Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Klac_YGOB_MFA1na 1ON33331675e-18
Kwal_YGOB_MFA1na 2ON33331172e-10
Sklu_YGOB_MFA2na 1ON33321139e-10
TBLA0B04930singletonON34341122e-09
Sklu_YGOB_MFA1na 3ON33331086e-09
ABL196Cna 3ON33321071e-08
Ecym_6479singletonON34321051e-08
Kthe_YGOB_MFA1na 2ON33331052e-08
TBLA0A01280singletonON34341026e-08
TBLA0J00550singletonON34331016e-08
NCAS0B05140singletonON34341016e-08
Ecym_4022na 3ON3434964e-07
Kpol_1039.70a2.114ON3333931e-06
TBLA0A02390singletonON3433931e-06
CAGL0C01919gsingletonON3434921e-06
NCAS0G021802.114ON3434922e-06
NDAI0K011702.114ON3434912e-06
NDAI0B044702.114ON3434912e-06
TPHA0I012802.114ON3434903e-06
TPHA0I01275na 4ON3434903e-06
Kpol_1039.70na 4ON3332895e-06
Kpol_1039.70bsingletonON3332895e-06
Smik_14.1822.114ON3838895e-06
TBLA0A01750singletonON3434887e-06
YNL145W (MFA2)2.114ON3838871e-05
NDAI0K01420singletonON3434861e-05
Skud_14.1872.114ON3838861e-05
Suva_14.1942.114ON3838843e-05
YDR461W (MFA1)na 5ON3636765e-04
Smik_4.739na 5ON3636756e-04
Skud_4.736na 5ON3636756e-04
KAFR0K02130singletonON3535748e-04
KAFR0F005802.114ON3535748e-04
TDEL0B047802.114ON3434730.002
Klac_YGOB_MFA2singletonON3233720.002
Suva_2.636na 5ON3636690.006
KNAG0F015502.114ON3639570.34
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Klac_YGOB_MFA1
         (33 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Klac_YGOB_MFA1 Chr5 complement(1149528..1149629) [102 bp, 33 aa]...    69   5e-18
Kwal_YGOB_MFA1 s56 complement(511414..511515) [102 bp, 33 aa] {O...    50   2e-10
Sklu_YGOB_MFA2 Chr5 (1220858..1220959) [102 bp, 33 aa] {ON} ANNO...    48   9e-10
TBLA0B04930 Chr2 complement(1161014..1161118) [105 bp, 34 aa] {O...    48   2e-09
Sklu_YGOB_MFA1 Chr5 (1176933..1177034) [102 bp, 33 aa] {ON} ANNO...    46   6e-09
ABL196C Chr2 complement(40215..40316) [102 bp, 33 aa] {ON} Non-s...    46   1e-08
Ecym_6479 Chr6 (928035..928139) [105 bp, 34 aa] {ON} similar to ...    45   1e-08
Kthe_YGOB_MFA1 Chr7 (1301790..1301891) [102 bp, 33 aa] {ON} ANNO...    45   2e-08
TBLA0A01280 Chr1 (304900..305004) [105 bp, 34 aa] {ON}                 44   6e-08
TBLA0J00550 Chr10 complement(109603..109707) [105 bp, 34 aa] {ON}      44   6e-08
NCAS0B05140 Chr2 complement(956459..956563) [105 bp, 34 aa] {ON}       44   6e-08
Ecym_4022 Chr4 complement(55499..55603) [105 bp, 34 aa] {ON} sim...    42   4e-07
Kpol_1039.70a s1039 complement(187909..188010) [102 bp, 33 aa] {...    40   1e-06
TBLA0A02390 Chr1 (573085..573189) [105 bp, 34 aa] {ON}                 40   1e-06
CAGL0C01919g Chr3 complement(202384..202488) [105 bp, 34 aa] {ON...    40   1e-06
NCAS0G02180 Chr7 complement(390421..390525) [105 bp, 34 aa] {ON}       40   2e-06
NDAI0K01170 Chr11 (269630..269734) [105 bp, 34 aa] {ON}                40   2e-06
NDAI0B04470 Chr2 (1118223..1118327) [105 bp, 34 aa] {ON}               40   2e-06
TPHA0I01280 Chr9 complement(292074..292178) [105 bp, 34 aa] {ON}...    39   3e-06
TPHA0I01275 Chr9 complement(290869..290973) [105 bp, 34 aa] {ON}       39   3e-06
Kpol_1039.70 s1039 complement(186672..186773) [102 bp, 33 aa] {O...    39   5e-06
Kpol_1039.70b s1039 complement(189037..189138) [102 bp, 33 aa] {...    39   5e-06
Smik_14.182 Chr14 (331978..332091) [114 bp, 38 aa] {ON} YNL145W ...    39   5e-06
TBLA0A01750 Chr1 (425269..425373) [105 bp, 34 aa] {ON}                 39   7e-06
YNL145W Chr14 (352414..352530) [117 bp, 38 aa] {ON}  MFA2Mating ...    38   1e-05
NDAI0K01420 Chr11 (325279..325383) [105 bp, 34 aa] {ON}                38   1e-05
Skud_14.187 Chr14 (342672..342785) [114 bp, 38 aa] {ON} YNL145W ...    38   1e-05
Suva_14.194 Chr14 (349190..349303) [114 bp, 38 aa] {ON} YNL145W ...    37   3e-05
YDR461W Chr4 (1385176..1385286) [111 bp, 36 aa] {ON}  MFA1Mating...    34   5e-04
Smik_4.739 Chr4 (1306426..1306533) [108 bp, 36 aa] {ON} YDR461W ...    33   6e-04
Skud_4.736 Chr4 (1305258..1305365) [108 bp, 36 aa] {ON} YDR461W ...    33   6e-04
KAFR0K02130 Chr11 complement(438634..438741) [108 bp, 35 aa] {ON}      33   8e-04
KAFR0F00580 Chr6 complement(119048..119155) [108 bp, 35 aa] {ON}...    33   8e-04
TDEL0B04780 Chr2 complement(846043..846147) [105 bp, 34 aa] {ON}...    33   0.002
Klac_YGOB_MFA2 Chr3 (1339261..1339359) [99 bp, 32 aa] {ON} ANNOT...    32   0.002
Suva_2.636 Chr2 (1137378..1137485) [108 bp, 36 aa] {ON} YDR461W ...    31   0.006
KNAG0F01550 Chr6 complement(279169..279279) [111 bp, 36 aa] {ON}...    27   0.34 

>Klac_YGOB_MFA1 Chr5 complement(1149528..1149629) [102 bp, 33 aa]
          {ON} ANNOTATED BY YGOB - similar to Scer MFA1 pheromone
          Length = 33

 Score = 68.9 bits (167), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%)

Query: 1  MQPTQQASQNESAENKENWIIPGFVWVPQCVVA 33
          MQPTQQASQNESAENKENWIIPGFVWVPQCVVA
Sbjct: 1  MQPTQQASQNESAENKENWIIPGFVWVPQCVVA 33

>Kwal_YGOB_MFA1 s56 complement(511414..511515) [102 bp, 33 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 33

 Score = 49.7 bits (117), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 20/33 (60%), Positives = 26/33 (78%)

Query: 1  MQPTQQASQNESAENKENWIIPGFVWVPQCVVA 33
          MQP  QA+QN+S++NK+NWI  G  W PQCV+A
Sbjct: 1  MQPIAQATQNDSSDNKDNWIHKGLAWDPQCVIA 33

>Sklu_YGOB_MFA2 Chr5 (1220858..1220959) [102 bp, 33 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 33

 Score = 48.1 bits (113), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 20/32 (62%), Positives = 24/32 (75%)

Query: 1  MQPTQQASQNESAENKENWIIPGFVWVPQCVV 32
          MQP   A+Q +SAENK+NWII G  W PQCV+
Sbjct: 1  MQPKSNATQKDSAENKDNWIIEGLAWNPQCVI 32

>TBLA0B04930 Chr2 complement(1161014..1161118) [105 bp, 34 aa]
          {ON} 
          Length = 34

 Score = 47.8 bits (112), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 21/34 (61%), Positives = 27/34 (79%), Gaps = 1/34 (2%)

Query: 1  MQPTQQASQNE-SAENKENWIIPGFVWVPQCVVA 33
          MQPT QA+Q E S+ENK+N+IIPG  W P C++A
Sbjct: 1  MQPTTQATQKENSSENKDNYIIPGLFWDPACIIA 34

>Sklu_YGOB_MFA1 Chr5 (1176933..1177034) [102 bp, 33 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 33

 Score = 46.2 bits (108), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 23/33 (69%)

Query: 1  MQPTQQASQNESAENKENWIIPGFVWVPQCVVA 33
          M+    A+Q  S E+KENWII GF W PQC++A
Sbjct: 1  MKAATHATQKGSTEDKENWIIKGFAWDPQCIIA 33

>ABL196C Chr2 complement(40215..40316) [102 bp, 33 aa] {ON}
          Non-syntenic homolog of Saccharomyces cerevisiae
          YNL145W (MFA2)
          Length = 33

 Score = 45.8 bits (107), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 24/32 (75%)

Query: 1  MQPTQQASQNESAENKENWIIPGFVWVPQCVV 32
          MQ T   +++ES ENK+NWI  G++W PQCV+
Sbjct: 1  MQLTNNTNKDESTENKDNWIAKGYMWTPQCVI 32

>Ecym_6479 Chr6 (928035..928139) [105 bp, 34 aa] {ON} similar to
          Ashbya gossypii ABL196C
          Length = 34

 Score = 45.1 bits (105), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 25/32 (78%)

Query: 2  QPTQQASQNESAENKENWIIPGFVWVPQCVVA 33
          Q ++  +QN  +ENK++WII GFVW PQCV+A
Sbjct: 3  QHSKDGNQNGESENKDHWIIKGFVWNPQCVIA 34

>Kthe_YGOB_MFA1 Chr7 (1301790..1301891) [102 bp, 33 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 33

 Score = 45.1 bits (105), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 19/33 (57%), Positives = 24/33 (72%)

Query: 1  MQPTQQASQNESAENKENWIIPGFVWVPQCVVA 33
          M P  QA+Q +S+ENK+NWI  G  W PQCV+A
Sbjct: 1  MPPITQATQKDSSENKDNWIQKGLAWDPQCVIA 33

>TBLA0A01280 Chr1 (304900..305004) [105 bp, 34 aa] {ON} 
          Length = 34

 Score = 43.9 bits (102), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 26/34 (76%), Gaps = 1/34 (2%)

Query: 1  MQPTQQASQNE-SAENKENWIIPGFVWVPQCVVA 33
          MQ T QA+Q + S+ENK+N+I+PG  W P C++A
Sbjct: 1  MQSTTQATQKDNSSENKDNYIVPGLFWDPACIIA 34

>TBLA0J00550 Chr10 complement(109603..109707) [105 bp, 34 aa] {ON}
          
          Length = 34

 Score = 43.5 bits (101), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 26/33 (78%), Gaps = 1/33 (3%)

Query: 1  MQPTQQASQNE-SAENKENWIIPGFVWVPQCVV 32
          MQPT QA++ + S+ENK+N+I+PG  W P C++
Sbjct: 1  MQPTTQATRKDNSSENKDNYIVPGLFWDPACII 33

>NCAS0B05140 Chr2 complement(956459..956563) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 43.5 bits (101), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 26/34 (76%), Gaps = 1/34 (2%)

Query: 1  MQPTQQASQNE-SAENKENWIIPGFVWVPQCVVA 33
          MQP+ QASQ + +AENK+N+I+ G  W P CV+A
Sbjct: 1  MQPSAQASQKDNTAENKDNYIVKGLFWDPACVIA 34

>Ecym_4022 Chr4 complement(55499..55603) [105 bp, 34 aa] {ON}
          similar to Ashbya gossypii ABL196C MFa2
          Length = 34

 Score = 41.6 bits (96), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 24/34 (70%), Gaps = 1/34 (2%)

Query: 1  MQPTQQASQ-NESAENKENWIIPGFVWVPQCVVA 33
          MQP   ASQ N  ++ K+NWI+ G+ W PQCV+A
Sbjct: 1  MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34

>Kpol_1039.70a s1039 complement(187909..188010) [102 bp, 33 aa]
          {ON} complement(187909..188010) [102 nt, 34 aa]
          Length = 33

 Score = 40.4 bits (93), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (72%)

Query: 1  MQPTQQASQNESAENKENWIIPGFVWVPQCVVA 33
          MQ T  A+Q  S+E K+N+I+ G+ W P+CV+A
Sbjct: 1  MQSTTYAAQKNSSEKKDNYIVKGWFWDPECVIA 33

>TBLA0A02390 Chr1 (573085..573189) [105 bp, 34 aa] {ON} 
          Length = 34

 Score = 40.4 bits (93), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 1  MQPTQQASQNE-SAENKENWIIPGFVWVPQCVV 32
          MQ   QA Q E S+ENK+N+IIPG  W P C++
Sbjct: 1  MQYNAQAGQKETSSENKDNYIIPGLFWDPACII 33

>CAGL0C01919g Chr3 complement(202384..202488) [105 bp, 34 aa] {ON}
          highly similar to uniprot|P34166 Saccharomyces
          cerevisiae YNL145w MFA2
          Length = 34

 Score = 40.0 bits (92), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 25/34 (73%), Gaps = 1/34 (2%)

Query: 1  MQPTQQASQNESA-ENKENWIIPGFVWVPQCVVA 33
          MQPT +A+Q ++  E ++N+I+ GF W P CV+A
Sbjct: 1  MQPTIEATQKDNTQEKRDNYIVKGFFWSPDCVIA 34

>NCAS0G02180 Chr7 complement(390421..390525) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 40.0 bits (92), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 24/34 (70%), Gaps = 1/34 (2%)

Query: 1  MQPTQQASQNE-SAENKENWIIPGFVWVPQCVVA 33
          MQPT QA+  + SAE ++N+I+ G  W P CV+A
Sbjct: 1  MQPTTQATHKDNSAEKQDNYIVKGLFWDPACVIA 34

>NDAI0K01170 Chr11 (269630..269734) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 39.7 bits (91), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 25/34 (73%), Gaps = 1/34 (2%)

Query: 1  MQPTQQASQNE-SAENKENWIIPGFVWVPQCVVA 33
          MQP+ QA++ + S+E K+N+I+ G  W P CV+A
Sbjct: 1  MQPSTQATKKDNSSEKKDNYIVKGLFWDPACVIA 34

>NDAI0B04470 Chr2 (1118223..1118327) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 39.7 bits (91), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 25/34 (73%), Gaps = 1/34 (2%)

Query: 1  MQPTQQASQNE-SAENKENWIIPGFVWVPQCVVA 33
          MQP+ QA++ + S+E K+N+I+ G  W P CV+A
Sbjct: 1  MQPSTQATKKDNSSEKKDNYIVKGLFWDPACVIA 34

>TPHA0I01280 Chr9 complement(292074..292178) [105 bp, 34 aa] {ON}
          Anc_2.114 YNL145W
          Length = 34

 Score = 39.3 bits (90), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 25/34 (73%), Gaps = 1/34 (2%)

Query: 1  MQPTQQA-SQNESAENKENWIIPGFVWVPQCVVA 33
          MQPT QA  ++ ++E K+N+I+ G  W P+CV+A
Sbjct: 1  MQPTTQAIKKDTTSEKKDNYIVKGVFWDPECVIA 34

>TPHA0I01275 Chr9 complement(290869..290973) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 39.3 bits (90), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 25/34 (73%), Gaps = 1/34 (2%)

Query: 1  MQPTQQA-SQNESAENKENWIIPGFVWVPQCVVA 33
          MQPT QA  ++ ++E K+N+I+ G  W P+CV+A
Sbjct: 1  MQPTTQAIKKDTTSEKKDNYIVKGVFWDPECVIA 34

>Kpol_1039.70 s1039 complement(186672..186773) [102 bp, 33 aa]
          {ON} complement(186672..186773) [102 nt, 34 aa]
          Length = 33

 Score = 38.9 bits (89), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 23/32 (71%)

Query: 1  MQPTQQASQNESAENKENWIIPGFVWVPQCVV 32
          MQ T  A+Q  S+E K+N+I+ G+ W P+CV+
Sbjct: 1  MQSTTYAAQKNSSEKKDNYIVKGWFWDPECVI 32

>Kpol_1039.70b s1039 complement(189037..189138) [102 bp, 33 aa]
          {ON} complement(189037..189138) [102 nt, 34 aa]
          Length = 33

 Score = 38.9 bits (89), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 23/32 (71%)

Query: 1  MQPTQQASQNESAENKENWIIPGFVWVPQCVV 32
          MQ T  A+Q  S+E K+N+I+ G+ W P+CV+
Sbjct: 1  MQSTTYAAQKNSSEKKDNYIVKGWFWDPECVI 32

>Smik_14.182 Chr14 (331978..332091) [114 bp, 38 aa] {ON} YNL145W
          (REAL)
          Length = 38

 Score = 38.9 bits (89), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 5/38 (13%)

Query: 1  MQP-----TQQASQNESAENKENWIIPGFVWVPQCVVA 33
          MQP      Q A +N+S+E K+N+II G  W P CV+A
Sbjct: 1  MQPITTTSAQAAQKNKSSEKKDNYIIKGLFWDPACVIA 38

>TBLA0A01750 Chr1 (425269..425373) [105 bp, 34 aa] {ON} 
          Length = 34

 Score = 38.5 bits (88), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 23/34 (67%), Gaps = 1/34 (2%)

Query: 1  MQPTQQASQNE-SAENKENWIIPGFVWVPQCVVA 33
          MQ   Q +Q E S+ENK+N+IIPG  W P C++ 
Sbjct: 1  MQYNIQTTQKENSSENKDNYIIPGLFWDPACIIV 34

>YNL145W Chr14 (352414..352530) [117 bp, 38 aa] {ON}  MFA2Mating
          pheromone a-factor, made by a cells; interacts with
          alpha cells to induce cell cycle arrest and other
          responses leading to mating; biogenesis involves
          C-terminal modification, N-terminal proteolysis, and
          export; also encoded by MFA1
          Length = 38

 Score = 38.1 bits (87), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 24/38 (63%), Gaps = 5/38 (13%)

Query: 1  MQP-----TQQASQNESAENKENWIIPGFVWVPQCVVA 33
          MQP     TQ   +++S+E K+N+II G  W P CV+A
Sbjct: 1  MQPITTASTQATQKDKSSEKKDNYIIKGLFWDPACVIA 38

>NDAI0K01420 Chr11 (325279..325383) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 37.7 bits (86), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 25/34 (73%), Gaps = 1/34 (2%)

Query: 1  MQPTQQASQNESA-ENKENWIIPGFVWVPQCVVA 33
          MQP+ +A++ +S+ E ++N+I+ G  W P CV+A
Sbjct: 1  MQPSTEATKKDSSFEKRDNYIVKGLFWDPACVIA 34

>Skud_14.187 Chr14 (342672..342785) [114 bp, 38 aa] {ON} YNL145W
          (REAL)
          Length = 38

 Score = 37.7 bits (86), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 25/38 (65%), Gaps = 5/38 (13%)

Query: 1  MQPTQ----QASQ-NESAENKENWIIPGFVWVPQCVVA 33
          MQPT     QASQ + S+E K+N+II G  W P CV+A
Sbjct: 1  MQPTATVSAQASQKDRSSEKKDNFIIKGLFWDPACVIA 38

>Suva_14.194 Chr14 (349190..349303) [114 bp, 38 aa] {ON} YNL145W
          (REAL)
          Length = 38

 Score = 37.0 bits (84), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 5/38 (13%)

Query: 1  MQP----TQQASQ-NESAENKENWIIPGFVWVPQCVVA 33
          MQP    + QASQ ++S+E K+N+II G  W P CV+A
Sbjct: 1  MQPVATVSAQASQKDKSSEKKDNYIIKGLFWDPACVIA 38

>YDR461W Chr4 (1385176..1385286) [111 bp, 36 aa] {ON}  MFA1Mating
          pheromone a-factor, made by a cells; interacts with
          alpha cells to induce cell cycle arrest and other
          responses leading to mating; biogenesis involves
          C-terminal modification, N-terminal proteolysis, and
          export; also encoded by MFA2
          Length = 36

 Score = 33.9 bits (76), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 3/36 (8%)

Query: 1  MQP---TQQASQNESAENKENWIIPGFVWVPQCVVA 33
          MQP   T    +  S+E K+N+II G  W P CV+A
Sbjct: 1  MQPSTATAAPKEKTSSEKKDNYIIKGVFWDPACVIA 36

>Smik_4.739 Chr4 (1306426..1306533) [108 bp, 36 aa] {ON} YDR461W
          (REAL)
          Length = 36

 Score = 33.5 bits (75), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 1  MQP---TQQASQNESAENKENWIIPGFVWVPQCVVA 33
          MQP   T       + ENK+N+II G  W P CV+A
Sbjct: 1  MQPSTITAAPKDKTNTENKDNYIIKGVFWDPACVIA 36

>Skud_4.736 Chr4 (1305258..1305365) [108 bp, 36 aa] {ON} YDR461W
          (REAL)
          Length = 36

 Score = 33.5 bits (75), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 1  MQP---TQQASQNESAENKENWIIPGFVWVPQCVVA 33
          MQP   T       S+E K+N+II G  W P CV+A
Sbjct: 1  MQPSTITAAPKDKTSSEKKDNYIIKGVFWDPACVIA 36

>KAFR0K02130 Chr11 complement(438634..438741) [108 bp, 35 aa] {ON}
          
          Length = 35

 Score = 33.1 bits (74), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 24/35 (68%), Gaps = 2/35 (5%)

Query: 1  MQPTQQAS--QNESAENKENWIIPGFVWVPQCVVA 33
          MQPT  ++  ++ S+E K+N+++   VW P CV+A
Sbjct: 1  MQPTSTSATQKDNSSEKKDNYMVSSGVWDPVCVIA 35

>KAFR0F00580 Chr6 complement(119048..119155) [108 bp, 35 aa] {ON}
          Anc_2.114 YNL145W
          Length = 35

 Score = 33.1 bits (74), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 24/35 (68%), Gaps = 2/35 (5%)

Query: 1  MQPTQQAS--QNESAENKENWIIPGFVWVPQCVVA 33
          MQPT  ++  ++ S+E K+N+++   VW P CV+A
Sbjct: 1  MQPTSTSATQKDNSSEKKDNYMVSSGVWDPVCVIA 35

>TDEL0B04780 Chr2 complement(846043..846147) [105 bp, 34 aa] {ON}
          Anc_2.114 YNL145W
          Length = 34

 Score = 32.7 bits (73), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 1/34 (2%)

Query: 1  MQPTQQASQNE-SAENKENWIIPGFVWVPQCVVA 33
          MQPT QA++ + S+E K+N+++ G      CV+A
Sbjct: 1  MQPTTQATKKDTSSEKKDNFMLGGSTSYYGCVIA 34

>Klac_YGOB_MFA2 Chr3 (1339261..1339359) [99 bp, 32 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 32

 Score = 32.3 bits (72), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 1  MQPTQQASQNESAENKENWIIPGFVWVPQCVVA 33
          M+   QA Q  + E+ ++W+ PG  W P+C+++
Sbjct: 1  MEDKAQA-QTRTHESSDHWVFPGLTWNPKCIIS 32

>Suva_2.636 Chr2 (1137378..1137485) [108 bp, 36 aa] {ON} YDR461W
          (REAL)
          Length = 36

 Score = 31.2 bits (69), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 4/36 (11%)

Query: 1  MQPTQQAS----QNESAENKENWIIPGFVWVPQCVV 32
          MQP    S       S E K+N+II G  W P C++
Sbjct: 1  MQPITTVSAAPKDKTSTEKKDNYIIKGVFWDPACII 36

>KNAG0F01550 Chr6 complement(279169..279279) [111 bp, 36 aa] {ON}
          Anc_2.114 YNL145W
          Length = 36

 Score = 26.6 bits (57), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 9/39 (23%)

Query: 1  MQP-----TQQASQNESAENKENWIIPGFVWVPQ-CVVA 33
          MQP     T  A +++S ENK+NW +P   W+   CV+A
Sbjct: 1  MQPINTVSTSAAEKSKSGENKDNWRLP---WITTGCVIA 36

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.125    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 3,697,565
Number of extensions: 58654
Number of successful extensions: 140
Number of sequences better than 10.0: 37
Number of HSP's gapped: 140
Number of HSP's successfully gapped: 37
Length of query: 33
Length of database: 53,481,399
Length adjustment: 8
Effective length of query: 25
Effective length of database: 52,564,071
Effective search space: 1314101775
Effective search space used: 1314101775
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 59 (27.3 bits)