)
          Length = 526

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 129 EIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           +I I D+RN + P+ + ++ H   V +IK+HP+  NVLLS S D     +DL
Sbjct: 376 KIIILDMRNPESPI-LTLEGHSSSVNEIKWHPTKRNVLLSCSDDCQVLYWDL 426

 Score = 30.4 bits (67), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 80/210 (38%), Gaps = 40/210 (19%)

Query: 124 SGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQV 183
           S +D    ++D+++    V+  + +H  +V D++F      +  S   DG   V+DL  +
Sbjct: 262 SSIDTTCIVWDLQS-SHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSL 320

Query: 184 EEEDALHQVINYESVHSCGWLSPKR--IYTLSHMETFAIHELNNKSDELTEPKPLDFGDI 241
                 H  I YE   S    S       T S   ++A+  L        EP P D    
Sbjct: 321 A-----HSTIIYEPPSSSSSSSAPAAGTTTPSSDGSYALLRL--------EPSPYD---- 363

Query: 242 RGTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVF 301
                        P  +A   ++ N    KII    ++ N    I     H   V  ++ 
Sbjct: 364 -------------PNVLATFAADSN----KIIIL--DMRNPESPILTLEGHSSSV-NEIK 403

Query: 302 ISPKSQNIMYSCGEDGSVKTWKIENNSLQV 331
             P  +N++ SC +D  V  W + N+ +++
Sbjct: 404 WHPTKRNVLLSCSDDCQVLYWDLNNSFMEI 433

>Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa]
           {ON} YDR128W - Hypothetical ORF [contig 174] FULL
          Length = 1102

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 25/45 (55%)

Query: 136 RNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           RN    +  ++  H   +TDI FHP+ P +L + S D Y + +D+
Sbjct: 100 RNSSDAIEHVLHGHSRAITDINFHPTHPEILATCSIDAYVHAWDM 144

>KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25
           YNL317W
          Length = 452

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 67/150 (44%), Gaps = 15/150 (10%)

Query: 28  GLLSSLSNGD-VNLLDWNTGNCIRTVKAGNTSINRMRVLDSDYDNGS---VFSVAMNDAV 83
           GL++S S  + V L D  TGNC+ T+        +  VL + +  G    +  ++ + + 
Sbjct: 221 GLIASASKDNLVKLWDPRTGNCVSTILKF-----KHTVLKTRFQPGGGNLLLGISKDKSC 275

Query: 84  KVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTELSGVDAEIHIYDI-RNFDKPV 142
           +V D+R     ++   ++      L     H     G      D  I  +D+ ++  KPV
Sbjct: 276 RVFDIRQNMTELMVFRDDVDYMTLLWHPINHSTFTVG----NYDGSIKHFDVLQDITKPV 331

Query: 143 RMLVDSHHDDVTDIKFHPSDPNVLLSGSTD 172
            ++  +H   VT + ++P+  N+L S S D
Sbjct: 332 HVIPFAHDKCVTSLSYNPAG-NILASASKD 360

>KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 417

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 44/82 (53%), Gaps = 5/82 (6%)

Query: 108 LSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLL 167
           +  + ++ M+ C  +  G   ++ I+DIR+F +P++       D ++ I+++P  P +L 
Sbjct: 287 IEFNYKNDMILCTGDSQG---QLKIWDIRDFKEPIKEWEHGDQDPISAIQWNPQIPQILA 343

Query: 168 SG-STDGYTNVYDLTQVEEEDA 188
           +     G   ++D +  E+ED+
Sbjct: 344 TADQQSGLVKIWDASG-EQEDS 364

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 88/197 (44%), Gaps = 22/197 (11%)

Query: 8   HSNSLGRTDWCLELQPLYRHG-LLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLD 66
           H N  G   + L+  PL + G LL+   +G + L   +T   I T K   T+ N   V D
Sbjct: 276 HGNVEG---YGLDWSPLIKTGALLTGDCSGQIFLTQRHTSKWI-TDKQPFTAANNQSVED 331

Query: 67  SDYD--NGSVFSVAMNDA-VKVLDLRVQGNS-IVAELNNEKKTPFLSLDSRHG-MLACGT 121
             +     +VF+ +  D  V++ D R + +   ++   +      +S + + G +LA G 
Sbjct: 332 IQWSPTESTVFATSGTDGYVRIWDTRSKKHKPAISTRASNTDVNVISWNEKLGYLLASGD 391

Query: 122 ELSGVDAEIHIYDIRNFD-------KPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGY 174
           +    +    ++D+R F        +PV    D H   +T I F+P D +V+   S D  
Sbjct: 392 D----NGSWGVWDLRQFSPANSEGVQPVAQY-DFHRGPITSISFNPLDDSVVAVASEDNT 446

Query: 175 TNVYDLTQVEEEDALHQ 191
             ++DL+   ++D + Q
Sbjct: 447 VTLWDLSVEADDDEIQQ 463

>Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON}
           complement(37021..37932) [912 nt, 304 aa]
          Length = 303

 Score = 37.7 bits (86), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 66/149 (44%), Gaps = 16/149 (10%)

Query: 45  TGNCIRTVKAGNTSINRMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEK- 103
           TG C RT++  ++ +NR+ +     ++  + + A +  VK+ D+     + VA     + 
Sbjct: 21  TGVCSRTIQHSDSQVNRLTIT----NDKKLLAAAGHQNVKLYDINTTNPNPVASFEGHRG 76

Query: 104 KTPFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDP 163
               LS  + +  +   +E    D  I ++D+R+   P       H+  V ++  HP+  
Sbjct: 77  NVTSLSFQNDNRWMVTSSE----DGTIKVWDVRSPSVPRTY---KHNAPVNEVAIHPNQG 129

Query: 164 NVLLSGSTDGYTNVYDLTQVEEEDALHQV 192
             L+S   DG   ++DL    E    HQ+
Sbjct: 130 E-LISCDRDGNIRIWDL---GENQCTHQL 154

>KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1101

 Score = 38.1 bits (87), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%)

Query: 136 RNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           R+    V  ++  H   +TDI FHP++P +L + S D Y + +D+
Sbjct: 100 RSSSNAVEHVLHGHSRAITDINFHPTNPEILATCSIDAYVHAWDM 144

>TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1.399
           YNL006W
          Length = 303

 Score = 37.7 bits (86), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 64/149 (42%), Gaps = 16/149 (10%)

Query: 45  TGNCIRTVKAGNTSINRMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEK- 103
           TG C RT++  ++ +NR+ +      +  + + A +  V++ D+R    + VA     + 
Sbjct: 21  TGVCSRTIQHSDSQVNRLEIT----SDKKLLAAAGHQNVRLYDIRTTNPNPVASFEGHRG 76

Query: 104 KTPFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDP 163
               +S    +  +   +E    D  I ++D+R    P       H+  V ++  HP+  
Sbjct: 77  NVTSISFQQDNKWMVSSSE----DGTIKVWDVRAPSVPRNY---KHNAPVNEVVIHPNQG 129

Query: 164 NVLLSGSTDGYTNVYDLTQVEEEDALHQV 192
             L+S   DG   ++DL    E    HQ+
Sbjct: 130 E-LISCDRDGNIRIWDLG---ENQCTHQL 154

>Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score = 37.4 bits (85), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 66/149 (44%), Gaps = 16/149 (10%)

Query: 45  TGNCIRTVKAGNTSINRMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEK- 103
           TG C RT++  ++ +NR+ +     ++  + + A +  V++ D+R    + VA     + 
Sbjct: 21  TGVCSRTIQHSDSQVNRLEIT----NDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRG 76

Query: 104 KTPFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDP 163
               +S    +  +   +E    D  I ++D+R+   P       H+  V ++  HP+  
Sbjct: 77  NVTSVSFQQDNRWMVTSSE----DGTIKVWDVRSPSIPRNY---KHNAPVNEVVIHPNQG 129

Query: 164 NVLLSGSTDGYTNVYDLTQVEEEDALHQV 192
             L+S   DG   ++DL    E    HQ+
Sbjct: 130 E-LISCDRDGNIRIWDLG---ENQCTHQL 154

>Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score = 37.4 bits (85), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 66/149 (44%), Gaps = 16/149 (10%)

Query: 45  TGNCIRTVKAGNTSINRMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEK- 103
           TG C RT++  ++ +NR+ +     ++  + + A +  V++ D+R    + VA     + 
Sbjct: 21  TGVCSRTIQHSDSQVNRLEIT----NDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRG 76

Query: 104 KTPFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDP 163
               +S    +  +   +E    D  I ++D+R+   P       H+  V ++  HP+  
Sbjct: 77  NVTSVSFQQDNRWMVTSSE----DGTIKVWDVRSPSIPRNY---KHNAPVNEVVIHPNQG 129

Query: 164 NVLLSGSTDGYTNVYDLTQVEEEDALHQV 192
             L+S   DG   ++DL    E    HQ+
Sbjct: 130 E-LISCDRDGNIRIWDLG---ENQCTHQL 154

>ZYRO0F11484g Chr6 complement(943018..943902) [885 bp, 294 aa] {ON}
           highly similar to uniprot|Q04491 Saccharomyces
           cerevisiae YLR208W SEC13 Component of both the Nup84
           nuclear pore sub-complex and of the COPII complex (Sar1p
           Sec13p Sec16p Sec23p Sec24p Sec31p Sfb2p and Sfb3p)
           which is important for the formation of ER to Golgi
           transport vesicles
          Length = 294

 Score = 37.4 bits (85), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 37/81 (45%), Gaps = 6/81 (7%)

Query: 248 DYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFISPKSQ 307
           D V+D Y   +A   S++    +KI     E   + +++S    H   V R  +  PK  
Sbjct: 14  DAVLDYYGRRLATCSSDKT---IKIFEVEGETHKLVETLS---GHEGPVWRVAWAHPKFG 67

Query: 308 NIMYSCGEDGSVKTWKIENNS 328
            I+ SC  DG V  WK EN S
Sbjct: 68  TILASCSYDGKVLIWKEENGS 88

>Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score = 37.4 bits (85), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 66/149 (44%), Gaps = 16/149 (10%)

Query: 45  TGNCIRTVKAGNTSINRMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEK- 103
           TG C RT++  ++ +NR+ +     ++  + + A +  V++ D+R    + VA     + 
Sbjct: 21  TGVCSRTIQHSDSQVNRLEIT----NDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRG 76

Query: 104 KTPFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDP 163
               +S    +  +   +E    D  I ++D+R+   P       H+  V ++  HP+  
Sbjct: 77  NVTSVSFQQDNRWMVTSSE----DGTIKVWDVRSPSIPRNY---KHNAPVNEVVIHPNQG 129

Query: 164 NVLLSGSTDGYTNVYDLTQVEEEDALHQV 192
             L+S   DG   ++DL    E    HQ+
Sbjct: 130 E-LISCDRDGNIRIWDLG---ENQCTHQL 154

>YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protein
           required for the transport of amino acid permease Gap1p
           from the Golgi to the cell surface; component of the TOR
           signaling pathway; associates with both Tor1p and Tor2p;
           contains a WD-repeat
          Length = 303

 Score = 37.4 bits (85), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 66/149 (44%), Gaps = 16/149 (10%)

Query: 45  TGNCIRTVKAGNTSINRMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEK- 103
           TG C RT++  ++ +NR+ +     ++  + + A +  V++ D+R    + VA     + 
Sbjct: 21  TGVCSRTIQHSDSQVNRLEIT----NDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRG 76

Query: 104 KTPFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDP 163
               +S    +  +   +E    D  I ++D+R+   P       H+  V ++  HP+  
Sbjct: 77  NVTSVSFQQDNRWMVTSSE----DGTIKVWDVRSPSIPRNY---KHNAPVNEVVIHPNQG 129

Query: 164 NVLLSGSTDGYTNVYDLTQVEEEDALHQV 192
             L+S   DG   ++DL    E    HQ+
Sbjct: 130 E-LISCDRDGNIRIWDLG---ENQCTHQL 154

>Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa]
           {ON} complement(180839..181954) [1116 nt, 372 aa]
          Length = 371

 Score = 37.4 bits (85), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 72/185 (38%), Gaps = 45/185 (24%)

Query: 19  LELQPLYRHGLLS---SLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLDSDYDNGSVF 75
           L++QP+ +  L+    + +NG    +  N  NCI   +             S +D   V 
Sbjct: 144 LQVQPVMQSQLVDNTIAKTNGSRGTISANK-NCIYQAQF------------SPHDENLVM 190

Query: 76  SVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACG--------TELSGVD 127
             + N  V + DLR Q NS      N K+  FL+ +     L C            SGVD
Sbjct: 191 CCSGNSYVTLFDLR-QPNS------NNKQQRFLAHNGSE-TLTCDFNKYRPTVVATSGVD 242

Query: 128 AEIHIYDIRNF-------------DKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGY 174
           + I I+DIR                  +  +  +H   V  + + P  PNVLLS S D  
Sbjct: 243 SSIRIWDIRMLVNLGPQSQHINSSAACINEITRAHELAVRKVAWSPHHPNVLLSASYDMT 302

Query: 175 TNVYD 179
            +V+ 
Sbjct: 303 CSVWQ 307

>TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON}
           Anc_6.9 YEL056W
          Length = 391

 Score = 37.4 bits (85), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 8/77 (10%)

Query: 124 SGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQV 183
           +G    I++YDIRN  K +  +   H + VT ++F      +L+SGS+D    ++DL ++
Sbjct: 260 AGTTNNIYLYDIRNTGKILHSMT-GHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEI 318

Query: 184 -------EEEDALHQVI 193
                  E +D L +V+
Sbjct: 319 GAEQQPDEADDGLPEVM 335

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 49/101 (48%), Gaps = 12/101 (11%)

Query: 91  QGNSIVAELNNEKKTPFLSL-----DSRHGML----ACGTELSGVD-AEIHIYDIRN--F 138
           +G   + + + +K++  LS      D+ +G+     A G  +SG D + I ++D  N   
Sbjct: 127 EGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKL 186

Query: 139 DKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYD 179
            +P++    SH D V D ++H  + N+  S S D    ++D
Sbjct: 187 KQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFD 227

>TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.276
           YPL247C
          Length = 598

 Score = 37.4 bits (85), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 35/72 (48%), Gaps = 2/72 (2%)

Query: 125 GVDAE-IHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQV 183
           G+D + I I D+RN   PV +++  H   V  IK+HPS P VLLS   D     +DL   
Sbjct: 433 GLDKKAILILDMRNPGVPV-LVLSGHSPSVNQIKWHPSKPYVLLSCGDDCQVLYWDLNSE 491

Query: 184 EEEDALHQVINY 195
                 H   N+
Sbjct: 492 LNPKVTHLARNH 503

>KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score = 37.0 bits (84), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 32/149 (21%), Positives = 64/149 (42%), Gaps = 16/149 (10%)

Query: 45  TGNCIRTVKAGNTSINRMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQG-NSIVAELNNEK 103
           TG C RT++  ++ +NR+ +      +    + A +  V++ D+R    N + +   +  
Sbjct: 21  TGVCSRTIQHSDSQVNRLEIT----SDKRFLAAAGHLNVRLYDIRTTNPNPVTSFEGHRG 76

Query: 104 KTPFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDP 163
               ++    +  +   +E    D  I ++D+R    P       HH  V ++  HP+  
Sbjct: 77  NVTSIAFQQENKWMVSSSE----DGTIKVWDVR---APSVQRNYKHHAAVNEVVIHPNQG 129

Query: 164 NVLLSGSTDGYTNVYDLTQVEEEDALHQV 192
             L+S   DG   ++DL    E   +HQ+
Sbjct: 130 E-LISCDQDGNIKIWDLG---ENQCVHQL 154

>NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON} 
          Length = 303

 Score = 36.6 bits (83), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 67/155 (43%), Gaps = 16/155 (10%)

Query: 45  TGNCIRTVKAGNTSINRMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEK- 103
           TG C RT++  ++ +NR+++     ++  + + A +  VK+ D+     + V      K 
Sbjct: 21  TGVCSRTIQHSDSQVNRLQIT----NDKKLLAAAGHLNVKLYDINTTNPNPVGSFEGHKG 76

Query: 104 KTPFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDP 163
               +S    +  +   +E    D  I ++D+R+   P       H+  V ++  HP+  
Sbjct: 77  NVTSVSFQQDNRWMVTSSE----DGTIKVWDVRSPSVPRNY---KHNAPVNEVVIHPNQG 129

Query: 164 NVLLSGSTDGYTNVYDLTQVEEEDALHQVINYESV 198
             L+S   DG   ++DL    E    HQ+   E V
Sbjct: 130 E-LISCDRDGNIRIWDLG---ENQCTHQITPEEDV 160

>Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,
           581 aa] {ON} complement(43262..43506,43751..45251) [1746
           nt, 582 aa]
          Length = 581

 Score = 37.0 bits (84), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 65/144 (45%), Gaps = 13/144 (9%)

Query: 75  FSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTELSGVDAEIHIYD 134
           F+V  +  V++   R +   +V   +  K   + +     G L C  + +G+   + +YD
Sbjct: 55  FAVTSSTRVQIFSSRTR--QVVKTFSRFKDVVYSASFRNDGKLLCAGDATGL---VSVYD 109

Query: 135 IRNFDKPVRML---VDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQV-EEEDALH 190
             +++  V +L     +H   VT  KFH  DP  L++ S D  T ++D++   E +  L 
Sbjct: 110 --SYNPRVLLLSIKASTHPTHVT--KFHTQDPKTLITASDDRVTRLWDISHAYEPQIELT 165

Query: 191 QVINYESVHSCGWLSPKRIYTLSH 214
              +Y    SC   +P  I T S+
Sbjct: 166 GASDYVRTVSCIPSAPHLISTGSY 189

>SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {ON}
           highly similar to uniprot|P41318 Saccharomyces
           cerevisiae YNL006W LST8 Protein required for the
           transport of amino acid permease Gap1p from the Golgi to
           the cell surface component of the TOR signaling pathway
           associates with both Tor1p and Tor2p contains a
           WD-repeat
          Length = 303

 Score = 36.6 bits (83), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 63/149 (42%), Gaps = 16/149 (10%)

Query: 45  TGNCIRTVKAGNTSINRMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQG-NSIVAELNNEK 103
           TG C RT++  ++ +NR+ +      +    + A +  V++ D+R    N + +   +  
Sbjct: 21  TGVCSRTIQHADSQVNRLEIT----SDKRFLAAAGHLHVRLYDIRTTNPNPVTSFEGHRG 76

Query: 104 KTPFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDP 163
               +S    +  +   +E    D  I ++D+R    P       HH  V ++  HP+  
Sbjct: 77  NVTSISFQQDNKWMVSSSE----DGTIKVWDVR---APSVQRNYKHHAPVNEVVIHPNQG 129

Query: 164 NVLLSGSTDGYTNVYDLTQVEEEDALHQV 192
             L+S   DG   ++DL    E    HQ+
Sbjct: 130 E-LISCDQDGNIRIWDLG---ENQCTHQL 154

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 48/207 (23%), Positives = 82/207 (39%), Gaps = 31/207 (14%)

Query: 130 IHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLT--QVEEED 187
           + +YDIR  +       + H  +VT I F   D   ++S S DG   V+D+    V+   
Sbjct: 55  VRLYDIRTTNPNPVTSFEGHRGNVTSISFQ-QDNKWMVSSSEDGTIKVWDVRAPSVQRNY 113

Query: 188 ALHQVINYESVH-------SCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGD 240
             H  +N   +H       SC      RI+ L   E    H+L  + D      PL    
Sbjct: 114 KHHAPVNEVVIHPNQGELISCDQDGNIRIWDLG--ENQCTHQLTPEDD-----TPLQSLS 166

Query: 241 IRGTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDV 300
           I              G + V  + + N  +  +P H +  N+   ++   +H   + R V
Sbjct: 167 IAS-----------DGSMLVAGNNKGNCYVWQMPNHTDAANLK-PVTKFRSHTKYITR-V 213

Query: 301 FISPKSQNIMYSCGEDGSVKTWKIENN 327
            +S   +++  +C  D + + W IE+N
Sbjct: 214 LLSSDVKHLA-TCSADHTARVWSIEDN 239

>KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON}
           similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1133

 Score = 37.0 bits (84), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%)

Query: 136 RNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           R+  K V  ++  H   +TDI FHP  P +L + S D Y   +D+
Sbjct: 100 RSSSKAVEHVLHGHFRAITDINFHPLQPEILATSSIDTYALAWDM 144

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 130 IHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEE 186
           ++++D+R    P+ +L + H   V  I F+P +   ++S   DG    +D  +VE+E
Sbjct: 182 VYVWDVRKGTSPLSVL-EGHSGSVNSIDFNPFNETEIMSSGNDGTVKFWDYNKVEDE 237

>YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and nucleus; similar to the petunia WD repeat protein
           an11; overexpression causes a cell cycle delay or arrest
          Length = 523

 Score = 37.0 bits (84), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 47/210 (22%), Positives = 81/210 (38%), Gaps = 42/210 (20%)

Query: 124 SGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQV 183
           S +D    ++D+++    V+  + +H  +V D++F      +  S   DG   V+DL  +
Sbjct: 262 SSIDTTCIVWDLQSSHY-VKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSL 320

Query: 184 EEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELT--EPKPLDFGDI 241
                 H  I YE   S          ++S      I   +  SD L   EP P D    
Sbjct: 321 A-----HSTIIYEPPSS----------SVSGATAGTITPSSKGSDALLRLEPSPYD---- 361

Query: 242 RGTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVF 301
                        P  +A   ++ N    KII    ++ N    I     HG  V   + 
Sbjct: 362 -------------PNVLATFAADSN----KIIIL--DMRNPESPILNLQGHGSSV-NGIK 401

Query: 302 ISPKSQNIMYSCGEDGSVKTWKIENNSLQV 331
             P  +N++ SCG+D  V  W + ++ +++
Sbjct: 402 WHPTKRNVLLSCGDDCQVLYWDLNSSFMEI 431

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score = 36.6 bits (83), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 34/158 (21%), Positives = 72/158 (45%), Gaps = 10/158 (6%)

Query: 29  LLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLDSDYDNG--SVFSVAMNDAVKVL 86
           LLS   +G + L  WN  N   +     +S++   V D  + N   +VF     D+   L
Sbjct: 188 LLSGSDDGTIAL--WNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQL 245

Query: 87  DLRVQGNSIVAELNNEKKTPFLSLD-SRHGMLACGTELSGVDAEIHIYDIRNFDKPVRML 145
             + + ++  ++   +   PF +L  S+H         +G D+ ++++D R+  +P+  +
Sbjct: 246 HDQREKDTFTSQFKVD--APFNTLAFSKHSQYLFAA--AGTDSHVYLFDRRDISRPLHSM 301

Query: 146 VDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQV 183
              H   VT+++F P    +L++   D    ++D+  +
Sbjct: 302 A-GHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDI 338

>Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C
           (REAL)
          Length = 523

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 52/121 (42%), Gaps = 17/121 (14%)

Query: 76  SVAMNDAVKVLDLRVQGNSIV---------AELNNEKKTP-------FLSLDSRHGMLAC 119
           S   + +V+V DLR   +S +           LN +  TP        L L+        
Sbjct: 305 SCGGDGSVRVFDLRSLAHSTIIYEPPASSAPGLNADTTTPASKGSDALLRLEPSPYDPNV 364

Query: 120 GTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYD 179
               +    +I I D+RN + P+ + ++ H   V +IK+HP+  NVLLS   D     +D
Sbjct: 365 LATFAAESNKIIILDMRNPESPI-LNLEGHSSSVNEIKWHPTKRNVLLSCGDDCQVLYWD 423

Query: 180 L 180
           L
Sbjct: 424 L 424

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 82/212 (38%), Gaps = 46/212 (21%)

Query: 124 SGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQV 183
           S +D    ++D+++    V+  + +H  +V D++F      +  S   DG   V+DL  +
Sbjct: 262 SSIDTTCIVWDLQSSHY-VKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSL 320

Query: 184 EEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDEL--TEPKPLDFGDI 241
                 H  I YE   S          +   +        +  SD L   EP P D    
Sbjct: 321 A-----HSTIIYEPPAS----------SAPGLNADTTTPASKGSDALLRLEPSPYD---- 361

Query: 242 RGTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNI-NDSISIPNAHG-DEVVRD 299
                        P  +A   +E N    KII     +L++ N    I N  G    V +
Sbjct: 362 -------------PNVLATFAAESN----KII-----ILDMRNPESPILNLEGHSSSVNE 399

Query: 300 VFISPKSQNIMYSCGEDGSVKTWKIENNSLQV 331
           +   P  +N++ SCG+D  V  W + N+ +++
Sbjct: 400 IKWHPTKRNVLLSCGDDCQVLYWDLNNSFMEI 431

>TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {ON}
           Anc_8.631 YOR212W
          Length = 431

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 7/68 (10%)

Query: 113 RHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTD 172
           +  M A G    G D+ +HI+D R      +  +   + DV  +KF+ +D N ++SGS D
Sbjct: 246 KTNMFATG----GSDSYVHIWDTRAPSSVQKFYI--SNSDVNTVKFY-NDGNAIVSGSDD 298

Query: 173 GYTNVYDL 180
           G   +YDL
Sbjct: 299 GIIRLYDL 306

>Kpol_1013.37 s1013
           complement(88637..88936,88986..88994,89037..90134) [1407
           bp, 468 aa] {ON}
           complement(88637..88936,88986..88994,89037..90134) [1407
           nt, 469 aa]
          Length = 468

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 53/109 (48%), Gaps = 9/109 (8%)

Query: 71  NGSVFSVAMNDAVKVL-DLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTELSGVDAE 129
           +GS+ + A  D V ++ DLR   N  +  L    K  + S  S++G        SG D  
Sbjct: 321 DGSLIATAGADKVGIIWDLRSGKN--ILSLVGHAKPIYCSDWSQNGY---QXXXSG-DGT 374

Query: 130 IHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVY 178
           I I+D+R  D    +L  +H + VTD+KF   +   L+S S D   NV+
Sbjct: 375 IKIWDLRKVDDVETIL--AHKNVVTDLKFEKENSKFLISSSYDKDINVF 421

>Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}
           YPL247C (REAL)
          Length = 522

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 129 EIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           +I I D+RN + P+ + ++ H   V +IK+HP+  NVLLS S D     +DL
Sbjct: 374 KIIILDMRNPESPI-LNLEGHTCSVNEIKWHPTKRNVLLSCSDDCQALYWDL 424

>Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782
           bp, 593 aa] {ON} YGR225W (REAL)
          Length = 593

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 4/62 (6%)

Query: 108 LSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLL 167
           +SL+    +LA G    G D    ++DI + DKP++  V  H   V  I F P   ++L 
Sbjct: 396 ISLNEHSNLLAVG----GNDNSCSLWDISDLDKPIKKFVLPHKAAVKAIAFCPWSKSLLA 451

Query: 168 SG 169
           +G
Sbjct: 452 TG 453

>KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, 697
           aa] {ON} similar to uniprot|Q06440 Saccharomyces
           cerevisiae YLR429W CRN1 Coronin cortical actin
           cytoskeletal component that associates with the
           Arp2p/Arp3p complex to regulate its activity
          Length = 697

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 39/81 (48%), Gaps = 3/81 (3%)

Query: 244 TWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFIS 303
            WD + ++ V P +I+V  +    G   +IP  NE+    D + +   H   V+ D    
Sbjct: 34  AWDSN-LIKVNPKFISVNWNSSGGGAFAVIPL-NEVGKAPDQVPLFRGHTAHVL-DTDFD 90

Query: 304 PKSQNIMYSCGEDGSVKTWKI 324
           P + NI+ S  +DG +  W+I
Sbjct: 91  PFNDNIIASGSDDGKIGIWEI 111

>YGR225W Chr7 (945145..946327,946421..947019) [1782 bp, 593 aa] {ON}
            AMA1Activator of meiotic anaphase promoting complex
           (APC/C); Cdc20p family member; required for initiation
           of spore wall assembly; required for Clb1p degradation
           during meiosis
          Length = 593

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 4/62 (6%)

Query: 108 LSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLL 167
           +SL+    +LA G    G D    ++DI + DKP++  V  H   V  I F P   ++L 
Sbjct: 396 ISLNEHANLLAVG----GNDNSCSLWDISDLDKPIKKFVLPHKAAVKAIAFCPWSKSLLA 451

Query: 168 SG 169
           +G
Sbjct: 452 TG 453

>Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {ON}
           complement(61507..62967) [1461 nt, 487 aa]
          Length = 486

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 52/120 (43%), Gaps = 14/120 (11%)

Query: 76  SVAMNDAVKVLDLRVQGNS-IVAELNNEK----------KTP--FLSLDSRHGMLACGTE 122
           S   + +V+V DLR   +S I+ E N+++          K+P   L L            
Sbjct: 284 SCGGDGSVRVFDLRSLAHSTIIYESNSDQNGSDTLTDNEKSPSALLRLQPSPSDPNVMAT 343

Query: 123 LSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQ 182
            +     I I D+RN   PV + ++ H   V  IK+HP   NVLLS   D     +DL +
Sbjct: 344 FALDSKSILILDMRNPGSPV-LTLEGHSAAVNQIKWHPKKSNVLLSCGDDCQVLYWDLNE 402

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 6/74 (8%)

Query: 124 SGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQV 183
           S +D    ++D+++ +  VR  + +H  +V D+KF      +  S   DG   V+DL  +
Sbjct: 241 SSIDTTCIVWDLQSSNY-VRTQLIAHDSEVFDVKFLAHSTQLFASCGGDGSVRVFDLRSL 299

Query: 184 EEEDALHQVINYES 197
                 H  I YES
Sbjct: 300 A-----HSTIIYES 308

>Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON}
           YOL138C - Hypothetical ORF [contig 124] FULL
          Length = 1286

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 8/65 (12%)

Query: 119 CGTELSGVDAEIHIYDIRN---FDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYT 175
           CGT  S     + IYDI      + P+  ++  H   +  + F+ +  ++L+SGS DG  
Sbjct: 184 CGTSTS-----VSIYDINKANTLEGPLTTILSKHTRSINSVDFNMAQSSLLISGSQDGCI 238

Query: 176 NVYDL 180
            V+DL
Sbjct: 239 KVWDL 243

>NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON}
           Anc_7.534
          Length = 474

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 56/111 (50%), Gaps = 11/111 (9%)

Query: 70  DNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLD-SRHGM-LACGTELSGVD 127
           D   + S  +++A  V D+R  G SI+    + K  P  S+D S  G  +A G    G D
Sbjct: 328 DGALLCSGGLDNAAIVWDVRT-GKSIMNLQGHAK--PIYSVDWSPDGYHIATG----GGD 380

Query: 128 AEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVY 178
             I+I+DIR   +  R+L  +H++ VT ++F  S  + L+S   D    +Y
Sbjct: 381 GVINIWDIRKTTETTRLL--AHNNIVTGVRFQKSTGHCLVSCGYDKQIRIY 429

>KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {ON}
           Anc_6.276 YPL247C
          Length = 553

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 53/116 (45%), Gaps = 13/116 (11%)

Query: 76  SVAMNDAVKVLDLRVQGNSIV-----------AELNNEKKTPFLSLDSRHGMLACGTELS 124
           S   + +V+V DLR   +S +           A+L+ +++   L L+             
Sbjct: 342 SCGGDGSVRVFDLRSLAHSTIIYEPPTNPVSNADLS-QQQNALLRLEPSPTDANVIATFV 400

Query: 125 GVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
               +I I D+RN + PV ++++ H   +  IK+HP+   +LLS S D     +DL
Sbjct: 401 SESNKILILDMRNSESPV-LVLEGHKSAINQIKWHPTKRYILLSCSDDCQVLYWDL 455

>Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa]
           {ON} YBR175W (SWD3) - YBR175W [contig 22] FULL
          Length = 316

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 5/68 (7%)

Query: 112 SRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGST 171
           +  G L C   +   D  I I+DI      +   + +H + V  I   P DP++L SGS 
Sbjct: 108 TMKGNLLCSCSM---DESIKIWDI--LSGTLLRTLSAHSEPVVSIDLPPFDPSILSSGSY 162

Query: 172 DGYTNVYD 179
           DG   ++D
Sbjct: 163 DGLIRIFD 170

>KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 459

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 76/146 (52%), Gaps = 20/146 (13%)

Query: 69  YDNGSVFSVAMNDAVKVL-DLRVQGNSIVAELNNEKKTPFLSLD-SRHG-MLACGTELSG 125
           +++GS+ S A  DA+ ++ D+R  G +I++   + K  P  S+D S++G  LA G+    
Sbjct: 314 HNDGSLVSTAGLDAIALIWDIR-SGKNIMSLQGHSK--PIYSVDWSQNGYQLASGSG--- 367

Query: 126 VDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYD----LT 181
            D  I ++DIR       +L  +H+  V+ +KF+  +   L+S   D   N+++    + 
Sbjct: 368 -DGTIKVWDIRKKGNVETIL--AHNSIVSQVKFNKQNGGYLVSSGYDKKVNIFNDGNWIK 424

Query: 182 QVEEEDALHQVINYE----SVHSCGW 203
           +   E  L +V++ +     ++S GW
Sbjct: 425 ERSLEGHLDKVMSIDIVGPDIYSAGW 450

>SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1140

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 23/45 (51%)

Query: 136 RNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           RN    +  ++  H   +TDI FHP  P +L + S D Y   +D+
Sbjct: 100 RNSTNAIEHILHGHFRAITDINFHPHHPEILATCSVDTYVLAWDM 144

>SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1353

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 8/65 (12%)

Query: 119 CGTELSGVDAEIHIYDIRN---FDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYT 175
           CGT  S     + +YDI      D P+   +  H   +  + F+ S  N+L+SG  DG  
Sbjct: 200 CGTSTS-----VSVYDINKTSTIDNPLVTTLSEHTRSINSVDFNMSQTNLLISGGQDGCI 254

Query: 176 NVYDL 180
            V+DL
Sbjct: 255 KVWDL 259

>Kpol_1054.60 s1054 (148854..151013) [2160 bp, 719 aa] {ON}
           (148854..151013) [2160 nt, 720 aa]
          Length = 719

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 294 DEVVRDVFISPKSQNIMYSCGEDGSVKTWKIENNSLQV 331
           +  V  V ISPKS+ ++ SCGED SV+ W  E +  QV
Sbjct: 231 ESFVYSVIISPKSKELI-SCGEDRSVRIWSYEGDVQQV 267

>Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W
           (WTM2) - Transcriptional modulator [contig 67] FULL
          Length = 381

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 36/76 (47%), Gaps = 5/76 (6%)

Query: 127 DAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL-----T 181
           D +I  YD R   KP+  + D H   +T     P+   + ++GS  G   ++DL      
Sbjct: 186 DNKIRFYDTRGDGKPLWEVCDPHDGRLTCFDVSPALETLFVTGSDTGVLKLWDLRSVIAA 245

Query: 182 QVEEEDALHQVINYES 197
           Q+E+++ +     Y+S
Sbjct: 246 QLEQQEPMEIAKLYQS 261

>NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {ON}
           Anc_6.276 YPL247C
          Length = 524

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 129 EIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           +I I D+RN + PV + +  H   +  IK+HP++ N+LLS + D     +DL
Sbjct: 372 KIIILDMRNPETPV-LTLQGHSSSLNQIKWHPTERNILLSCADDCQVLYWDL 422

>KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {ON}
           highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093W UTP15 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 507

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 129 EIHIYDIRN-FDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEE 185
            + IYD  N   + V +   SH   V   KFHP+D   L++ S D    V+D+TQ +E
Sbjct: 104 RVSIYDSYNPRTQLVSIAASSHPTHVA--KFHPADSRTLVTASDDRVVRVWDITQAQE 159

 Score = 33.5 bits (75), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 53/128 (41%), Gaps = 13/128 (10%)

Query: 77  VAMNDAVKVLDL------RVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTELSGVDAEI 130
           +AM DA   + +      R Q  SI A  +      F   DSR  + A        D  +
Sbjct: 96  LAMGDATGRVSIYDSYNPRTQLVSIAASSHPTHVAKFHPADSRTLVTASD------DRVV 149

Query: 131 HIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEEDALH 190
            ++DI    +P   L  +  D V  +   P  P+++++GS DG+  ++D    E    L 
Sbjct: 150 RVWDITQAQEPQVELTGAA-DYVRSVCMVPQAPHLVVTGSYDGFVRLFDTRSNEAATTLV 208

Query: 191 QVINYESV 198
           Q +  E V
Sbjct: 209 QGMPVEDV 216

>KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {ON}
           Anc_6.276 YPL247C
          Length = 504

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 129 EIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           +I I D+RN + P  + +  H   V  IK+HP+  NVLLS S D     +DL
Sbjct: 371 DILILDMRNPESPA-LTLKGHSSLVNQIKWHPTKRNVLLSCSDDCQVLYWDL 421

>TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON}
           Anc_6.276 YPL247C Two N bases added to fix a frameshift
           that can't be corrected using the reads.
          Length = 447

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 76/166 (45%), Gaps = 19/166 (11%)

Query: 29  LLSSLSNGDVNLLDWNTGNCIRT-VKAGNTSINRMRVLDSDYDNGSVFSVAMND-AVKVL 86
           L+SS  +    + D  + N I+T + A ++ +  +R L     +  +F+    D +V+V 
Sbjct: 226 LISSSIDTTCIVWDLQSANYIKTQLIAHDSEVFDVRFLT---QSTQLFASCGGDGSVRVF 282

Query: 87  DLRVQGNS-IVAELNNEKKTPFLSLDSRHGMLACGTELSGVD-----------AEIHIYD 134
           DLR   +S I+ E       P L   +    L    E S  D           +++ I D
Sbjct: 283 DLRCLAHSTIIYEPTIPDGAPDLPSPTVPPAL-LRLEPSPFDPNVIATFAIDSSKVLILD 341

Query: 135 IRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           +R+   P+ + +++H   +  IK+HP+  NVLLS S D     +DL
Sbjct: 342 MRSPGSPL-LTLEAHTAPINQIKWHPTRRNVLLSASDDCQVLYWDL 386

>AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL247C
          Length = 438

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 44/96 (45%), Gaps = 8/96 (8%)

Query: 132 IYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEEDALHQ 191
           I D+R    P+ +L++ H   V  +K+HPS PNVL +   D     +DL ++     +  
Sbjct: 326 ILDMRYPGSPM-LLLEGHAAPVNQLKWHPSKPNVLATCGDDCQILYWDLLELLSASQVWT 384

Query: 192 VINYESVHSCGWLSPKRIYTLS--HMETFAIHELNN 225
            +  +      W +   + TL    M   A +E+NN
Sbjct: 385 GLTQQR-----WSTTSTVRTLETPQMSYTAQYEVNN 415

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 86/197 (43%), Gaps = 22/197 (11%)

Query: 8   HSNSLGRTDWCLELQPLYRHG-LLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLD 66
           H N  G   + L+  PL + G LLS   +G + L   +T   + T K   T  N   + D
Sbjct: 270 HGNVEG---YGLDWSPLIKTGALLSGDCSGQIYLTQRHTSRWV-TDKQSFTVSNNESIED 325

Query: 67  SDYDN--GSVFSVAMNDA-VKVLDLRVQGN--SIVAELNNEKKTPFLSLDSRHGMLACGT 121
             +     +VF+ A  D  +++ D R + +  +I  + +N         D    +LA G 
Sbjct: 326 IQWSRTESTVFATAACDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGD 385

Query: 122 ELSGVDAEIHIYDIRNFD-------KPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGY 174
           +    +    ++D+R F        +PV    D H   +T I F+P D +++  GS D  
Sbjct: 386 D----NGTWGVWDLRQFTPSNADTVQPVAQY-DFHKGAITSIAFNPLDESIVAVGSEDNT 440

Query: 175 TNVYDLTQVEEEDALHQ 191
             ++DL+   +++ + Q
Sbjct: 441 VTLWDLSVEADDEEIKQ 457

>SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar to
           uniprot|P38123 Saccharomyces cerevisiae YBR175W SWD3
           Subunit of the COMPASS complex which methylates histone
           H3 on lysine 4 and is required in transcriptional
           silencing near telomeres
          Length = 314

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 6/77 (7%)

Query: 106 PFLSLD-SRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPN 164
           P LSL  +  G L C   +   D  I I+D+      +   + +H + V  I     DP+
Sbjct: 99  PVLSLVYTSKGNLLCSASM---DESIKIWDV--LTGTLLKTISAHSEPVVSIDMPVCDPS 153

Query: 165 VLLSGSTDGYTNVYDLT 181
           +L SGS DG   ++D T
Sbjct: 154 ILSSGSYDGLIRIFDTT 170

>KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 61/138 (44%), Gaps = 15/138 (10%)

Query: 45  TGNCIRTVKAGNTSINRMRVL-DSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEK 103
           TG C RT++  ++ +NR+ +  D  Y      + A +  V++ D+R    + V+     K
Sbjct: 21  TGVCSRTIQHADSQVNRLEITSDKKY-----LAAAGHLHVRLYDIRSNNPNPVSSFEGHK 75

Query: 104 -KTPFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSD 162
                ++    +  +   +E    D  I ++D+R+   P       H+  V ++  HP+ 
Sbjct: 76  GNVTSIAFQQENRWMVSSSE----DGTIKVWDVRS---PSVQRNYKHNAPVNEVAIHPNQ 128

Query: 163 PNVLLSGSTDGYTNVYDL 180
              L+S   DG   ++DL
Sbjct: 129 GE-LISCDQDGNIRIWDL 145

>KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {ON}
           similar to uniprot|Q06440 Saccharomyces cerevisiae
           YLR429W CRN1 Coronin cortical actin cytoskeletal
           component that associates with the Arp2p/Arp3p complex
           to regulate its activity
          Length = 707

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 140 KPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVE 184
           KPVRML   H   V  + FHP   N+L S S D    ++D++Q E
Sbjct: 143 KPVRML-SGHSRKVGHLLFHPLAENILASSSLDYTVKIWDISQEE 186

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 46/94 (48%), Gaps = 6/94 (6%)

Query: 234 KPLDFGDIRGT---WDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPN 290
           K L + ++R T   WD + ++     YI+V  +    G   +IP   E+  I D + +  
Sbjct: 33  KELQYENLRITSNAWDSN-LIKCNGKYISVNWNSSGGGAFAVIPV-KEVGKIPDQVPLFR 90

Query: 291 AHGDEVVRDVFISPKSQNIMYSCGEDGSVKTWKI 324
            H  +V+ D   SP + +I+ S  +DG +  W+I
Sbjct: 91  GHTAQVL-DTDFSPFNDHIVASGSDDGKIGIWEI 123

>TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.399
           YNL006W
          Length = 304

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 31/149 (20%), Positives = 68/149 (45%), Gaps = 16/149 (10%)

Query: 45  TGNCIRTVKAGNTSINRMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEK- 103
           TG C RT++  ++ +N++ +     ++  + + A ++ +K+ D+    ++ +A  +  K 
Sbjct: 21  TGVCSRTIQHPDSQVNKLEIT----NDKKLLAAAGSNNIKLYDVNTSNSNPIASFDGHKN 76

Query: 104 KTPFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDP 163
               ++    +  +   +E    D  I ++DIR+   P       H+  V ++  HP+  
Sbjct: 77  NVTSINFQVENKWMVTSSE----DNTIKLWDIRSPSSPRTY---KHNCPVNEVIIHPNQG 129

Query: 164 NVLLSGSTDGYTNVYDLTQVEEEDALHQV 192
             L+S   DG   ++DL    E    HQ+
Sbjct: 130 E-LISCDKDGNIRIWDLG---ENQCTHQL 154

>Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON}
           similar to Ashbya gossypii AGR067W
          Length = 1132

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 20/32 (62%)

Query: 149 HHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           H   +TDI FHPS P +L + S D Y + +D+
Sbjct: 113 HFRAITDINFHPSHPELLATCSIDTYVHAWDM 144

>ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} similar
           to uniprot|Q12523 Saccharomyces cerevisiae YPL247C
           Hypothetical ORF
          Length = 506

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 129 EIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
            + I D+RN   PV ++++ H   V  +++HPS  NVLLS + D     +DL
Sbjct: 378 RVLILDMRNPGSPV-LVLEGHSAAVNQMRWHPSKRNVLLSCADDCQVLYWDL 428

>KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON}
           similar to uniprot|P20053 Saccharomyces cerevisiae
           YPR178W PRP4 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 471

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 52/114 (45%), Gaps = 7/114 (6%)

Query: 65  LDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTELS 124
           LD   D   + S  ++   ++ D+R  G S++    + K    +S       +A G+   
Sbjct: 316 LDFQCDGSLLCSAGLDSIGRIWDMR-SGQSLMILEGHAKPIYGVSWSPNGHHVATGS--- 371

Query: 125 GVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVY 178
             D  + ++DIR    P  +L  +H++ V+D+KF       L+S S D   +V+
Sbjct: 372 -ADGTVKVWDIRKVGNPFSIL--AHNNIVSDVKFDKVSGRTLVSSSYDKTVSVF 422

>TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.429
           YDR364C
          Length = 452

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 150 HDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEEDALHQVINY 195
           H    D+KFHPS+PN  + G ++   N YD+ +V+ +  L QV ++
Sbjct: 244 HSTPNDLKFHPSEPNSFIVGLSNSKINHYDV-RVQAKQGLVQVYDH 288

>Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W
           (REAL)
          Length = 391

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 93/224 (41%), Gaps = 22/224 (9%)

Query: 127 DAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEE 186
           D  I +YD  N  K   + +  H   V  +K+  S   +L+SGS D    V+D   +++ 
Sbjct: 46  DKMIRVYDAIN--KKFLLQLSGHDGGVWALKY--SHDGILVSGSADSTVRVWD---IKKG 98

Query: 187 DALHQVINYESVHSC----GWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGDIR 242
              H    ++S   C     + +   I T S   T  + +L  KS         D+  + 
Sbjct: 99  YCTHVFEGHKSTVRCLDIVEYENTNYIVTGSRDNTLHVWKLPKKSSATDYENEHDYPLLF 158

Query: 243 GTWDCD-YVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNIND-----SISIPNAHGDEV 296
            T + + Y V V  G+ A+ ++   +GN+ +   ++  L + D      + I + H D V
Sbjct: 159 HTPEENPYFVGVLRGHTALVRAVSGHGNIVVSGSYDNTLIVWDVAQMKCLCILSGHTDRV 218

Query: 297 VRDVFISPKSQNIMYSCGEDGSVKTWKIENNSLQVPPGFWDYST 340
              ++   + + I  S   D ++K W + N       G W Y+T
Sbjct: 219 YSALYDHERKRCI--SASMDTTIKIWDLNN---IWNNGEWSYAT 257

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 86/197 (43%), Gaps = 22/197 (11%)

Query: 8   HSNSLGRTDWCLELQPLYRHG-LLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLD 66
           H N  G   + L+  PL + G LL+   +G +     +T   I T K   T  N   + D
Sbjct: 271 HGNVEG---YALDWSPLTKTGALLTGDCSGQIYFTQRHTSKWI-TDKQPFTVANNQSIED 326

Query: 67  SDYDN--GSVFSVAMNDA-VKVLDLRVQGN--SIVAELNNEKKTPFLSLDSRHGMLACGT 121
             +     +VF+ A  D  +++ D R + +  +I  + +N      +S   + G L    
Sbjct: 327 IQWSRTESTVFASAGCDGYIRIWDTRSKKHKPAISVKASN-TDVNVISWSEKLGYLLASG 385

Query: 122 ELSGVDAEIHIYDIRNFD-------KPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGY 174
           + +G      ++D+R F        +PV    D H   +T I F+P D +++  GS D  
Sbjct: 386 DDNGT---WGVWDLRQFSPENAGSVQPVAQY-DFHKGAITSISFNPLDESIIAVGSEDNT 441

Query: 175 TNVYDLTQVEEEDALHQ 191
             ++DL+   +++ + Q
Sbjct: 442 VTLWDLSVEADDEEIKQ 458

>Kwal_47.17310 s47 (345235..346896) [1662 bp, 553 aa] {ON} YER124C
           (DSE1) - Daughter Specific Expression 1 [contig 210]
           FULL
          Length = 553

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 48/101 (47%), Gaps = 13/101 (12%)

Query: 126 VDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEE 185
           +D ++ ++DIR+     +  V+ H   +  +K+H +D   L S   +GYT  +DL  ++ 
Sbjct: 316 IDNQVKVWDIRS--TGAKCTVNGHKGSIKGLKYH-NDTRRLYSSDDEGYTIAWDLQGIDN 372

Query: 186 EDALHQVINYES--------VHSCG--WLSPKRIYTLSHME 216
               H    + S        +  CG   ++PK + T+S ++
Sbjct: 373 VSECHLATGFLSITEEKISEIKQCGNVVVAPKNLRTVSSIK 413

>Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {ON}
           YMR093W (UTP15) - Protein required for cell viability
           [contig 55] FULL
          Length = 507

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 129 EIHIYDIRN-FDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEE 185
            + +YD  N   + V +   SH   V   KFHP+D   L++ S D    V+D+TQ +E
Sbjct: 104 RVSVYDSYNPRAQLVSIAASSHPTHVA--KFHPADSRTLVTASDDRVVRVWDITQAQE 159

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 54/128 (42%), Gaps = 13/128 (10%)

Query: 77  VAMNDA---VKVLDL---RVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTELSGVDAEI 130
           +AM DA   V V D    R Q  SI A  +      F   DSR  + A        D  +
Sbjct: 96  LAMGDATGRVSVYDSYNPRAQLVSIAASSHPTHVAKFHPADSRTLVTASD------DRVV 149

Query: 131 HIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEEDALH 190
            ++DI    +P ++ +    D V  +   P  P+++++GS DG   ++D    E    L 
Sbjct: 150 RVWDITQAQEP-QVELTGASDYVRSVCMVPQAPHLVVTGSYDGQVRLFDTRTNERATTLA 208

Query: 191 QVINYESV 198
           Q +  E V
Sbjct: 209 QGMPVEDV 216

>Suva_10.302 Chr10 (532343..533236) [894 bp, 297 aa] {ON} YLR208W
           (REAL)
          Length = 297

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 36/80 (45%), Gaps = 6/80 (7%)

Query: 248 DYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFISPKSQ 307
           D V+D Y   +A   S++    +KI     E   + D+++    H   V R  +  PK  
Sbjct: 14  DAVLDYYGKRLATCSSDKT---IKIFEVEGETHKLVDTLT---GHEGPVWRVDWAHPKFG 67

Query: 308 NIMYSCGEDGSVKTWKIENN 327
            I+ SC  DG V  WK EN 
Sbjct: 68  TILASCSYDGKVLIWKEENG 87

>Skud_12.272 Chr12 (506157..507050) [894 bp, 297 aa] {ON} YLR208W
           (REAL)
          Length = 297

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 36/80 (45%), Gaps = 6/80 (7%)

Query: 248 DYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFISPKSQ 307
           D V+D Y   +A   S++    +KI     E   + D+++    H   V R  +  PK  
Sbjct: 14  DAVLDYYGKRLATCSSDKT---IKIFEVEGETHKLIDTLT---GHEGPVWRVDWAHPKFG 67

Query: 308 NIMYSCGEDGSVKTWKIENN 327
            I+ SC  DG V  WK EN 
Sbjct: 68  TILASCSYDGKVLIWKEENG 87

>TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.276
           YPL247C
          Length = 531

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query: 125 GVDA-EIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTD 172
           G D+  + I D+RN   PV + +D H   +  IK+HP+  N +LS S D
Sbjct: 385 GADSNSVLILDMRNPGTPV-LTLDGHSAPINQIKWHPTKKNTILSSSDD 432

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 85/195 (43%), Gaps = 19/195 (9%)

Query: 8   HSNSLGRTDWCLELQPLYRHG-LLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLD 66
           H N  G   + L+  PL + G LL+   +G V L   +T   + T K   T  N   + D
Sbjct: 277 HGNVEG---YGLDWSPLIKTGALLTGDCSGMVYLTQRHTSKWV-TDKTPFTVGNNKSIED 332

Query: 67  SDYDN--GSVFSVAMNDA-VKVLDLRVQGNS-IVAELNNEKKTPFLSLDSRHGMLACGTE 122
             +     +VF+ A  D  +++ D R + +  +++ + +      +S + + G L    +
Sbjct: 333 IQWSRTESTVFATAGCDGYIRIWDTRSKKHKPVISTVVSNTDVNVISWNEKMGYLLASGD 392

Query: 123 LSGVDAEIHIYDIRNFDK------PVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTN 176
             G      I+D+R F        PV    D H   +T I F+P D +++   S D    
Sbjct: 393 DKGT---WGIWDLRQFSPNSEKALPVAQY-DFHKGAITSISFNPLDESIVAVASEDNTVT 448

Query: 177 VYDLTQVEEEDALHQ 191
           ++DL+   +++ + Q
Sbjct: 449 LWDLSVEADDEEIKQ 463

>YLR208W Chr12 (559551..560444) [894 bp, 297 aa] {ON}
           SEC13Structural component of three distinct complexes;
           subunit of the Nup84 nuclear pore sub-complex (NPC), the
           COPII vesicle coat, and the Seh1-associated (SEA)
           complex; the COPII vesicle coat is required for vesicle
           formation in ER to Golgi transport; the Nup84 subcomplex
           contributes to nucleocytoplasmic transport, NPC
           biogenesis and processes that may require localization
           of genes or chromosomes at the nuclear periphery
           including transcription; homologous to human SEC13
          Length = 297

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 36/80 (45%), Gaps = 6/80 (7%)

Query: 248 DYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFISPKSQ 307
           D V+D Y   +A   S++    +KI     E   + D+++    H   V R  +  PK  
Sbjct: 14  DAVLDYYGKRLATCSSDKT---IKIFEVEGETHKLIDTLT---GHEGPVWRVDWAHPKFG 67

Query: 308 NIMYSCGEDGSVKTWKIENN 327
            I+ SC  DG V  WK EN 
Sbjct: 68  TILASCSYDGKVLIWKEENG 87

>NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {ON}
           Anc_2.469 YMR093W
          Length = 514

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 40/83 (48%), Gaps = 1/83 (1%)

Query: 127 DAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEE 186
           D  I ++DI N  +P   L  +  D V  +   PS P++++SGS DG   +YD       
Sbjct: 146 DRVIRLWDISNAYQPTLELT-AATDYVRSVTCVPSAPHMIVSGSYDGVVRLYDTRTSSAS 204

Query: 187 DALHQVINYESVHSCGWLSPKRI 209
             ++ + + + V     +SP +I
Sbjct: 205 TPIYSLNHEQPVEDIISISPTQI 227

>Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON}
           YEL056W (HAT2) - subunit of a cytoplasmic histone
           acetyltransferase [contig 186] FULL
          Length = 396

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 127 DAEIHIYDIRNFDKPVRMLVDSHHDD-VTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEE 185
           D  I I+DI++  K V   V+S H D V + K+H SDPN+  S S D +  ++D      
Sbjct: 181 DGSIAIWDIKS-GKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD---KRS 236

Query: 186 EDALHQVINYESVHSCGW 203
           E  L +++  E  ++  +
Sbjct: 237 EKPLQKLLQKEPFNTIAF 254

>CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178w PRP4
           U4/U6 snRNP
          Length = 500

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 52/112 (46%), Gaps = 14/112 (12%)

Query: 71  NGSVFSVAMNDAVKVL-DLRVQGNSIVAELNNEKKTPFL---SLDSRHGMLACGTELSGV 126
           +G++ S A  D   ++ DLR      V++L    KT +    S+D     LA G    G 
Sbjct: 351 DGALVSTAGTDKTAIIWDLR--SGKAVSQLQGHAKTIYCMDWSIDGH--TLATG----GG 402

Query: 127 DAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVY 178
           D  I I+D+R  DK  +  +  H   VT +KF  ++ + L+S   D    VY
Sbjct: 403 DGVITIWDLRKSDKLTK--ITEHKSIVTSLKFDKANDHNLISSGYDRSIFVY 452

>Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W
           (REAL)
          Length = 781

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 47/210 (22%), Positives = 91/210 (43%), Gaps = 19/210 (9%)

Query: 127 DAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEE 186
           D  I +YD  + +K   + +  H   V  +K+  +   +L+SGSTD    V+D   +++ 
Sbjct: 402 DKMIRVYD--SVNKKFLLQLSGHDGGVWALKY--AHGGILVSGSTDRTVRVWD---IKKG 454

Query: 187 DALHQVINYESVHSC----GWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGDIR 242
              H    + S   C     + + K I T S   T  I +L  +S         D+  + 
Sbjct: 455 CCTHVFKGHNSTVRCLDIVEYKNTKYIVTGSRDNTLHIWKLPKESSTAGHEPEHDYPLVF 514

Query: 243 GTWDCD-YVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNIND-----SISIPNAHGDEV 296
            T + + Y V V  G++A  ++   +GN+ +   ++  L + D      + I + H D +
Sbjct: 515 HTPEENPYFVGVLRGHMASVRTVSGHGNIVVSGSYDNTLIVWDVAQMKCLYILSGHTDRI 574

Query: 297 VRDVFISPKSQNIMYSCGEDGSVKTWKIEN 326
              ++   + + I  S   D +++ W +EN
Sbjct: 575 YSTIYDHERKRCI--SASMDCTIRIWDLEN 602

>Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W
           (REAL)
          Length = 783

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 91/210 (43%), Gaps = 19/210 (9%)

Query: 127 DAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEE 186
           D  I +YD  N  K   + +  H   V  +K+  S   +L+SGSTD    V+D   +++ 
Sbjct: 405 DKMIRVYDAIN--KKFLLQLSGHDGGVWALKY--SHDGILVSGSTDRTVRVWD---IKKG 457

Query: 187 DALHQVINYESVHSC----GWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGDIR 242
              H    + S   C     + + + I T S   T  + +L  ++  +      D+  + 
Sbjct: 458 CCTHVFKGHNSTVRCLDIVEYKNNRYIVTGSRDNTLHVWKLPKEASAIEHGDEHDYPLVY 517

Query: 243 GTWDCD-YVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNIND-----SISIPNAHGDEV 296
            T + + Y + V  G++A  ++   +GN+ +   ++  L + D      + I + H D +
Sbjct: 518 HTPEENPYFIGVLRGHMASVRTVSGHGNIVVSGSYDNTLIVWDVAQMKCLYILSGHTDRI 577

Query: 297 VRDVFISPKSQNIMYSCGEDGSVKTWKIEN 326
              ++   + + I  S   D ++K W +EN
Sbjct: 578 YSTIYDHERKRCI--SASMDTTIKIWDLEN 605

>CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 aa]
           {ON} highly similar to uniprot|P41811 Saccharomyces
           cerevisiae YGL137w SEC27
          Length = 902

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 37/170 (21%), Positives = 70/170 (41%), Gaps = 25/170 (14%)

Query: 29  LLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMR--------VLDSDYDNGSVFSVAMN 80
           +L++L +G V + ++ T   +R+++  +T +   +        V+ SD +   VF+   N
Sbjct: 28  VLTTLYSGRVEIWNYETQQEVRSIQVTDTPVRAGKFITRKNWIVVGSDDNKVRVFN--YN 85

Query: 81  DAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDK 140
              KV D     + I +          +++      +  G++    D  + +++  N D 
Sbjct: 86  TGEKVADFVAHPDYIRS----------IAVHPSKPYILTGSD----DLTVKLWNWEN-DW 130

Query: 141 PVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEEDALH 190
            +      H   V  + F+P DPNV  SG  D    V+ L Q      LH
Sbjct: 131 SLEQTFKGHEHFVMCVAFNPKDPNVFASGCLDHKVKVWSLGQSTPNFTLH 180

>NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {ON}
           Anc_8.631
          Length = 428

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 125 GVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           G D   +I+D R+     +  V     DVT IKF   D N +++GS DG  N++DL
Sbjct: 251 GSDGYTYIWDTRSPSAVQKFFVSD--SDVTSIKFF-KDGNSIITGSDDGIINMFDL 303

>Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)
          Length = 763

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 47/210 (22%), Positives = 90/210 (42%), Gaps = 19/210 (9%)

Query: 127 DAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEE 186
           D  I IYD  + +K   + +  H   V  +K+      +L+SGSTD    V+D   +++ 
Sbjct: 385 DKMIRIYD--SINKKFLLQLSGHDGGVWALKY--VHGGILVSGSTDRTVRVWD---IKKG 437

Query: 187 DALHQVINYESVHSC----GWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGDIR 242
              H    + S   C     + + K I T S   T  I +L  ++         D+  + 
Sbjct: 438 CCTHVFKGHNSTVRCLDIVEYKNTKYIVTGSRDNTLHIWKLPEETSTTEHQAEHDYPLVF 497

Query: 243 GTWDCD-YVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNIND-----SISIPNAHGDEV 296
            T + + Y V V  G++A  ++   +GN+ +   ++  L + D      + I + H D +
Sbjct: 498 HTPEENPYFVGVLRGHMASVRTVSGHGNIVVSGSYDNTLIVWDVAQMKCLYILSGHTDRI 557

Query: 297 VRDVFISPKSQNIMYSCGEDGSVKTWKIEN 326
              ++   + + I  S   D +++ W +EN
Sbjct: 558 YSTIYDHKRKRCI--SASMDSTIRIWDLEN 585

>KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011W
          Length = 478

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 18/24 (75%)

Query: 301 FISPKSQNIMYSCGEDGSVKTWKI 324
           ++SP+ +N M SCG+D +VK W +
Sbjct: 122 YLSPQRENFMLSCGDDKTVKLWSV 145

>Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LST8)
           - Protein required for transport of permeases from the
           Golgi to the plasma membrane [contig 82] FULL
          Length = 303

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 31/149 (20%), Positives = 63/149 (42%), Gaps = 16/149 (10%)

Query: 45  TGNCIRTVKAGNTSINRMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQG-NSIVAELNNEK 103
           TG C RT++  ++ +NR+ +      +    + A +  V++ D+R    N + +   +  
Sbjct: 21  TGVCSRTIQHSDSQVNRLEI----SSDKRFLAAAGHLNVRLYDIRTTNPNPVTSFEGHRG 76

Query: 104 KTPFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDP 163
               ++    +  +   +E    D  I ++D+R    P       H   V ++  HP+  
Sbjct: 77  NVTSIAFQQENKWMVSSSE----DGTIKVWDVR---APSVQRNYKHQAAVNEVVIHPNQG 129

Query: 164 NVLLSGSTDGYTNVYDLTQVEEEDALHQV 192
             L+S   DG   ++DL    E   +HQ+
Sbjct: 130 E-LISCDQDGNVRIWDLG---ENQCVHQL 154

>Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 63/150 (42%), Gaps = 13/150 (8%)

Query: 37  DVNLLDWNTGNCIRTV-KAGNTSINRMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSI 95
           ++N++D   G C + + K  N     +  L    D   +  V+    +K+  L+     I
Sbjct: 39  EINIIDLTLG-CRKILHKISNEDEQEITALRLTPDGQYLAYVSQAQLLKIFQLKT--GRI 95

Query: 96  VAELNNEKKTPFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTD 155
           V  L     +  L  D    +LA G    G D  I I DI N    +   +  H   ++ 
Sbjct: 96  VRSLKISSPSYILDTDPTSTLLAVG----GTDGSIVIVDIEN--GYITHSLKGHGGTISS 149

Query: 156 IKFHP---SDPNVLLSGSTDGYTNVYDLTQ 182
           +KF+    S+  +L SG T+G   V+DL +
Sbjct: 150 LKFYGQLDSETWLLASGDTNGMVKVWDLVK 179

>KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON}
           uniprot|P56094 Kluyveromyces lactis KLLA0F10263g TUP1
           Transcriptional repressor TUP1
          Length = 682

 Score = 34.7 bits (78), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 7/66 (10%)

Query: 116 MLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYT 175
            LA G E    D  I I+D+    K + M +  H  D+  + + PS  N L+SGS D   
Sbjct: 420 FLATGAE----DKLIRIWDLET--KKIVMTLKGHEQDIYSLDYFPSG-NKLVSGSGDRTV 472

Query: 176 NVYDLT 181
            ++DLT
Sbjct: 473 RIWDLT 478

>Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178W
           (REAL)
          Length = 470

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 43/84 (51%), Gaps = 7/84 (8%)

Query: 115 GMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGY 174
           G L C     G+D+   ++DIR+  K   M +  H   V  + + P+   V  +G  DG 
Sbjct: 324 GSLVCS---GGMDSLTMLWDIRSGSKV--MTLAGHSKPVYTVAWSPNGYQVA-TGGGDGL 377

Query: 175 TNVYDLTQVEEEDALHQVINYESV 198
            NV+D+ Q  +E  L+Q++ + ++
Sbjct: 378 INVWDIRQ-RDEGQLNQILAHRNI 400

>TPHA0D01130 Chr4 (236199..237554) [1356 bp, 451 aa] {ON} Anc_8.651
           YPL139C
          Length = 451

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 67/151 (44%), Gaps = 24/151 (15%)

Query: 47  NCIRTVKAGNTSINRMRV-LDSDY--------DNGSVFSVAMNDAVKVLDLRVQGNSIVA 97
           + I + K G + IN   + LD +         DNGS+        +K++D   +  +++ 
Sbjct: 174 SSIHSAKGGPSDINDFSISLDDETIIKTQSLSDNGSI--------IKLIDNAAKPGTVLR 225

Query: 98  ELNNEKK--TPFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTD 155
            +N  K+  T  +     +  + C +     D  I  +D R  DKP+ +L DS    +T 
Sbjct: 226 SINVSKECITHTIKYIDNNMFVTCSS-----DNIIRFWDTRGDDKPMFVLQDSKDGLLTS 280

Query: 156 IKFHPSDPNVLLSGSTDGYTNVYDLTQVEEE 186
           +   P   ++ ++GS  G   ++D+ QV  E
Sbjct: 281 LDTTPLIDSLFITGSDTGVIKLWDVRQVLAE 311

>CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON}
           similar to uniprot|P53196 Saccharomyces cerevisiae
           YGL004c
          Length = 412

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 30/53 (56%), Gaps = 3/53 (5%)

Query: 128 AEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
            +I++YD     K    LV +H  DVT +K  PS+  VLLSGSTD    V+ L
Sbjct: 121 GDINVYDHEWMSK--LSLVGAHVSDVTTVKIFPSNA-VLLSGSTDMQLKVWSL 170

>Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON}
           similar to Ashbya gossypii ADL186C
          Length = 1317

 Score = 34.7 bits (78), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 8/65 (12%)

Query: 119 CGTELSGVDAEIHIYDI---RNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYT 175
           CGT  S     + IYDI    +   P+      H   +  + F+    N+++SG  DGY 
Sbjct: 212 CGTSTS-----LSIYDINRTSDIGSPLVATYSEHSRSINSVDFNMGQTNLIISGGQDGYI 266

Query: 176 NVYDL 180
            V+DL
Sbjct: 267 KVWDL 271

>KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.469
           YMR093W
          Length = 509

 Score = 34.3 bits (77), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 52/122 (42%), Gaps = 4/122 (3%)

Query: 64  VLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTEL 123
           V +  ++  S F  A+  + +V     +   +V   +  K   + +     G L    + 
Sbjct: 42  VTEIAFNPKSPFDFAVTSSTRVQIFSSRTRQVVKTFSRFKDVVYCANFRADGKLLVAGDA 101

Query: 124 SGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQV 183
           +G+ +    Y+ RN    V +   +H   VT  KFHP D   L++ S D  T ++D++  
Sbjct: 102 TGLVSVYDSYNPRNV--LVSIQASTHPTHVT--KFHPMDSKTLITSSDDRVTRLWDISHA 157

Query: 184 EE 185
            E
Sbjct: 158 YE 159

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 48/100 (48%), Gaps = 10/100 (10%)

Query: 83  VKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGT---ELSGVDAEIHIYDIRNFD 139
           V++ D R Q +  +  LN+++    +   S   +++CG    ++  +     +Y+  NF+
Sbjct: 193 VRMYDTRTQSSDPIYSLNHDQPVENVIAISPTQLVSCGGPNFKVWDLTNNKQLYERGNFN 252

Query: 140 KPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYD 179
           K V  L     D V +  F    P  L++GS DG+  V+D
Sbjct: 253 KTVTCL-----DHVEN--FSSPMPQALIAGSLDGHVKVFD 285

>Smik_12.266 Chr12 (506562..507455) [894 bp, 297 aa] {ON} YLR208W
           (REAL)
          Length = 297

 Score = 33.9 bits (76), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 6/80 (7%)

Query: 248 DYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFISPKSQ 307
           D V+D Y   +A   S++    +K+     E   + D+++    H   V R  +  PK  
Sbjct: 14  DAVLDYYGKRLATCSSDKT---IKVFEVEGETHKLIDTLT---GHEGPVWRVDWAHPKFG 67

Query: 308 NIMYSCGEDGSVKTWKIENN 327
            I+ SC  DG V  WK EN 
Sbjct: 68  TILASCSYDGKVLIWKEENG 87

>Suva_11.7 Chr11 complement(15456..17615) [2160 bp, 719 aa] {ON}
           YKL213C (REAL)
          Length = 719

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 78/200 (39%), Gaps = 37/200 (18%)

Query: 159 HPSDPNVLLSGSTDGYTNVYDLTQVEEEDALHQVINYES-----------VHSCGWLSPK 207
           + S+  VLL G  D   N   L     ED L+ +I +E            V S  W    
Sbjct: 62  YDSEKQVLLFGGKDTMINGVPLFATLGEDPLYTLIGHEGNVCSLECQDGVVVSGSWDKTA 121

Query: 208 RIYT----LSHMETFAIHELNNKSDELTEPKPLDFGDIRGT--WDCDYVVDVYPG----- 256
           +++     + +++  +    + K   LTE K L     +    W    V+  + G     
Sbjct: 122 KVWKDGSLVYNLQAHSASVWDAKVVSLTENKYLTASADKTIKLWQNGEVIKTFSGIHNDV 181

Query: 257 --YIAVGKSE-----ENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFISPKSQNI 309
             ++A+  S       N+G +K++  H         + I   HG   V  V + P     
Sbjct: 182 VRHLALVDSGHFISCSNDGLIKLVDIHT-----GKVLKIFEGHG-SFVYCVKLLPNGD-- 233

Query: 310 MYSCGEDGSVKTWKIENNSL 329
           + SCGED SV+ W +EN SL
Sbjct: 234 IVSCGEDRSVRIWSMENTSL 253

>ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1147

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 4/50 (8%)

Query: 135 IRNFDKP----VRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           I N  KP    +  ++  H   +TDI F P  P++L + S D Y + +DL
Sbjct: 95  IWNLAKPSSNAIEHVLHKHFRAITDINFSPQHPDILATCSIDTYVHAWDL 144

>TPHA0D01390 Chr4 (289408..291129) [1722 bp, 573 aa] {ON} Anc_8.699
           YPL169C
          Length = 573

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 54/110 (49%), Gaps = 18/110 (16%)

Query: 60  NRMRVLDSDYDNGSV----FSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHG 115
           NR+ V+ ++++NGS+      ++    + V D+RV+GN+ +  + N+K+    +L+  +G
Sbjct: 21  NRVEVVITNWENGSINDLTSFLSRQSRIAVRDVRVEGNAAIGYVANKKEAE--ALNKFNG 78

Query: 116 MLACGTELS-----GVDAE------IHIYDIRNFDKPVRML-VDSHHDDV 153
           +   G  L      GVD        +  +  R +D   +ML + S H D 
Sbjct: 79  IRFAGKSLKIQVTGGVDNSSPTVKLLKAFLFRRYDPQTKMLNLGSIHTDA 128

>YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subunit
           of the SEA (Seh1-associated) complex, a coatomer-related
           complex that associates dynamically with the vacuole;
           has N-terminal WD-40 repeats and a C-terminal RING
           motif; mtc5 is synthetically sick with cdc13-1
          Length = 1148

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 23/39 (58%)

Query: 142 VRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           +  ++  H   +TDI F+P  P+VL + S D Y + +D+
Sbjct: 106 IEFVLHGHSRAITDINFNPQHPDVLATCSVDTYVHAWDM 144

>Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W
           (REAL)
          Length = 1152

 Score = 34.3 bits (77), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 23/39 (58%)

Query: 142 VRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           +  ++  H   +TDI F+P  P+VL + S D Y + +D+
Sbjct: 106 IEFVLHGHSRAITDINFNPQHPDVLATCSVDTYVHAWDM 144

>Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 33.9 bits (76), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 85/197 (43%), Gaps = 22/197 (11%)

Query: 8   HSNSLGRTDWCLELQPLYRHG-LLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLD 66
           H N  G   + L+  PL + G LLS   +G V     +T   + T K   T  N   + D
Sbjct: 269 HGNVEG---YGLDWSPLIKTGSLLSGDCSGQVYFTQRHTSRWV-TDKQPFTVSNNKSIED 324

Query: 67  SDYDNG--SVFSVAMNDA-VKVLDLRVQGN--SIVAELNNEKKTPFLSLDSRHGMLACGT 121
             +     +VF+ A  D  +++ D R + +  +I  + +N         D    +LA G 
Sbjct: 325 IQWSRSESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGD 384

Query: 122 ELSGVDAEIHIYDIRNFD-------KPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGY 174
           +    +    ++D+R F        +PV    D H   +T I F+P D +++  GS D  
Sbjct: 385 D----NGTWGVWDLRQFTPSNADSVQPVAQY-DFHKGAITSIAFNPLDESIVAVGSEDNT 439

Query: 175 TNVYDLTQVEEEDALHQ 191
             ++DL+   +++ + Q
Sbjct: 440 VTLWDLSVEADDEEIKQ 456

>Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W
           (REAL)
          Length = 1151

 Score = 34.3 bits (77), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 23/39 (58%)

Query: 142 VRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           +  ++  H   +TDI F+P  P+VL + S D Y + +D+
Sbjct: 105 IEFVLHGHSRAITDINFNPQHPDVLATCSVDTYVHAWDM 143

>KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {ON}
           Anc_2.469 YMR093W
          Length = 508

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 55/131 (41%), Gaps = 12/131 (9%)

Query: 69  YDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTELSGVDA 128
           ++  S F  A+  + +V     +   +V   +  K   + +     G L    + +G+  
Sbjct: 47  FNPKSPFDFAVTSSTRVQIFSSKTRQVVKTFSRFKDVVYSASFRNDGKLLVAGDATGL-- 104

Query: 129 EIHIYDIRNFDKPVRMLVD----SHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVE 184
            + +YD  N   P  +L+     +H   VT  KFHP D   L++ S D  T ++D++   
Sbjct: 105 -VSVYDAYN---PRSILLSINASTHPTHVT--KFHPQDNKTLVTTSDDRVTRIWDISHAY 158

Query: 185 EEDALHQVINY 195
           E   L    +Y
Sbjct: 159 EAQELTGASDY 169

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 151 DDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEEDALHQVINYESVHSCGWLSPKRI 209
           D V  + F PS P+++ +GS DG   +YD T+ E    ++ + + + V S   +SP ++
Sbjct: 168 DYVRSVTFIPSAPHLIATGSYDGLVRLYD-TRAEGSSPIYSLNHDQPVESIIAISPTQL 225

>Kpol_530.39 s530 (90456..91340) [885 bp, 294 aa] {ON}
           (90456..91340) [885 nt, 295 aa]
          Length = 294

 Score = 33.9 bits (76), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 36/83 (43%), Gaps = 6/83 (7%)

Query: 248 DYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFISPKSQ 307
           D V+D Y   +A   S++    +KI     E   + +++     H   V R  +  PK  
Sbjct: 14  DTVLDYYGKRLATCSSDKT---IKIFEIEGESHKLVETLV---GHEGPVWRVDWAHPKFG 67

Query: 308 NIMYSCGEDGSVKTWKIENNSLQ 330
            I+ SC  DG V  WK EN   Q
Sbjct: 68  TILASCSYDGKVLIWKEENGKWQ 90

>ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|Q12024 Saccharomyces cerevisiae
           YOR272W YTM1 microtubule-associated protein
          Length = 448

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 50/111 (45%), Gaps = 4/111 (3%)

Query: 70  DNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTELSGVDAE 129
           DN   +SV+ +  VK  DL V    +  +  +        L S H +LACG+  S     
Sbjct: 287 DNTVGYSVSQDHTVKTWDL-VTSRCVDTKTTSYSLLSLAQLPSLH-LLACGS--SARHIT 342

Query: 130 IHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           +H +   +  K  +  +  H + V  +   P +  +L+SGS DG   V+D+
Sbjct: 343 LHDFRANSSSKITQQQLLGHKNFVVSLDTCPENEYMLVSGSHDGTAKVWDI 393

>KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa]
           {ON} similar to uniprot|P38123 Saccharomyces cerevisiae
           YBR175W SWD3 Subunit of the COMPASS complex which
           methylates histone H3 on lysine 4 and is required in
           transcriptional silencing near telomeres
          Length = 316

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 126 VDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYD 179
           +D  I ++DI      +   + +H + V  I   P DP++L SGS DG   ++D
Sbjct: 119 MDESIKVWDI--LTGTLLRTLSAHSEPVVSIDIPPFDPSILSSGSYDGLIRIFD 170

>Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W
           (REAL)
          Length = 1151

 Score = 34.3 bits (77), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 23/39 (58%)

Query: 142 VRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           +  ++  H   +TDI F+P  P+VL + S D Y + +D+
Sbjct: 105 IEFVLHGHSRAITDINFNPQHPDVLATCSVDTYVHAWDM 143

>KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {ON}
           similar to uniprot|P07834 Saccharomyces cerevisiae
           YFL009W CDC4 F-box protein required for G1/S and G2/M
           transition associates with Skp1p and Cdc53p to form a
           complex SCFCdc4 which acts as ubiquitin-protein ligase
           directing ubiquitination of the phosphorylated CDK
           inhibitor Sic1p
          Length = 753

 Score = 33.9 bits (76), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 72/169 (42%), Gaps = 23/169 (13%)

Query: 27  HGLLSSLSNGDVNLLDWNTGN--CIRTVKAGNTSINRMRVLDSDYDNGSVFSVAMNDAVK 84
           HG +    + D NL+ W+     C+  V  G+T  +R+     DY      S  M+  +K
Sbjct: 512 HGNIVISGSYDFNLMVWDIAKMKCLY-VLTGHT--DRIYSTIYDYTRNRCISAGMDSTIK 568

Query: 85  VLDLR-VQGNSIVAELNNEKKT------PFLSLDSRH---GMLACGTEL---SGVDAEIH 131
           V DL+ +Q N     +N+            L+L       G+L    +    +  D  + 
Sbjct: 569 VWDLQNIQKNGHCTTINSTSNPCTKVTGSVLTLQGHTALVGLLGLSDKFLVSAAADGTLR 628

Query: 132 IYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
            +D  N+ +        HH D++ I     + N+L+SGS +G  NVY+L
Sbjct: 629 GWDSDNYSRQFAY----HHKDLSAITTFYVNDNILVSGS-EGQFNVYNL 672

>Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to
           Ashbya gossypii AAL009C
          Length = 303

 Score = 33.5 bits (75), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 89/229 (38%), Gaps = 36/229 (15%)

Query: 108 LSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLL 167
           L + S    LA G  L      + +YDIR  +       + H  +VT I F   D   ++
Sbjct: 38  LEITSDKRYLAAGGHL-----HVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQ-QDNKWMV 91

Query: 168 SGSTDGYTNVYDLT--QVEEEDALHQVINYESVH-------SCGWLSPKRIYTLSHMETF 218
           S S DG   V+D+    V+     +  +N   +H       SC      +I+ L   E  
Sbjct: 92  SSSEDGTIKVWDVRTPSVQRNYKHNAPVNEVVIHPNQGELISCDQDGNIKIWDLG--ENQ 149

Query: 219 AIHELNNKSDELTEPKPLDFGDIRGTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNE 278
             H+L      L +  PL    I              G + V  S + N  +  +P H +
Sbjct: 150 CTHQL-----ALEDDTPLQSLSIAS-----------DGSMLVAGSNKGNCYVWKMPNHTD 193

Query: 279 LLNINDSISIPNAHGDEVVRDVFISPKSQNIMYSCGEDGSVKTWKIENN 327
             N+   ++   +H   + R V +S   +++  +C  D + + W IE+N
Sbjct: 194 TANLK-PVTKFRSHTKYITR-VLLSVDVKHLA-TCSADHTARVWSIEDN 239

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 32/150 (21%), Positives = 63/150 (42%), Gaps = 18/150 (12%)

Query: 45  TGNCIRTVKAGNTSINRMRVL-DSDYDNGSVFSVAMNDAVKVLDLRVQG-NSIVAELNNE 102
           TG C RT++  ++ +NR+ +  D  Y      +   +  V++ D+R    N + +   + 
Sbjct: 21  TGVCSRTIQHADSQVNRLEITSDKRY-----LAAGGHLHVRLYDIRTTNPNPVTSFEGHR 75

Query: 103 KKTPFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSD 162
                ++    +  +   +E    D  I ++D+R    P       H+  V ++  HP+ 
Sbjct: 76  GNVTSIAFQQDNKWMVSSSE----DGTIKVWDVRT---PSVQRNYKHNAPVNEVVIHPNQ 128

Query: 163 PNVLLSGSTDGYTNVYDLTQVEEEDALHQV 192
              L+S   DG   ++DL    E    HQ+
Sbjct: 129 GE-LISCDQDGNIKIWDL---GENQCTHQL 154

>KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.119
           YGL004C
          Length = 409

 Score = 33.9 bits (76), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 28/46 (60%), Gaps = 3/46 (6%)

Query: 127 DAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTD 172
           +  I +Y+ +   + VR + D+H  D+T +KF PS   VLLS STD
Sbjct: 120 NGNIAVYNAKY--ETVREIEDAHASDITSLKFFPSGE-VLLSASTD 162

>ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [2694
           bp, 897 aa] {ON} highly similar to uniprot|P41811
           Saccharomyces cerevisiae YGL137W SEC27 Involved in
           beta'-subunit of yeast coatomer
          Length = 897

 Score = 33.9 bits (76), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 36/87 (41%), Gaps = 23/87 (26%)

Query: 15  TDWCLELQ----PLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLDSD-- 68
           T W + LQ     L+  GLL + S+G +   DW  GN +R V      IN   V+ SD  
Sbjct: 426 TSWSIPLQYGVERLFGGGLLGAKSDGFIYFFDWENGNLVRRV-----DINARDVIWSDNG 480

Query: 69  ------------YDNGSVFSVAMNDAV 83
                        D  S +S+A N  V
Sbjct: 481 ELVMILNTEEGRGDEASAYSLAFNKDV 507

>Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W
           (REAL)
          Length = 322

 Score = 33.5 bits (75), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 46/208 (22%), Positives = 88/208 (42%), Gaps = 21/208 (10%)

Query: 130 IHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEEDAL 189
           I +YD  + +K   + +  H   V  +K+      +L+SGSTD    ++D+    +    
Sbjct: 2   IRVYD--SVNKKFLLQLSGHDGGVWALKY--VHDGILVSGSTDKTVRIWDI----KRGCC 53

Query: 190 HQVIN-YESVHSC----GWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGDI-RG 243
             V N ++S   C     + + K I + S   T  + +L   S         D+  + R 
Sbjct: 54  TYVFNGHDSTVRCLDVLKYNNTKYIVSGSRDNTLHVWKLPEGSSTADHQAEHDYPLVFRT 113

Query: 244 TWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNIND-----SISIPNAHGDEVVR 298
             +  Y V +  G+ A  ++   +GN+ I   ++  L + D      + I + H D V  
Sbjct: 114 PEENPYFVGILRGHTASIRTVSGHGNIVISASYDSTLIVWDIAQMKCLYILSGHTDRVYA 173

Query: 299 DVFISPKSQNIMYSCGEDGSVKTWKIEN 326
            ++   + + I  S G D +++ W +EN
Sbjct: 174 AIYDHERKRCI--SAGTDSTIRIWDLEN 199

>Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar to
           Ashbya gossypii ABL044C
          Length = 517

 Score = 33.9 bits (76), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 127 DAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYD 179
           D  + ++DI +  +P+  L  +  D V  I F P  P++++SGS DG   +YD
Sbjct: 146 DRVVRLWDISHAYQPILELTGAS-DYVRSICFLPGTPHMVVSGSYDGVIRLYD 197

>Suva_2.303 Chr2 complement(535706..536839) [1134 bp, 377 aa] {ON}
           YDR142C (REAL)
          Length = 377

 Score = 33.5 bits (75), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 67/179 (37%), Gaps = 37/179 (20%)

Query: 146 VDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEEDALHQVINYESVHSCGWLS 205
           +  + + V   +F P D N+++S S + Y +++D+                       L 
Sbjct: 171 ISQNKNCVYQAQFSPHDQNLVISCSGNSYASLFDIR----------------------LP 208

Query: 206 PKRIYTLSHMETFAIHE-LNNKSDELTEPKPLDFGDIRGTWDCDYVVDVYPGYIAVGKSE 264
           P R  T      F +H  L   + +  + +P     +  T   D  + ++   +      
Sbjct: 209 PSRSQT-----NFLVHSGLEALTCDFNKYRPY----VIATGGVDNAIRIWDIRMLKTSGS 259

Query: 265 ENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFISPKSQNIMYSCGEDGSVKTWK 323
              G       HN    IN+   IPNAHG   +R V  SP   NI+ S   D + + WK
Sbjct: 260 ATTGRPTHTSSHNSAC-INE---IPNAHG-LAIRKVTWSPHHSNILMSASYDMTCRVWK 313

>AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL137W
           (SEC27); 1-intron
          Length = 832

 Score = 33.9 bits (76), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 41/190 (21%), Positives = 72/190 (37%), Gaps = 43/190 (22%)

Query: 148 SHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEEDALHQVINYESVHSCGWLSPK 207
           S  D V  I FHPS+P VL++     Y+   ++   E +  +  +   E+    G   P+
Sbjct: 11  SRTDRVKGIDFHPSEPWVLIT----LYSGRAEIWNYETQTEVRSISVCEAPVRAGKFIPR 66

Query: 208 RIYTLSHMETFAIHELNNKSDELTEPKPLDFGDIRGTWDCDYVVDVYPGYIAVGKSEENN 267
           + + +   + F I   N  + E    K +DF             + +P YI         
Sbjct: 67  KSWIIVGSDDFKIRVFNYNTGE----KVVDF-------------EAHPDYIRA------- 102

Query: 268 GNLKIIPFHNELLNINDSISIP------------NAHGDE-VVRDVFISPKSQNIMYSCG 314
             L + P  + +L+ +D +++                G E  V  V  +PK  N   +  
Sbjct: 103 --LAVHPTRSYVLSASDDLTVKLWNWEKNWALEQTFEGHEHFVMSVTFNPKDPNTFATAC 160

Query: 315 EDGSVKTWKI 324
            D +VK W +
Sbjct: 161 LDHTVKIWSL 170

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 33.5 bits (75), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 86/198 (43%), Gaps = 20/198 (10%)

Query: 8   HSNSLGRTDWCLELQPLYRHG-LLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLD 66
           H N  G   + L+  P+ ++G LL+   +G +     +T   I T K   T+ N   V D
Sbjct: 277 HGNVEG---YALDWSPMIKNGALLTGDCSGQIYFTQRHTSKWI-TDKQPFTAENNKSVED 332

Query: 67  SDYDN--GSVFSVAMNDA-VKVLDLRVQGNSIVAELN-NEKKTPFLSLDSRHGMLACGTE 122
             +     +VF+ A  D  +++ D R + +     +  +      +S   + G L    +
Sbjct: 333 IQWSRTESTVFASAGCDGYIRIWDTRSKKHKPALSVKASNTDVNVISWSEKIGYLLASGD 392

Query: 123 LSGVDAEIHIYDIRNFD-------KPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYT 175
            +G+     ++D+R F        +PV    D H   +T I F+P D +++   S D   
Sbjct: 393 DNGL---WGVWDLRQFSPDNINDVQPVAQY-DFHKGAITSINFNPLDDSIIAVASEDNTV 448

Query: 176 NVYDLTQVEEEDALHQVI 193
            ++DL+   +++ + Q I
Sbjct: 449 TLWDLSVEADDEEIKQQI 466

>CAGL0K00275g Chr11 complement(26129..28276) [2148 bp, 715 aa] {ON}
           similar to uniprot|P36037 Saccharomyces cerevisiae
           YKL213c DOA1
          Length = 715

 Score = 33.5 bits (75), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 10/66 (15%)

Query: 266 NNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFISPKSQNIMYSCGEDGSVKTWKIE 325
           N+G +K++    E+ N+          G E    V+      N ++SCGED +V+ W I 
Sbjct: 199 NDGTIKLLNLEGEIKNV--------FEGHESF--VYCVKHMNNTLFSCGEDSTVRIWSIN 248

Query: 326 NNSLQV 331
            ++ QV
Sbjct: 249 GSTKQV 254

>NCAS0I02490 Chr9 complement(465916..467796) [1881 bp, 626 aa] {ON}
           Anc_3.95 YDR488C
          Length = 626

 Score = 33.5 bits (75), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 3/65 (4%)

Query: 146 VDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEEDALHQVINYESVHSCGWLS 205
           V+ H  DVT ++FHP + ++L SGS D   +++D       D +  +   E V +  WL 
Sbjct: 487 VNFHSSDVTSLRFHPQNDDLLCSGSMDWNCHLWDTFN---NDLIDSIDLKEDVIAVQWLP 543

Query: 206 PKRIY 210
            +  Y
Sbjct: 544 DRDTY 548

>TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1310

 Score = 33.9 bits (76), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 130 IHIYDIRNFDKPVRMLVDS---HHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           I IYDI   +K  + L+ S   H   V    F+  D N+L+SG  DG   ++DL
Sbjct: 205 ISIYDINKAEKLDKTLITSYSEHTRAVNSFDFNMVDSNLLISGGQDGCIKIWDL 258

>Kwal_47.17555 s47 complement(453984..455237) [1254 bp, 417 aa] {ON}
           YGL004C - Hypothetical ORF [contig 207] FULL
          Length = 417

 Score = 33.5 bits (75), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 4/43 (9%)

Query: 130 IHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTD 172
           I IYD +     V   ++ H+ ++TD+KF PS   VLLSGS D
Sbjct: 131 ISIYDSQ---AEVTRTLEGHYAEITDVKFFPSG-EVLLSGSAD 169

>KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.247
           YKR036C
          Length = 666

 Score = 33.5 bits (75), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 58/126 (46%), Gaps = 12/126 (9%)

Query: 62  MRVLDSDYDNGSVFSVA-MNDAVKVLDLRVQGNSIVAELNNEKKTP-FLSLDSRHGMLAC 119
           +  LD D+ NG++ +   ++  +K+ DL    ++ + EL   K T   L +D  + M+  
Sbjct: 368 ITTLDFDFPNGTLSTAGHLDHTIKLWDL--TKSTQIGELKGHKATVNSLQMDLTYNMVIS 425

Query: 120 G-----TELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGY 174
                  +L  VD  I  ++   +  P     DSH D++T I  +  +   L+SGS D  
Sbjct: 426 AGKDATVKLWNVDLGIESFNTERYFNPCIYTFDSHTDEITAISSYHEN---LVSGSRDKT 482

Query: 175 TNVYDL 180
              +DL
Sbjct: 483 IRQWDL 488

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 33.5 bits (75), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 81/186 (43%), Gaps = 19/186 (10%)

Query: 19  LELQPLYRHG-LLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLDSDYDN--GSVF 75
           L+  PL + G LLS   +G +     +T   + T K   T  N   + D  +     +VF
Sbjct: 277 LDWSPLIKTGALLSGDCSGQIYFTQRHTSRWV-TDKQPFTVSNNKSIEDIQWSRTESTVF 335

Query: 76  SVAMNDA-VKVLDLRVQGN--SIVAELNNEKKTPFLSLDSRHGMLACGTELSGVDAEIHI 132
           + A  D  +++ D R + +  +I  + +N         D    +LA G +    +    +
Sbjct: 336 ATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDD----NGTWGV 391

Query: 133 YDIRNFD-------KPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEE 185
           +D+R F        +PV    D H   +T I F+P D +++  GS D    ++DL+   +
Sbjct: 392 WDLRQFTPSNADTVQPVAQY-DFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEAD 450

Query: 186 EDALHQ 191
           ++ + Q
Sbjct: 451 DEEIKQ 456

>YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON}
           RRB1Essential nuclear protein involved in early steps of
           ribosome biogenesis; physically interacts with the
           ribosomal protein Rpl3p
          Length = 511

 Score = 33.5 bits (75), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 85/197 (43%), Gaps = 22/197 (11%)

Query: 8   HSNSLGRTDWCLELQPLYRHG-LLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLD 66
           H N  G   + L+  PL + G LLS   +G +     +T   + T K   T  N   + D
Sbjct: 271 HGNVEG---YGLDWSPLIKTGALLSGDCSGQIYFTQRHTSRWV-TDKQPFTVSNNKSIED 326

Query: 67  SDYDN--GSVFSVAMNDA-VKVLDLRVQGN--SIVAELNNEKKTPFLSLDSRHGMLACGT 121
             +     +VF+ A  D  +++ D R + +  +I  + +N         D    +LA G 
Sbjct: 327 IQWSRTESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGD 386

Query: 122 ELSGVDAEIHIYDIRNFD-------KPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGY 174
           +    +    ++D+R F        +PV    D H   +T I F+P D +++  GS D  
Sbjct: 387 D----NGTWGVWDLRQFTPSNADAVQPVAQY-DFHKGAITSIAFNPLDESIVAVGSEDNT 441

Query: 175 TNVYDLTQVEEEDALHQ 191
             ++DL+   +++ + Q
Sbjct: 442 VTLWDLSVEADDEEIKQ 458

>KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1159

 Score = 33.5 bits (75), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 4/68 (5%)

Query: 129 EIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEEDA 188
           ++ I+D+R+   P+  L   H+  V  I F   + N ++S S DG    +DL++   E+ 
Sbjct: 182 DVFIWDLRHGSTPLHKLT-GHNSGVNSIDFSRFEENKIMSSSNDGTVKFWDLSK---EEK 237

Query: 189 LHQVINYE 196
             Q I  E
Sbjct: 238 CQQAITTE 245

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 4/50 (8%)

Query: 135 IRNFDKP----VRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           I N +KP    +   +  H   +TDI F+   P++L + S D Y + +D+
Sbjct: 96  IWNLNKPSSNAIEYALHGHSRAITDINFNSQHPDILATCSIDTYVHAWDM 145

>ACR085C Chr3 complement(508364..511228) [2865 bp, 954 aa] {ON}
           NOHBY322; No homolog in Saccharomyces cerevisiae
          Length = 954

 Score = 33.5 bits (75), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 56/118 (47%), Gaps = 11/118 (9%)

Query: 108 LSLDSRHGMLACGTELSGVDAEIHIYDIR--NFDKPVRMLVDSHHDDVTDIKFHPSDPNV 165
           LS D R+ ++    EL G    I +Y +   + D PV  ++  H   V ++KFHPSD  V
Sbjct: 168 LSQDGRYMIVG---EL-GHKPRILVYSLAPDSNDFPV-FVIQQHSFGVANLKFHPSDSRV 222

Query: 166 LLSGST--DGYTNVYDLTQVEEEDALHQVINYESVHSCGWLSPKRI-YTLSHMETFAI 220
            +S     DG+ +V+ LT       L    N  SV    W + K I Y + H++ + I
Sbjct: 223 FMSLGQINDGFLHVWRLTSTNVV-LLGTNKNISSVTDVLWCNSKFITYGVRHLKEWRI 279

>KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 937

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 22/32 (68%), Gaps = 2/32 (6%)

Query: 291 AHGDEVVRDVFISPKSQNIMYSCGEDGSVKTW 322
           AH D +++  F+ P+S N  +SCG+DG VK W
Sbjct: 607 AHSDSIMKVAFL-PESHN-FFSCGKDGLVKYW 636

>KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa]
           {ON} Anc_4.122 YGL003C
          Length = 568

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 56/124 (45%), Gaps = 10/124 (8%)

Query: 91  QGNSIVAELNNEKKTPFLSLDSRHGMLACGTELSGV------DAEIHIYDIRNFDKPVRM 144
           Q N IV   +  KK    ++      +AC +  S +      D  I   D+R+ D P   
Sbjct: 322 QSNGIVEIFDVNKKKCIRTMLGHSDRVACLSWNSYILTSGSRDHNILHRDVRSPD-PFFE 380

Query: 145 LVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEEDALHQVINYESVHSCGWL 204
            ++SH  +V  +K++  D N L+SG  D   NVYD T  +    + +  +  +V +  W 
Sbjct: 381 KIESHSQEVCGLKWN-VDENKLVSGGNDNIVNVYDRTSTKPFMTMTE--HKAAVKALDWS 437

Query: 205 SPKR 208
           S KR
Sbjct: 438 SHKR 441

>CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131c Ribosome assembly protein
          Length = 513

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 86/186 (46%), Gaps = 19/186 (10%)

Query: 19  LELQPLYRHG-LLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINR-MRVLDSDYDNGSVFS 76
           L+  PL + G LLS   +G + L   +T   +   +A +   N+ +  +       +VF+
Sbjct: 281 LDWSPLIKSGALLSGDCSGQIYLTQRHTSKWVTDKQAYSVGNNKSIEDIQWSKTESTVFA 340

Query: 77  VAMNDA-VKVLDLRVQGN--SIVAELNNEKKTPFLSLDSRHG-MLACGTELSGVDAEIHI 132
            A  D  ++V D R + +  +I  + +N      +S + + G +LA G +    +    +
Sbjct: 341 TAGCDGYIRVWDTRSKKHKPAISVKASN-TDVNVISWNEKIGYLLASGDD----NGSWGV 395

Query: 133 YDIRNFD-------KPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEE 185
           +D+R F        +PV    + H   +T I F+P + +++  GS D    ++DL+   +
Sbjct: 396 WDLRQFTPDNAANIQPVAQY-NFHKGAITSIAFNPLEESIVAVGSEDNTVTLWDLSVEAD 454

Query: 186 EDALHQ 191
           ++ + Q
Sbjct: 455 DEEIKQ 460

>NCAS0H00700 Chr8 (125259..126152) [894 bp, 297 aa] {ON} Anc_7.338
           YLR208W
          Length = 297

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 34/79 (43%), Gaps = 6/79 (7%)

Query: 248 DYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFISPKSQ 307
           D V+D Y   +A   S++    +KI     E    +  ++    H   V R  +  PK  
Sbjct: 14  DAVLDYYGKRLATCSSDKT---IKIFEVEGE---THKEVATLEGHDGPVWRVDWAHPKFG 67

Query: 308 NIMYSCGEDGSVKTWKIEN 326
            I+ SC  DG V  WK EN
Sbjct: 68  TILASCSYDGKVLIWKEEN 86

>CAGL0J08778g Chr10 (868299..869195) [897 bp, 298 aa] {ON} highly
           similar to uniprot|Q04491 Saccharomyces cerevisiae
           YLR208w SEC13
          Length = 298

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 36/80 (45%), Gaps = 6/80 (7%)

Query: 248 DYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFISPKSQ 307
           D V+D Y   +A   S++    +KI     E   + D++     H   V R  +  PK  
Sbjct: 14  DAVLDYYGKKLATCSSDKT---IKIFEVEGESHKLVDTLV---GHEGPVWRVDWAHPKFG 67

Query: 308 NIMYSCGEDGSVKTWKIENN 327
            I+ SC  DG V  WK EN+
Sbjct: 68  TILASCSYDGKVIIWKEEND 87

>TDEL0A05290 Chr1 complement(933493..934452) [960 bp, 319 aa] {ON}
           Anc_8.585 YBR175W
          Length = 319

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 2/56 (3%)

Query: 124 SGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYD 179
           S +D  I I+D+ N    V   V +H + V  I     D  ++ SGS DG   V+D
Sbjct: 116 SSMDESIKIWDVLN--GSVMRTVAAHSESVVSIDIPADDSTIVCSGSYDGLIRVFD 169

>NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON}
           Anc_2.469 YMR093W
          Length = 510

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 127 DAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYD 179
           D  I ++DI N  +P   L  S  D V  +   PS P++++SGS DG   +YD
Sbjct: 146 DRVIRLWDISNAYQPQLELTGST-DYVRSVTCVPSAPHMIVSGSYDGIIRLYD 197

>KAFR0L01440 Chr12 complement(266463..267377) [915 bp, 304 aa] {ON}
           Anc_7.338 YLR208W
          Length = 304

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 34/79 (43%), Gaps = 6/79 (7%)

Query: 248 DYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFISPKSQ 307
           D V+D Y   +A   S++    +KI     E   +   +S    H   V R  +  PK  
Sbjct: 14  DAVLDYYGKRLATCSSDKT---IKIFEVEGESQKL---VSTLTGHEGPVWRVDWAHPKFG 67

Query: 308 NIMYSCGEDGSVKTWKIEN 326
            I+ SC  DG V  WK EN
Sbjct: 68  TILASCSYDGKVIIWKEEN 86

>ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {ON}
           similar to uniprot|P53196 Saccharomyces cerevisiae
           YGL004C RPN14 Putative non-ATPase subunit of the 19S
           regulatory particle of the 26S proteasome localized to
           the cytoplasm
          Length = 391

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 4/51 (7%)

Query: 134 DIRNFDKPVRM---LVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLT 181
           +IR FD    +   + ++H D++T +KF PS   VLLSGSTD    ++ L 
Sbjct: 105 NIRVFDSSPSLQHHIREAHLDEITCLKFFPSG-QVLLSGSTDMRLKIWSLA 154

>CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa]
           {ON} highly similar to uniprot|Q12417 Saccharomyces
           cerevisiae YPL151c PRP46 Pre-mRNA splicing factor PRP46
          Length = 427

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 76/176 (43%), Gaps = 41/176 (23%)

Query: 27  HGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLDSDYD-----------NGSVF 75
           HG +  ++   V+   + TG+  +T+K  N +  +++V    +D           +  +F
Sbjct: 115 HGWVRCIAMDKVDNEWFATGSNDKTIKIWNLASGKLKVTLKAHDMTVRDLAISNRHPYMF 174

Query: 76  SVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTEL-----------S 124
           SV+ +  VK  DL             EK T   ++ + HG L+    +           +
Sbjct: 175 SVSEDKTVKCWDL-------------EKNT---AIRNYHGHLSGVHTVDIHPTVDVVVTA 218

Query: 125 GVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           G D+ + ++DIR    PV M +  H   +T ++  P DP V +S S D    ++DL
Sbjct: 219 GRDSVVKVWDIRT-RLPV-MTLPGHKGPITKVRCLPVDPQV-ISSSVDASIRLWDL 271

>Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222C
           (UTP13) - Protein required for cell viability [contig
           27] FULL
          Length = 823

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 39/89 (43%), Gaps = 6/89 (6%)

Query: 155 DIKFHPSDPNVL--LSGSTDGYTNVYDLTQVEEEDALHQVINYESVHSCGWL--SP--KR 208
           D +  P+D  VL  L+G  D   N++ L   ++   +  +  ++ + +CG++  SP    
Sbjct: 196 DFRLSPADDGVLELLTGGRDDIVNLFQLNSTKKAKLMRTIPVHQQIEACGFIRDSPDGSL 255

Query: 209 IYTLSHMETFAIHELNNKSDELTEPKPLD 237
            YT      F I    + S      KP++
Sbjct: 256 FYTAGGDAVFQILSFTSASVAKRTKKPIE 284

>NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {ON}
           Anc_8.67
          Length = 885

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 87/209 (41%), Gaps = 21/209 (10%)

Query: 127 DAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEE 186
           D ++ IYD +   K     +  H   V  +K+   +  +++SGSTD    V+D   ++  
Sbjct: 493 DRQLRIYDSK--KKIFLKELSGHEGGVWALKY--DEDGIIVSGSTDRTVRVWD---IKRG 545

Query: 187 DALHQVINYESVHSC----GWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGDIR 242
              H    + S   C     + + K I T S   T  + +L  + +   +  PL F    
Sbjct: 546 CCTHVFKGHTSTVRCLEIVTYKNIKYIVTGSRDNTLHVWKLVREDNRSIDELPLIFNTPE 605

Query: 243 GTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNIND-----SISIPNAHGDEVV 297
              +  Y V V  G++A  ++   +GN+ I   ++  L + D      I +   H D + 
Sbjct: 606 ---ENPYFVGVLRGHMASVRTISGHGNIIISGSYDNNLMVWDIAQMKCIYLLIGHTDRIY 662

Query: 298 RDVFISPKSQNIMYSCGEDGSVKTWKIEN 326
             ++   + + I  S   D ++K W +EN
Sbjct: 663 STIYDHQRKRCI--SASMDSTIKIWDLEN 689

>NDAI0D00630 Chr4 (139065..139967) [903 bp, 300 aa] {ON} Anc_7.338
           YLR208W
          Length = 300

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 35/79 (44%), Gaps = 6/79 (7%)

Query: 248 DYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFISPKSQ 307
           D V+D Y   +A   S++    +KI     E   + D++     H   V R  +  PK  
Sbjct: 14  DAVLDYYGKRLATCSSDKT---IKIFEVEGENYKLIDTLI---GHEGPVWRVDWAHPKFG 67

Query: 308 NIMYSCGEDGSVKTWKIEN 326
            I+ SC  DG V  WK EN
Sbjct: 68  TILASCSYDGKVLIWKEEN 86

>ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1282

 Score = 33.1 bits (74), Expect = 1.6,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 31/59 (52%)

Query: 127 DAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEE 185
           D  I ++D+RN + P+++L   H   V  + +   D N+LLS   D    +++  + +E
Sbjct: 232 DPSILVWDLRNANTPLQVLSQGHSKGVLSLDWCNQDENLLLSSGRDNTVVLWNPQEGQE 290

>NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa]
           {ON} Anc_1.247
          Length = 589

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 64/152 (42%), Gaps = 47/152 (30%)

Query: 29  LLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLDSDYDNGSVFSVAMNDAVKVLDL 88
           LLS+  +  +   D  TGNC++T++A                     +++ N    + D 
Sbjct: 404 LLSASRDKSIRQWDLTTGNCVQTLEA---------------------TLSHNSGTNIKDS 442

Query: 89  RVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDS 148
            V+                 +L S    LA G++    D  I ++D+R+  K VR L+  
Sbjct: 443 TVE-----------------ALQSVGAALATGSK----DGIIRLWDLRS-GKVVRTLL-K 479

Query: 149 HHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           H   +T ++F   D   +++GSTD   +V DL
Sbjct: 480 HQGPITSLQF---DSTKIITGSTDANISVSDL 508

>NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa]
           {ON} Anc_8.288 YDR128W
          Length = 1134

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 24/39 (61%)

Query: 142 VRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           +  ++  H   +TDI F+P +P++L + S D Y + +D+
Sbjct: 105 IEHVLHGHSRAITDINFNPENPDILATCSIDTYVHAWDM 143

>KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1321

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 8/65 (12%)

Query: 119 CGTELSGVDAEIHIYDIRN---FDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYT 175
           CGT  S     + IYDI      D PV   +  H   +  + F+    ++L+SG  DG  
Sbjct: 196 CGTSTS-----VAIYDINKTSAIDNPVVTSLSEHTRSINSVDFNMVQTSLLISGGQDGCI 250

Query: 176 NVYDL 180
            ++DL
Sbjct: 251 KIWDL 255

>NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {ON}
           Anc_8.288
          Length = 1145

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 23/36 (63%)

Query: 145 LVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           ++  H   +TDI F+P +P++L + S D Y + +D+
Sbjct: 112 VLHGHSRAITDINFNPENPDILATCSVDTYVHAWDM 147

>YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box
           protein required for G1/S and G2/M transition,
           associates with Skp1p and Cdc53p to form a complex,
           SCFCdc4, which acts as ubiquitin-protein ligase
           directing ubiquitination of the phosphorylated CDK
           inhibitor Sic1p
          Length = 779

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 92/210 (43%), Gaps = 19/210 (9%)

Query: 127 DAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEE 186
           D  I +YD  + +K   + +  H   V  +K+  +   +L+SGSTD    V+D   +++ 
Sbjct: 401 DKMIRVYD--SINKKFLLQLSGHDGGVWALKY--AHGGILVSGSTDRTVRVWD---IKKG 453

Query: 187 DALHQVINYESVHSC----GWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGDIR 242
              H    + S   C     + + K I T S   T  + +L  +S      +  D+  + 
Sbjct: 454 CCTHVFKGHNSTVRCLDIVEYKNIKYIVTGSRDNTLHVWKLPKESSVPDHGEEHDYPLVF 513

Query: 243 GTWDCD-YVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNIND-----SISIPNAHGDEV 296
            T + + Y V V  G++A  ++   +GN+ +   ++  L + D      + I + H D +
Sbjct: 514 HTPEENPYFVGVLRGHMASVRTVSGHGNIVVSGSYDNTLIVWDVAQMKCLYILSGHTDRI 573

Query: 297 VRDVFISPKSQNIMYSCGEDGSVKTWKIEN 326
              ++   + + I  S   D +++ W +EN
Sbjct: 574 YSTIYDHERKRCI--SASMDTTIRIWDLEN 601

>KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 aa]
           {ON} weakly similar to uniprot|Q12206 YOR229W
           Saccharomyces cerevisiae WTM2 WD repeat containing
           transcriptional modulator 2
          Length = 449

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 27/57 (47%)

Query: 127 DAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQV 183
           D  I  YDIR   KP+  + + H   +T     P+   + ++GS  G   ++DL  V
Sbjct: 254 DNGIRFYDIRGDGKPLWTVFEPHDGKLTCYDVSPTLETLFITGSDTGVLKLWDLRSV 310

>NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa]
           {ON} Anc_8.585 YBR175W
          Length = 335

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 124 SGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYD 179
           S +D  I ++D+ N    +   + +H + V  +   P D  VL SGS DG   ++D
Sbjct: 123 SSMDESIKVWDVLN--GILMKTISAHSESVVSVDICPEDSTVLSSGSFDGLIRLFD 176

>YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON}
           UTP13Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 817

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 60/149 (40%), Gaps = 11/149 (7%)

Query: 37  DVNLLDWNTGNCIRTVKAGNTSINRMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIV 96
           ++N++D   G+     K  N     +  L    D   +  V+    +K+  L+     +V
Sbjct: 39  EINIIDLTPGSRKILHKISNEDEQEITALKLTPDGQYLTYVSQAQLLKIFHLKT--GKVV 96

Query: 97  AELNNEKKTPFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDI 156
             +     +  L  DS   +LA G    G D  I + DI N    +      H   ++ +
Sbjct: 97  RSMKISSPSYILDADSTSTLLAVG----GTDGSIIVVDIEN--GYITHSFKGHGGTISSL 150

Query: 157 KFHP---SDPNVLLSGSTDGYTNVYDLTQ 182
           KF+    S   +L SG T+G   V+DL +
Sbjct: 151 KFYGQLNSKIWLLASGDTNGMVKVWDLVK 179

>SAKL0F10010g Chr6 (767640..768644) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q75A19 Ashbya gossypii ADR108C ADR108Cp
          Length = 334

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 64/124 (51%), Gaps = 10/124 (8%)

Query: 29  LLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLDSDYDNGSVFSVAMNDAVKVLDL 88
           +++  S+  +++LD+ TG  ++++   ++ IN+++ L     N ++ SV  +  +KV D+
Sbjct: 103 IITGSSDTTLSILDFETGMKLKSLPGHSSIINQVKPLS----NTTIASVGDDGMLKVWDV 158

Query: 89  RVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDS 148
           R +     A  +   + P  +L +        T  SG++  I I+D+R+  K   + +++
Sbjct: 159 RTRK----AVWSATTEFPLFTLATTGEKHMVYT--SGLEPVIRIWDLRSSQKDDTLSIET 212

Query: 149 HHDD 152
            H D
Sbjct: 213 PHTD 216

>ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL138C
          Length = 1361

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 8/65 (12%)

Query: 119 CGTELSGVDAEIHIYDIRNF---DKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYT 175
           CGT  S     + IYDI      D P+   +  H   +  + F+    ++L+SG  DG  
Sbjct: 202 CGTSTS-----VSIYDINRASAKDSPLITTLSEHSRSINSVDFNMGQTHLLISGGQDGCI 256

Query: 176 NVYDL 180
            V+DL
Sbjct: 257 KVWDL 261

>NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {ON}
           Anc_8.316 YDR142C
          Length = 375

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%)

Query: 151 DDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           D +   +F P DPN+L+  S D YT ++DL
Sbjct: 185 DCIYQSQFSPHDPNLLICCSGDSYTTIFDL 214

>CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa]
           {ON} highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093w
          Length = 517

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 50/115 (43%), Gaps = 14/115 (12%)

Query: 75  FSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTELSGVDAEIHIYD 134
           F+V  +  V+V   R +    +   +  K   + +   + G L C  + +G+   + +YD
Sbjct: 55  FAVTSSTRVQVFSSRTR--QAIKTFSRFKDVVYSASYRKDGKLLCAGDATGL---VSVYD 109

Query: 135 IRNFDKPVRMLVD----SHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEE 185
             N   P  +LV      H   VT  KFH  D   L+S S D  T V+D++   E
Sbjct: 110 SYN---PRTLLVSVAASQHPTHVT--KFHDHDLKTLVSASDDRVTRVWDISHAYE 159

>CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa]
           {ON} similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195c MSI1
          Length = 419

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 41/73 (56%), Gaps = 7/73 (9%)

Query: 116 MLACGTELSGVDAEIHIYDIR-NFDKPVRMLVDSHHDD-VTDIKFHPSDPNVLLSGSTDG 173
            +ACG        ++ ++D+R N +K V  + +  H+D +   KF+P +  ++ S  T G
Sbjct: 261 FIACGES-----NKLGLFDMRLNGEKEVNSISNYKHEDGINTCKFNPGNSLLVASADTCG 315

Query: 174 YTNVYDLTQVEEE 186
             N++D+ ++++E
Sbjct: 316 RINLWDIRKLDQE 328

>KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 essential nuclear protein involved in early
           steps of ribosome biogenesis
          Length = 523

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 31/64 (48%)

Query: 125 GVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVE 184
           G+D  I I+D R+      + V + + DV  I +      +L SG  DG   V+DL Q  
Sbjct: 353 GIDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDDDGTWGVWDLRQFT 412

Query: 185 EEDA 188
            ++A
Sbjct: 413 PQNA 416

 Score = 30.4 bits (67), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 82/189 (43%), Gaps = 23/189 (12%)

Query: 16  DWCLELQPLYRHG-LLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINR-MRVLDSDYDNGS 73
           DW     P+ + G +LS   +G V L   +T   I   +A   + N+ +  L       +
Sbjct: 292 DWS----PIIKTGAMLSGDCSGQVFLTQRHTSKWITDKQAFTVANNKSIEDLQWSRTEST 347

Query: 74  VF-SVAMNDAVKVLDLRVQGN--SIVAELNNEKKTPFLSLDSRHG-MLACGTELSGVDAE 129
           VF S  ++  +++ D R + +  +I  + +N      +S   + G +LA G +    D  
Sbjct: 348 VFASCGIDGYIRIWDTRSKKHKPAISVKASN-TDVNVISWSEKIGYLLASGDD----DGT 402

Query: 130 IHIYDIRNFD-------KPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQ 182
             ++D+R F         PV      H   +T I F+P D +++   S D    ++DL+ 
Sbjct: 403 WGVWDLRQFTPQNASTASPVAQY-QFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSV 461

Query: 183 VEEEDALHQ 191
             +++ + Q
Sbjct: 462 EADDEEIKQ 470

>AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR128W
          Length = 1125

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 23/45 (51%)

Query: 136 RNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           R+    V   +  H   +TDI FHP  P +L + S D Y + +D+
Sbjct: 100 RSSSNAVEHELHGHTRAITDINFHPIHPELLATCSIDTYVHAWDM 144

>KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} similar
           to uniprot|P38968 Saccharomyces cerevisiae YDL195W SEC31
           involved in protein transport from endoplasmic reticulum
           to Golgi Component (p150) of COPII coat of secretory
           pathway vesicles
          Length = 1299

 Score = 32.3 bits (72), Expect = 2.3,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 3/65 (4%)

Query: 127 DAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEE 186
           D  I I+D+RN + P+++L   H   V  + +   D  +LLS   D   NV  L   EE 
Sbjct: 228 DPSILIWDLRNANVPMQVLSQPHTKGVLSLDWCKQDETLLLSSGRD---NVCVLWNPEEG 284

Query: 187 DALHQ 191
            +L Q
Sbjct: 285 QSLTQ 289

>KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 89/207 (42%), Gaps = 23/207 (11%)

Query: 8   HSNSLGRTDWCLELQPLYRHG-LLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLD 66
           H N  G   + L+  PL + G LL+   +G + L   NT   + T K   T  N   V D
Sbjct: 276 HGNVEG---YALDWSPLIKTGALLTGDCSGQIYLTQRNTSKWV-TDKQPFTVGNNKSVED 331

Query: 67  SDYDN--GSVFSVAMNDA-VKVLDLRV-QGNSIVAELNNEKKTPFLSLDSRHG-MLACGT 121
             +     +VF+    D  V++ D R  Q    ++   +      +S + + G +LA G 
Sbjct: 332 IQWSRTEATVFASCGCDGYVRIWDTRSKQHKPALSVKASNTDVNVISWNEKIGYLLASGD 391

Query: 122 ELSGVDAEIHIYDIRNFD-------KPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGY 174
           +    +    ++D+R F        +PV    D H   +T I F+P + +++   S D  
Sbjct: 392 D----NGSWGVWDLRQFTPDNINNVQPVAQY-DFHKGAITSISFNPLEESIIAVASEDNT 446

Query: 175 TNVYDLT-QVEEEDALHQVINYESVHS 200
             ++DL+ + ++E+   Q    + + S
Sbjct: 447 VTLWDLSVEADDEEIKQQAAETKELES 473

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 66/166 (39%), Gaps = 22/166 (13%)

Query: 58  SINRMRVLDSDYDNGSVFSVAM--NDAVKVLDLRVQGNSIVA---ELNNEKKTPFLSLDS 112
           + NR+RV      N  V +  M  N  V + DL  Q  +  +   ++    K P  ++ +
Sbjct: 216 TTNRLRVSPFAQSNKEVLTATMSENGEVYIFDLGPQSKAFSSPGYQVPKSSKRPVHTIKN 275

Query: 113 RHG-----------MLACGTELSGVDAEIHIY-DIRNFDKPV---RMLVDSHHDDVTDIK 157
            HG           ++  G  L+G D    IY   RN  K V   +     ++  V DI+
Sbjct: 276 -HGNVEGYALDWSPLIKTGALLTG-DCSGQIYLTQRNTSKWVTDKQPFTVGNNKSVEDIQ 333

Query: 158 FHPSDPNVLLSGSTDGYTNVYDLTQVEEEDALHQVINYESVHSCGW 203
           +  ++  V  S   DGY  ++D    + + AL    +   V+   W
Sbjct: 334 WSRTEATVFASCGCDGYVRIWDTRSKQHKPALSVKASNTDVNVISW 379

>Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093W
           (REAL)
          Length = 513

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 40/75 (53%), Gaps = 7/75 (9%)

Query: 105 TPFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPN 164
           T F + DS+  +LA  ++    D    ++DI N  +P ++ +    D V  + F P+ P+
Sbjct: 130 TKFHTQDSK--ILATASD----DRVTRLWDISNAYEP-QLELTGATDYVRTLSFIPAAPH 182

Query: 165 VLLSGSTDGYTNVYD 179
           ++ +GS DG   +YD
Sbjct: 183 LIATGSYDGLVRLYD 197

>KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1120

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 22/39 (56%)

Query: 142 VRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           +  ++  H   +TDI F P  P++L + S D Y + +D+
Sbjct: 106 IEYVLHGHSRAITDINFSPQHPDILATCSIDTYVHAWDM 144

>ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093W UTP15 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 510

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 43/86 (50%), Gaps = 7/86 (8%)

Query: 94  SIVAELNNEKKTPFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDV 153
           SI A  +    T F S DS+  + A    ++       ++DI    +P ++ +    D V
Sbjct: 119 SINASTHPTHVTKFHSHDSKSLVTASDDRIT------RVWDISQSYEP-QLELKGASDYV 171

Query: 154 TDIKFHPSDPNVLLSGSTDGYTNVYD 179
             + F P+ P+++++GS DG+  +YD
Sbjct: 172 RSVNFVPAAPHLVMTGSYDGHVRLYD 197

>NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {ON}
           Anc_5.429 YDR364C
          Length = 448

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 140 KPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           K ++  +D H +  T + F P+  N+LLSG  D    V+D 
Sbjct: 145 KKIKYAMDGHTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDF 185

>KLLA0A08866g Chr1 (776960..778231) [1272 bp, 423 aa] {ON} similar
           to uniprot|P53196 Saccharomyces cerevisiae YGL004C RPN14
           Putative non-ATPase subunit of the 19S regulatory
           particle of the 26S proteasome localized to the
           cytoplasm
          Length = 423

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 77/200 (38%), Gaps = 43/200 (21%)

Query: 27  HGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLD------SDYDNGS------- 73
           HG LSS  +  + + D +TG  +RT      S+N   ++D      S   +GS       
Sbjct: 171 HGFLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAMVDRGRNFVSASSDGSLKLWECS 230

Query: 74  ----VFSVAMNDAVKVLDLR-VQGNSIVA---------ELNNEKKTPFLSLDSRHGMLAC 119
               VF++  ND +  + L   QGN             E N E K  F   D        
Sbjct: 231 TSACVFTLNSNDGINCISLANYQGNPATTSYNALDHSNEYNTEGKAVFAGHD-------- 282

Query: 120 GTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFH-PSDPNVLLSGSTDGYTNVY 178
               SG+   I  +DI N  K + +L  S    VT    H   D + L +G +DG    +
Sbjct: 283 ----SGI---ITFHDIYNRKKILDILPASKSACVTLTSQHIAGDDHYLFAGYSDGTIVSW 335

Query: 179 DLTQVEEEDALHQVINYESV 198
           D   V +     QV + +S+
Sbjct: 336 DTRNVSKPVETLQVNDNDSI 355

>TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.401
           YMR131C
          Length = 514

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 86/197 (43%), Gaps = 22/197 (11%)

Query: 8   HSNSLGRTDWCLELQPLYRHG-LLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLD 66
           H N  G   + L+  PL + G LL+   +G V L   +T   + T K   T  N   + D
Sbjct: 274 HGNVEG---YGLDWSPLIKTGALLTGDCSGQVYLTQRHTSKWV-TDKQPFTFSNNKSIED 329

Query: 67  SDYDN--GSVFSVAMNDA-VKVLDLRVQGNS-IVAELNNEKKTPFLSLDSRHG-MLACGT 121
             +     +VF+ +  D  +++ D R + +   ++   +      +S + + G +LA G 
Sbjct: 330 IQWSRTESTVFATSGCDGYIRIWDTRSKKHKPAISTRASATDVNVISWNEKIGYLLASGD 389

Query: 122 ELSGVDAEIHIYDIRNFD-------KPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGY 174
           +    D    ++D+R          +PV    D H   +T I F+P D +++   S D  
Sbjct: 390 D----DGRWGVWDLRQLSPNNSENVQPVAQY-DFHKGAITSISFNPLDESIIAVASEDNT 444

Query: 175 TNVYDLTQVEEEDALHQ 191
             ++DL+   +++ + Q
Sbjct: 445 VTLWDLSVEADDEEIKQ 461

>NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {ON}
           Anc_7.310
          Length = 1276

 Score = 32.3 bits (72), Expect = 2.7,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 124 SGVDAE--IHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYD 179
           SG D++  I I+D+RN + P+  L   H   +  + +   D ++LLS   DG   ++D
Sbjct: 234 SGSDSDPVILIWDLRNSNMPMTTLEGPHTKGIMSLDWCTKDESLLLSSGRDGIVALWD 291

>KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]
           {ON} weakly similar to uniprot|Q12523 Saccharomyces
           cerevisiae YPL247C Hypothetical ORF
          Length = 493

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 30/65 (46%), Gaps = 5/65 (7%)

Query: 116 MLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYT 175
           +L+C      +D    ++D+ N    V+  + +H  +V D+KF      +  S   DG  
Sbjct: 207 LLSCS-----IDTTCTVWDLSNSTNYVKTQLIAHDSEVFDVKFLAQSTQLFASCGGDGSV 261

Query: 176 NVYDL 180
            V+DL
Sbjct: 262 RVFDL 266

>TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {ON}
           Anc_2.469 YMR093W
          Length = 510

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 36/75 (48%), Gaps = 12/75 (16%)

Query: 115 GMLACGTELSGVDAEIHIYDIRNFDKPVRMLVD----SHHDDVTDIKFHPSDPNVLLSGS 170
           G L C  + +G+   + +YD  N   P  +L+     SH   VT  KFH  D   L++ S
Sbjct: 93  GKLLCAGDATGL---VSVYDSYN---PRTLLLSINASSHPTHVT--KFHTQDSKTLVTAS 144

Query: 171 TDGYTNVYDLTQVEE 185
            D  T V+D++   E
Sbjct: 145 DDRITRVWDISHAYE 159

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 44/83 (53%), Gaps = 2/83 (2%)

Query: 127 DAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEE 186
           D    ++DI +  +P ++ +    D V    F PS P+++++GS DG+  +YD T+    
Sbjct: 146 DRITRVWDISHAYEP-QLKLSGASDYVRTACFVPSAPHLVMTGSYDGFLRLYD-TRASGA 203

Query: 187 DALHQVINYESVHSCGWLSPKRI 209
             ++ + + + V +   +SP ++
Sbjct: 204 TPVYSLNHDQPVENVTSISPTQV 226

>Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W
           (REAL)
          Length = 1273

 Score = 32.3 bits (72), Expect = 2.9,   Method: Composition-based stats.
 Identities = 15/59 (25%), Positives = 29/59 (49%)

Query: 127 DAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEE 185
           D  I ++D+RN + P++ L   H   +  + +   D N+LLS   D    +++    E+
Sbjct: 234 DPSILVWDLRNANTPMQTLNQGHQKGILSLDWCDQDENLLLSSGRDNTVLLWNPESAEQ 292

 Score = 30.4 bits (67), Expect = 9.9,   Method: Composition-based stats.
 Identities = 46/211 (21%), Positives = 86/211 (40%), Gaps = 26/211 (12%)

Query: 148 SHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEEDALHQVI-------NYESVHS 200
           SH   V  +KF+    NVL SG  +G   ++D+ +  E  + +  +       + + V+S
Sbjct: 106 SHSSSVKTVKFNARQDNVLASGGNNGEIFIWDMNKCTESPSTYTPLTPGQSMSSVDEVNS 165

Query: 201 CGW-LSPKRIYTLSHMETFA-IHELNNKSD--ELTEPKPLDFGDIRGTWDCDYVVDVYPG 256
             W  S   ++  +    FA I +L  K +   L+   P       G      VV+ +P 
Sbjct: 166 LAWNQSLAHVFASAGSSNFASIWDLKAKKEVIHLSYTSPSS-----GIKQQLSVVEWHPK 220

Query: 257 ---YIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFISPKSQNIMYSC 313
               +A     +N+ ++ +     +L N N  +   N    + +  +    + +N++ S 
Sbjct: 221 NSTRVATATGSDNDPSILVW----DLRNANTPMQTLNQGHQKGILSLDWCDQDENLLLSS 276

Query: 314 GEDGSVKTWKIENNSL--QVPP-GFWDYSTQ 341
           G D +V  W  E+     Q P  G W + T+
Sbjct: 277 GRDNTVLLWNPESAEQLSQFPARGNWCFKTK 307

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 84/197 (42%), Gaps = 22/197 (11%)

Query: 8   HSNSLGRT-DWCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLD 66
           H N  G   DW   +Q      LL+   +G +     +T   + T K   T  N   + D
Sbjct: 272 HGNVEGYALDWSPSIQ---TGALLTGDCSGQIYFTQRHTSKWV-TDKQPFTVSNNKSIED 327

Query: 67  SDYDN--GSVFSVAMNDA-VKVLDLRVQGN--SIVAELNNEKKTPFLSLDSRHGMLACGT 121
             +    G+VF+ A  D  +++ D R + +  +I  + +N      +S   + G L    
Sbjct: 328 IQWSRTEGTVFASAGCDGYIRIWDTRSKKHKPAISVKASN-TDVNVISWSDKLGYLLASG 386

Query: 122 ELSGVDAEIHIYDIRNFD-------KPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGY 174
           + +GV     ++D+R F        +PV    D H   +T I F+P D +++   S D  
Sbjct: 387 DDNGV---WGVWDLRQFSPDTANSVQPVAQY-DFHKGAITSISFNPLDESIVAVASEDNT 442

Query: 175 TNVYDLTQVEEEDALHQ 191
             ++DL+   +++ + Q
Sbjct: 443 VTLWDLSVEADDEEIKQ 459

>TDEL0C02080 Chr3 (360056..360940) [885 bp, 294 aa] {ON} Anc_7.338
           YLR208W
          Length = 294

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 36/80 (45%), Gaps = 6/80 (7%)

Query: 248 DYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFISPKSQ 307
           D ++D Y   +A   S++    +KI     E   + ++++    H   V R  +  PK  
Sbjct: 14  DAILDYYGKRLATCSSDKT---IKIFEVEGENHKLVETLT---GHEGPVWRVDWAHPKFG 67

Query: 308 NIMYSCGEDGSVKTWKIENN 327
            I+ SC  DG V  WK EN 
Sbjct: 68  TILASCSYDGKVLIWKEENG 87

>Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W
           (CDC4) - 1:1 [contig 7] FULL
          Length = 744

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 71/176 (40%), Gaps = 37/176 (21%)

Query: 27  HGLLSSLSNGDVNLLDWNTGN--CIRTVKAGNTSINRMRVLDSDYDNGSVFSVAMNDAVK 84
           HG +    + D NL+ W+     C+  V  G+T  +R+     DY      S  M+  VK
Sbjct: 524 HGNIVVSGSYDFNLMVWDIAQMKCLY-VLTGHT--DRIYSTIYDYQRNRCISAGMDSTVK 580

Query: 85  VLDL--------------------RVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTELS 124
           V DL                    +V G+SI  +  +      L L  +  + A      
Sbjct: 581 VWDLADVSKNGPCTTITSSNNPCTKVTGSSITLQ-GHTALVGLLGLSDKFLVSA------ 633

Query: 125 GVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           G D  +  +D  N+ +        HH D++ I     + N+L+SGS +G  N+Y+L
Sbjct: 634 GADGILRGWDSENYTRQFAY----HHKDLSAITTFYVNDNILVSGS-EGNFNIYNL 684

>Kwal_26.7655 s26 complement(460957..463188) [2232 bp, 743 aa] {ON}
           YMR102C - Hypothetical ORF [contig 55] FULL
          Length = 743

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 20/34 (58%)

Query: 139 DKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTD 172
           D+P  + V +H D VT  KFHP+D    +SG  D
Sbjct: 301 DRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLD 334

>Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {ON}
           complement(43719..47660) [3942 nt, 1314 aa]
          Length = 1313

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 3/54 (5%)

Query: 130 IHIYDIR---NFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           I IYDI    N D P+      H   V    F+ +  ++L+SG  DG   ++DL
Sbjct: 208 ISIYDINKNDNIDNPLVTSFSEHSRAVNSFDFNMTQTSLLISGGQDGQIKIWDL 261

>Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W
           (REAL)
          Length = 1271

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 29/59 (49%)

Query: 127 DAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEE 185
           D  I ++D+RN + P++ L   H   +  + +   D N+LLS   D    +++    EE
Sbjct: 234 DPSILVWDLRNANTPLQTLSQGHQKGILSLDWCHQDENLLLSSGRDNTVLLWNPESAEE 292

>TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 127 DAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVY 178
           D  ++I+DIR  ++P  +L  +H+  V+ I+F   +   L+S   D   NVY
Sbjct: 370 DGTVNIWDIRKTNQPQVLL--AHNSIVSGIRFEKHNGKFLMSCGYDKNINVY 419

>KLTH0D04950g Chr4 complement(449060..451402) [2343 bp, 780 aa] {ON}
           weakly similar to uniprot|Q03177 Saccharomyces
           cerevisiae YMR102C Protein of unknown function
           transcription is activated by paralogous transcription
           factors Yrm1p and Yrr1p along with genes involved in
           multidrug resistance
          Length = 780

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 10/64 (15%)

Query: 139 DKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEEDALHQVINYESV 198
           D+P  +    H D VT  KFHP+D    LSG  D    ++ +        L   +++E  
Sbjct: 300 DRPKALKTFEHPDFVTCAKFHPNDDRFFLSGCLDHKLRLWSI--------LDHSVSFE-- 349

Query: 199 HSCG 202
           H CG
Sbjct: 350 HYCG 353

>AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL006W
           (LST8)
          Length = 303

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 30/138 (21%), Positives = 60/138 (43%), Gaps = 15/138 (10%)

Query: 45  TGNCIRTVKAGNTSINRMRVL-DSDYDNGSVFSVAMNDAVKVLDLRVQG-NSIVAELNNE 102
           TG C RT++  ++ +NR+ +  D  Y      + A +  V++ D+R    N + +   + 
Sbjct: 21  TGVCSRTIQHADSQVNRLEITSDKRY-----LAAAGHLHVRMYDIRTTNPNPVTSFEGHR 75

Query: 103 KKTPFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSD 162
                ++    +  +   +E    D  I ++D+R+   P       H   V ++  HP+ 
Sbjct: 76  GNVTSIAFQQDNKWMVSSSE----DGTIKVWDVRS---PSVQRNYKHDAPVNEVVIHPNQ 128

Query: 163 PNVLLSGSTDGYTNVYDL 180
              L+S   DG   ++DL
Sbjct: 129 GE-LISCDQDGNIKIWDL 145

>TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.450
           YMR102C
          Length = 945

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 107 FLSLD-SRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNV 165
            L LD SR+G +      S +D  + ++   + DK   +   SH D VT +KFHP D   
Sbjct: 411 ILDLDWSRNGFILT----SSIDKTVKLW---HTDKNKSLRTFSHPDFVTTVKFHPIDDRF 463

Query: 166 LLSGSTDGYTNVYDL 180
            +SG  D    ++ +
Sbjct: 464 FISGCIDQKCRLWSI 478

>Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 33/53 (62%), Gaps = 2/53 (3%)

Query: 128 AEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           A+IH++D+ N  KPV  L     D++T +KF+ S+ ++L S  +D    +YDL
Sbjct: 199 AKIHLWDV-NRLKPVSNL-SWGADNITSVKFNQSETDILASTGSDNSIVLYDL 249

>Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON}
           (85899..87926) [2028 nt, 676 aa]
          Length = 675

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 88/213 (41%), Gaps = 23/213 (10%)

Query: 127 DAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEE 186
           D  I +YD  + DK   + +  H   V  +K+   +  +++SGSTD    V+D+ Q    
Sbjct: 310 DKMIRVYD--SVDKRFLLELSGHEGGVWALKY--DEDGIIVSGSTDRSVRVWDIKQGR-- 363

Query: 187 DALHQVINYESVHSC----GWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGDIR 242
              H    + S   C     + + K I T S   T  + +L  K D        D   + 
Sbjct: 364 -CTHIFKGHTSTVRCLEIVEYKNVKYIITGSRDNTLHVWKL-PKPDVERRVDSADGNKLP 421

Query: 243 GTWDC----DYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNIND-----SISIPNAHG 293
            T++      Y V +  G++A  ++   +GN+ I   ++  L + D      + I   H 
Sbjct: 422 FTYNSPDENPYFVGILRGHMASVRALSGHGNIVISGSYDNSLMVWDIAQMKCLYILTGHT 481

Query: 294 DEVVRDVFISPKSQNIMYSCGEDGSVKTWKIEN 326
           D +   V+   + + I  S   D +++ W +++
Sbjct: 482 DRIYSTVYDHKRKRCI--SASMDATIRVWDLKD 512

>KAFR0A04350 Chr1 (865961..869305) [3345 bp, 1114 aa] {ON} Anc_6.176
           YGL094C
          Length = 1114

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 44/113 (38%), Gaps = 12/113 (10%)

Query: 230 LTEPKPLDF--GDIRGTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSIS 287
           +T+  P+ F  G   G    D+V  ++P    V  +   NG    I   N +L       
Sbjct: 238 MTQLPPISFSKGTTMGAGGADFV-KLHPVLPTVMIAASKNGPFDFIDLSNPILRTQ---- 292

Query: 288 IPNAHGDEVVRDVFISPKSQNIMYSCGEDGSVKTWKIENNSLQV--PPGFWDY 338
               H  + ++D+ ISP   NI      D +V TW    N  Q    PG  +Y
Sbjct: 293 --YVHPGQEIKDLIISPNGDNITV-LEIDNTVSTWSRSQNVGQFTNTPGILEY 342

>ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR212W (STE4)
          Length = 467

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 46/97 (47%), Gaps = 11/97 (11%)

Query: 125 GVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVE 184
           G D  ++I+D R         V     DV+ +KF   + N + +GS DG TN+YDL    
Sbjct: 281 GSDGYLYIWDKRVPTSVQSFFVS--DSDVSKVKFF-RNGNTIATGSDDGCTNLYDL---- 333

Query: 185 EEDALHQVINYESVHSCGWLSP--KRIYTLSHMETFA 219
             D   ++ NY    S    +P  ++ Y +S+M+  A
Sbjct: 334 RSDC--RIANYSLSRSIHGATPVQQQTYIMSNMDYTA 368

>KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 aa]
           {ON} highly similar to uniprot|P38011 Saccharomyces
           cerevisiae YMR116C ASC1 WD repeat protein (G-beta like
           protein) involved in translation regulation required for
           repression of Gcn4p activity in the absence of
           amino-acid starvation core component of the ribosome
           ortholog of mammalian RACK1
          Length = 319

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%)

Query: 142 VRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLT 181
           +R  ++ H+  VT +   P+ PN+LLSGS D     + LT
Sbjct: 9   LRGTLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLT 48

>AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR142C (PEX7)
          Length = 370

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 21/32 (65%)

Query: 151 DDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQ 182
           D +   +F P DPN+++S S + Y +++DL Q
Sbjct: 177 DCIYQAQFSPHDPNLVMSCSGNSYVSLFDLRQ 208

>Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON}
           (40266..43685) [3420 nt, 1140 aa]
          Length = 1139

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 132 IYDI-RNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           I+D+ R+    +  ++ +H   +TDI F+   P++L + S D Y + +DL
Sbjct: 95  IWDLARSSSNSIEHVIHAHFRAITDINFNRQHPDILATCSIDTYIHAWDL 144

>Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR178W
           (PRP4) - associated with the U4/U6 snRNP [contig 8] FULL
          Length = 474

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 58/125 (46%), Gaps = 14/125 (11%)

Query: 70  DNGSVFSVAMNDAVKVLDLRVQGNSIVAELN--NEKKTPFLSLDSRHGMLACGTELSGVD 127
           D  S+ + + N  VK+L    Q   +V  L+  ++ K   ++  S   +LA G    G D
Sbjct: 193 DGASLAAGSWNGDVKIL--HPQSLEVVRSLDGAHDDKIGGVAWSSDSQLLATG----GAD 246

Query: 128 AEIHIYD--IRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEE 185
             + I++   ++  +  R+++  H   V+ +KFHPSD  V    ++  +   + L  VE 
Sbjct: 247 NLVKIWNPQAQSHSEASRVVLRGHEARVSKVKFHPSDRFV----ASASFDMTWRLWDVER 302

Query: 186 EDALH 190
           E  L 
Sbjct: 303 ETELQ 307

>KNAG0D03460 Chr4 (622817..624055) [1239 bp, 412 aa] {ON} Anc_4.119
           YGL004C
          Length = 412

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 123 LSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           L   +  IH+Y       P+  + ++H  D+T +KF PS   ++LS STD    ++ L
Sbjct: 115 LGDSNGNIHLY--YELFNPLYKIEEAHFGDITSVKFFPSG-KLILSASTDMRMKIWSL 169

>SAKL0G01628g Chr7 complement(133626..136505) [2880 bp, 959 aa] {ON}
           conserved hypothetical protein
          Length = 959

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 5/81 (6%)

Query: 103 KKTPFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHD-DVTDIKFHPS 161
           K T  LSL      L  G   +G    + +Y +          V  HH   + ++KFHP+
Sbjct: 136 KTTSCLSLSPDEKFLIVGE--TGHHPRVLLYSLAPDSNDFPAFVIHHHSYGIANLKFHPT 193

Query: 162 DPNVLLSGS--TDGYTNVYDL 180
           DP + LS     DG+ +++ L
Sbjct: 194 DPKIFLSLGLINDGFLHIWRL 214

>Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C
           (ASC1) - G-beta like protein [contig 54] FULL
          Length = 218

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%)

Query: 142 VRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLT 181
           +R  ++ H+  VT +   P+ PN+LLSGS D     + LT
Sbjct: 9   LRGTLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLT 48

>NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25
          Length = 510

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 34/159 (21%), Positives = 67/159 (42%), Gaps = 15/159 (9%)

Query: 16  DWCLELQPLYRHGLLSSLSNGD-VNLLDWNTGNCIRTVKAGNTSINRMRVLDSDYDNGSV 74
           DW  E+      GL+ S S  + + L D  +GNC+ T+     ++  ++V         +
Sbjct: 212 DWHPEM------GLIISASKDNLIKLWDPRSGNCVSTILKFKHTV--LKVKFQPTGGNMI 263

Query: 75  FSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTELSGVDAEIHIYD 134
            +++ + + +V D+R     ++   +       L       M   G      D  I  +D
Sbjct: 264 AAISKDKSCRVFDIRHSMKELLCVRDEVDYMTLLWNPINESMFTVG----NYDGSIKHFD 319

Query: 135 -IRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTD 172
            +++  KP  ++  +H   VT + ++P   N+L S S D
Sbjct: 320 LLQDLTKPTHVIPYAHDKCVTSLSYNPMG-NILASASKD 357

>SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 470

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 55/111 (49%), Gaps = 11/111 (9%)

Query: 70  DNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLD-SRHGM-LACGTELSGVD 127
           D   + S  ++    V DLR  G SI+A   + K  P   LD S +G  +A G+     D
Sbjct: 322 DGSLLCSTGLDSVGLVWDLR-SGKSIMALEGHIK--PIYGLDWSPNGYDIATGS----AD 374

Query: 128 AEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVY 178
             I ++D+R     +   + +H+  V+++KF  ++ + L+S S D   N+Y
Sbjct: 375 GTIRLWDVRKVG--ILGALPAHNSIVSEVKFDKANGHYLVSSSYDKTLNIY 423

>Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 60/149 (40%), Gaps = 11/149 (7%)

Query: 37  DVNLLDWNTGNCIRTVKAGNTSINRMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIV 96
           ++N++D   G+     +  N     +  L    D   +  V+    +K+  L+     +V
Sbjct: 39  EINIIDLTPGSRNIIHRISNEDEQEITALKLTPDGQYLTYVSQAQLLKIFHLKT--GKVV 96

Query: 97  AELNNEKKTPFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDI 156
             +     +  L  DS   +LA G    G D  I + DI N    +      H   ++ +
Sbjct: 97  RSMKISSPSYILDADSTSTLLAVG----GTDGSIIVVDIEN--GYITHSFKGHGGTISSL 150

Query: 157 KFHP---SDPNVLLSGSTDGYTNVYDLTQ 182
           KF+    S   +L SG T+G   V+DL +
Sbjct: 151 KFYGQLDSKIWLLASGDTNGMVKVWDLVK 179

>YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}
           YTM1Constituent of 66S pre-ribosomal particles, forms a
           complex with Nop7p and Erb1p that is required for
           maturation of the large ribosomal subunit; has seven
           C-terminal WD repeats
          Length = 460

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 73/174 (41%), Gaps = 20/174 (11%)

Query: 63  RVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLD----SRHGMLA 118
           +V+    DN   +SV+ +  +K  DL      + A   + + T +  L     S   +LA
Sbjct: 292 QVIFDSTDNTVGYSVSQDHTIKTWDL------VTARCIDTRTTSYSLLSIAQLSTLNLLA 345

Query: 119 CGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVY 178
           CG+  S     +H   +    K  +  +  H + V+ +   P +  +L SGS DG   V+
Sbjct: 346 CGS--SARHITLHDPRVGASSKVTQQQLIGHKNFVSSLDTCPENEYILCSGSHDGTVKVW 403

Query: 179 DL-------TQVEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNN 225
           D+       T   E+ ++ + +N + V +  W     I +    +   I++ +N
Sbjct: 404 DVRSTSPMYTITREDKSVQKGVN-DKVFAVKWAEKVGIISAGQDKKIQINKGDN 456

>KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {ON}
           Anc_8.631 YOR212W
          Length = 425

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 3/56 (5%)

Query: 125 GVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           G D   +I+DIR         V +   DV  ++F   D N + +GS DG  N+YDL
Sbjct: 247 GSDGYTYIWDIRTPGSVQNFFVSNR--DVNTLQFF-KDGNSIATGSDDGMVNLYDL 299

>KAFR0I00640 Chr9 (128872..129819) [948 bp, 315 aa] {ON} Anc_8.585
           YBR175W
          Length = 315

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query: 124 SGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLT 181
           S +D  I I+D+ N    +   + +H + V  I     D +VL SGS DG   ++D T
Sbjct: 116 SSMDESIKIWDVLN--GTLMKTISAHSEAVVSIDVPTLDSSVLGSGSYDGLIRIFDTT 171

>TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8.544
           YBR198C
          Length = 832

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 6/65 (9%)

Query: 117 LACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTN 176
           LA G+E    D  IHI+DI    K ++ L+      V  + ++  + N+L+SG +D    
Sbjct: 694 LATGSE----DGVIHIWDI-GTGKSLKKLIGHGKSAVNSLSYN-KESNILVSGGSDNSVR 747

Query: 177 VYDLT 181
           ++DLT
Sbjct: 748 IWDLT 752

>Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 83/197 (42%), Gaps = 22/197 (11%)

Query: 8   HSNSLGRTDWCLELQPLYRHG-LLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLD 66
           H N  G   + L+  PL + G LL+   +G V L   +T   I   K   T  N   V D
Sbjct: 280 HGNVEG---YALDWSPLIKTGALLTGDCSGQVYLTQRHTSKWISD-KEPFTVANNQSVED 335

Query: 67  SDYDN--GSVFSVAMNDA-VKVLDLRVQGN--SIVAELNNEKKTPFLSLDSRHGMLACGT 121
             +     +VF+    D  ++V D R + +  +I  + +N      +S   + G L    
Sbjct: 336 IQWSRTESTVFASCGCDGYIRVWDTRSKKHKPAISVKASN-TDVNVISWSEKIGYLLASG 394

Query: 122 ELSGVDAEIHIYDIRNFD-------KPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGY 174
           + +G      ++D+R F         PV    D H   +T I F+P D +++   S D  
Sbjct: 395 DDNGT---WGVWDLRQFSPSNSNNTSPVAQY-DFHKGAITSISFNPLDESIVAVASEDNT 450

Query: 175 TNVYDLTQVEEEDALHQ 191
             ++DL+   +++ + Q
Sbjct: 451 VTLWDLSVEADDEEIKQ 467

>KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON}
           Anc_4.122 YGL003C
          Length = 617

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 66/174 (37%), Gaps = 34/174 (19%)

Query: 35  NGDVNLLDWNTGNCIRTVKAGNTSINRMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNS 94
           NG V + D   G CIRT+      ++R+  L   ++N  + S + +  +   D+R+    
Sbjct: 374 NGLVEIYDAVKGKCIRTLSG---HVDRVACL--SWNNHILSSGSRDHRILHRDVRMPD-- 426

Query: 95  IVAELNNEKKTPFLSLDSRHGMLACGTEL---------SGVDAEIHIYDIRNFDKPVRML 145
                      PF      H    CG +           G D  +H+YD     +   + 
Sbjct: 427 -----------PFFERIESHTQEVCGLKWNVDENKLASGGNDNIVHVYD--GTSRTPMLT 473

Query: 146 VDSHHDDVTDIKFHPSDPNVLLSGSTDG-----YTNVYDLTQVEEEDALHQVIN 194
           ++ H   V  I + P    +L +G           N+ +LT+V E D   Q+ N
Sbjct: 474 LNEHKAAVKAIAWSPHKRGILATGGGTADRCLKIWNINNLTKVREVDTSSQICN 527

>Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {ON}
           complement(90370..91632) [1263 nt, 421 aa]
          Length = 420

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 124 SGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           SG D   +I+D+R+        V   + DV  +KF   D N +++GS DG   ++DL
Sbjct: 244 SGSDGYTYIWDVRSAASVQSFFVS--NSDVNTVKFFK-DGNSIVTGSDDGTLRMFDL 297

>Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON}
           YDR142C (REAL)
          Length = 376

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 288 IPNAHGDEVVRDVFISPKSQNIMYSCGEDGSVKTWK 323
           IPNAH +  VR V  SP   NI+ S   D + + WK
Sbjct: 278 IPNAH-ELAVRKVAWSPHHSNILMSASYDMTCRIWK 312

>KLTH0D12672g Chr4 (1039205..1040542) [1338 bp, 445 aa] {ON} similar
           to uniprot|P24521 Saccharomyces cerevisiae YMR220W ERG8
           Phosphomevalonate kinase an essential cytosolic enzyme
           that acts in the biosynthesis of isoprenoids and sterols
           including ergosterol from mevalonate
          Length = 445

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 36/84 (42%), Gaps = 21/84 (25%)

Query: 210 YTLSHMETFAIHELNNKSDELTE-----------PKPLDFGDIRGTWDCDYVVDVY--PG 256
           Y ++    F + EL+ + +   E           P P + GDI        +V+VY  PG
Sbjct: 67  YMIAGEAPFEVRELDGRKNPFAEKVVEVIMNYCQPSPTETGDI--------LVEVYSDPG 118

Query: 257 YIAVGKSEENNGNLKIIPFHNELL 280
           Y +VG S     + K   FH+E +
Sbjct: 119 YHSVGTSMLKRNSYKEFRFHDETI 142

>Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}
           similar to Ashbya gossypii AFL157C
          Length = 435

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 44/96 (45%), Gaps = 8/96 (8%)

Query: 132 IYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEEDALHQ 191
           I D+R    P+ + ++ H+  +  +++HPS PNVL +   D     +DL      D+L+ 
Sbjct: 323 ILDMRYPGSPI-LTLNGHYCALNQLRWHPSKPNVLATCGDDCQILYWDLL-----DSLNG 376

Query: 192 VINYESVHSCGWLSPKRIYTLS--HMETFAIHELNN 225
                 +    W S   ++ L    M   A +E+NN
Sbjct: 377 GTISSGIPQQRWTSTNTVHFLETPQMSYTAQNEVNN 412

>NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1311

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 29/63 (46%), Gaps = 3/63 (4%)

Query: 121 TELSGVDAEIHIYDIR---NFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNV 177
           T +     +I I+DI    N + P+   +  H   V    F+    N+++SG  DG   +
Sbjct: 189 TAICTTSTDISIFDISRNINIENPLLTSLSEHTRSVNSFDFNMVQSNLIISGGQDGCVKI 248

Query: 178 YDL 180
           +DL
Sbjct: 249 WDL 251

>NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON}
           Anc_1.295 YJL074C
          Length = 1227

 Score = 31.6 bits (70), Expect = 4.8,   Method: Composition-based stats.
 Identities = 24/89 (26%), Positives = 43/89 (48%), Gaps = 7/89 (7%)

Query: 264 EENNGNLKIIPFHNELLNINDSISIPNAHGD-EVVRDVFISPKSQNIMYSCGEDGSVKTW 322
           E +  N K+     ++ N+NDSI  PN  G+ EV++D     KS+   Y+   D   + W
Sbjct: 428 ERDEINSKVRSLDEDIDNLNDSIEGPNVTGELEVIQDELEKLKSE---YAASIDKRKELW 484

Query: 323 KIENNSLQVPPGFWDYSTQINVLDDNIDE 351
           +   N  ++     +    + VL+ N++E
Sbjct: 485 R---NEQKIETVLQNLLENVKVLERNVNE 510

>Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa]
           {ON} YDL195W (SEC31) - Component (p150) of COPII coat of
           secretory pathway vesicles [contig 161] FULL
          Length = 1296

 Score = 31.6 bits (70), Expect = 4.9,   Method: Composition-based stats.
 Identities = 37/179 (20%), Positives = 72/179 (40%), Gaps = 14/179 (7%)

Query: 17  WCLELQPLYRHGLLSSLSNGDVN----LLDWNTGNCIRTVKAGNTSIN-RMRVLDSDYDN 71
           W  E  PL   G  S   + D +    L  W+  +       G+ S + +   LD  YDN
Sbjct: 15  WSHERSPLLATGTASGTIDADFSSDSTLEIWSLLSPHEATPQGSVSADAKFNDLDWSYDN 74

Query: 72  GSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTELSGVDAEIH 131
            SV + A+++ V       +  SI     +      +  +++   + C     G   EI+
Sbjct: 75  -SVLTGALDNGVVEFFSPSEYKSIAKLAQHSTPVKTVRFNAKQHNVLCS---GGSKGEIY 130

Query: 132 IYDIRNFDKP-----VRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEE 185
           I+D    + P     V     +  D++  + ++ +  +V  S  + G+ +++DL   +E
Sbjct: 131 IWDANKIETPGYAPFVPGTAMTPMDEIYSLAWNQNQGHVFASAGSSGFASIWDLKAKKE 189

>Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar to
           Ashbya gossypii AGL196C
          Length = 937

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 2/32 (6%)

Query: 291 AHGDEVVRDVFISPKSQNIMYSCGEDGSVKTW 322
           AH D ++   F+ P+S N  +SCG+DG +K W
Sbjct: 608 AHQDAIMNVKFV-PQSHN-FFSCGKDGVIKYW 637

>KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.324
           YLR129W
          Length = 942

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 73/164 (44%), Gaps = 24/164 (14%)

Query: 29  LLSSLSNGDVNLLDWNTGNCIRTVKAG----------NTSINRMRVLDSDYDNGSVFSVA 78
           + S+L N  VN+ D  TG  I  ++ G          NT    +  L    D+ S+ +V 
Sbjct: 41  ITSALEN--VNIWDIKTGELIAQLQDGITPGSADSKVNTKPAEVTFLQYHPDS-SLLAVG 97

Query: 79  MNDA-VKVLDLRVQGNSIVAELNNEKKT-PFLSLDSRHGMLACGTELSGVDAEIHIYDIR 136
             D  +KV DL     +++  LN  K +   L  D     L  G+     D+ I I+D+ 
Sbjct: 98  YRDGNIKVWDLV--SKTVLINLNGHKSSITVLKFDVNCTRLVSGSS----DSNIIIWDLV 151

Query: 137 NFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDL 180
           +     ++   SH D ++D+ +   D N LLS S DG   V+DL
Sbjct: 152 SEVGICKL--RSHKDRISDL-YVDDDFNWLLSVSKDGLIKVWDL 192

>SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {ON}
           similar to uniprot|P18851 YOR212W Saccharomyces
           cerevisiae STE4 G protein beta subunit
          Length = 426

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 7/75 (9%)

Query: 106 PFLSLDSRHGMLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNV 165
           P     S   M A G    G D  ++++D R+        V     D++ ++F  SD N 
Sbjct: 227 PPAGTTSYDSMFASG----GSDGYVYLWDTRSPSSVQNFFVS--DSDISTVRFF-SDGNS 279

Query: 166 LLSGSTDGYTNVYDL 180
           +++GS DG   ++DL
Sbjct: 280 IITGSDDGIARLFDL 294

>TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9
           YEL056W
          Length = 392

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 73/197 (37%), Gaps = 36/197 (18%)

Query: 149 HHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEEDALHQVINYESVHS-----CGW 203
           H D+   + F+P D   LLSGS D    ++D+T     ++   V  +ES H      C W
Sbjct: 152 HEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITT----NSTKPVSTWESCHQDGVNDCKW 207

Query: 204 LSPKRIYTLSHMETFAIHELN-NKSDELTEPKPLDFGDIRGTWDCDYVVDVYPGYIAVGK 262
                            HELN N    ++E   L   D R        +     +  +  
Sbjct: 208 -----------------HELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAF 250

Query: 263 SEENNGNLKIIPFHNELLNINDSISIPN------AHGDEVVRDVFISPKSQNIMYSCGED 316
           S+ +  NL      + L+ + DS    N       H   V    F + K   I+ S GED
Sbjct: 251 SKHST-NLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAK-DGIVMSSGED 308

Query: 317 GSVKTWKI-ENNSLQVP 332
             V  W + E  + QVP
Sbjct: 309 RRVIMWDLMEIGAEQVP 325

>TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.324
           YLR129W
          Length = 936

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 21/29 (72%)

Query: 27  HGLLSSLSNGDVNLLDWNTGNCIRTVKAG 55
           + LL++ SNG++ + + NT +CIRT + G
Sbjct: 399 NALLATASNGELKIWNLNTKSCIRTFECG 427

>AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,
           334 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YMR116C (ASC1); 1-intron
          Length = 334

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%)

Query: 142 VRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEE 186
           +R  ++ H+  VT +   P+ PN+LLSGS D     + LT  +++
Sbjct: 25  LRGTLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQ 69

>Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON}
           complement(17489..19777) [2289 nt, 763 aa]
          Length = 762

 Score = 31.2 bits (69), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 86/211 (40%), Gaps = 23/211 (10%)

Query: 127 DAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEE 186
           D  I + D +   K   + +  H   V  +K+   +  +L+SGSTD    V+D   ++  
Sbjct: 407 DKMIRVIDAKK--KKFLLELSGHDGGVWALKY--DEDGILVSGSTDRTVRVWD---IKRG 459

Query: 187 DALHQVINYESVHSC----GWLSPKRIYTLSHMETFAIHELNNKSDELTE--PKPLDFGD 240
              H    + S   C     + + K I T S   T  + +L  +S    E    PL F  
Sbjct: 460 CCTHVFKGHTSTVRCLDIVEYKNVKYIVTGSRDNTLHVWKLPRESSSTGEDPSYPLYFNS 519

Query: 241 IRGTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNIND-----SISIPNAHGDE 295
                +  Y V +  G++A  ++   +GN+ I   ++  L + D      + I   H D 
Sbjct: 520 PE---ENPYFVGILRGHMASVRTVSGHGNIVISGSYDNNLMVWDIAQMKCLYILTGHTDR 576

Query: 296 VVRDVFISPKSQNIMYSCGEDGSVKTWKIEN 326
           +   ++   + + I  S   D S++ W +EN
Sbjct: 577 IYCTIYDHKRRRCI--SASMDSSIRIWNLEN 605

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.134    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,292,886
Number of extensions: 2135985
Number of successful extensions: 6795
Number of sequences better than 10.0: 409
Number of HSP's gapped: 6866
Number of HSP's successfully gapped: 474
Length of query: 388
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 277
Effective length of database: 40,753,473
Effective search space: 11288712021
Effective search space used: 11288712021
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 67 (30.4 bits)