Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Klac_YGOB_Anc_6.66.6ON61613071e-38
Sklu_YGOB_Anc_6.66.6ON61612508e-30
Kpol_1045.826.6ON62622152e-24
TDEL0G046506.6ON62622143e-24
Kwal_56.223336.6ON62622091e-23
Kthe_YGOB_Anc_6.66.6ON62612022e-22
TPHA0J002306.6ON62601925e-21
NDAI0I027406.6ON66591883e-20
ZYRO0F00418g6.6ON62601874e-20
Skud_16.66.6ON62621856e-20
Suva_16.346.6ON62621771e-18
Smik_6.4796.6ON62621762e-18
TBLA0A072006.6ON65621726e-18
YPL271W (ATP15)6.6ON62621711e-17
Ecym_30086.6ON61611665e-17
CAGL0A01111g6.6ON69611613e-16
NCAS0D022006.6ON85601493e-14
KAFR0B064906.6ON66611474e-14
ACR021W6.6ON62621431e-13
KNAG0E027906.6ON65591423e-13
AGL147C8.368ON189638592.0
Ecym_52703.139ON14243573.6
CAGL0A01848g5.400ON93435573.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Klac_YGOB_Anc_6.6
         (61 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa] ...   122   1e-38
Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa] ...   100   8e-30
Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON} (192423...    87   2e-24
TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6 Y...    87   3e-24
Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON} ...    85   1e-23
Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON} ANN...    82   2e-22
TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON} ...    79   5e-21
NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}...    77   3e-20
ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON} ...    77   4e-20
Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)       76   6e-20
Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W (REAL)    73   1e-18
Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON} ...    72   2e-18
TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa] {O...    71   6e-18
YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon ...    70   1e-17
Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON} sim...    69   5e-17
CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly s...    67   3e-16
NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6 Y...    62   3e-14
KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa] {O...    61   4e-14
ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic homo...    60   1e-13
KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6 Y...    59   3e-13
AGL147C Chr7 complement(420751..426441) [5691 bp, 1896 aa] {ON} ...    27   2.0  
Ecym_5270 Chr5 complement(555591..556019) [429 bp, 142 aa] {ON} ...    27   3.6  
CAGL0A01848g Chr1 complement(187900..190704) [2805 bp, 934 aa] {...    27   3.7  

>Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score =  122 bits (307), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 61/61 (100%), Positives = 61/61 (100%)

Query: 1  MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENGVASEPVPLK 60
          MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENGVASEPVPLK
Sbjct: 1  MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENGVASEPVPLK 60

Query: 61 K 61
          K
Sbjct: 61 K 61

>Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score =  100 bits (250), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 53/61 (86%)

Query: 1  MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENGVASEPVPLK 60
          MS WRKAGLT+NNY+S+AA TVRAALK E QT  VL+RSKSEAKFIKFENG  S+P+PLK
Sbjct: 1  MSAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGTPSDPIPLK 60

Query: 61 K 61
          K
Sbjct: 61 K 61

>Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON}
          (192423..192611) [189 nt, 63 aa]
          Length = 62

 Score = 87.4 bits (215), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (83%), Gaps = 1/62 (1%)

Query: 1  MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENGV-ASEPVPL 59
          MS WRKAG+T+N YV++AA TVR ALK EL+TN+VLARSK+EAKF+ FENG    EPVP+
Sbjct: 1  MSAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPI 60

Query: 60 KK 61
          ++
Sbjct: 61 QQ 62

>TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6
          YPL271W
          Length = 62

 Score = 87.0 bits (214), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 40/62 (64%), Positives = 52/62 (83%), Gaps = 1/62 (1%)

Query: 1  MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENG-VASEPVPL 59
          M+ WRKAGLT+N Y+SVAA TVRAALKPELQ   VLARSK++A+++K+E G  AS+ VPL
Sbjct: 1  MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPL 60

Query: 60 KK 61
          ++
Sbjct: 61 QE 62

>Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON}
          YPL271W (ATP15) - nuclear gene for ATP synthase epsilon
          subunit [contig 186] FULL
          Length = 62

 Score = 85.1 bits (209), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 40/62 (64%), Positives = 51/62 (82%), Gaps = 1/62 (1%)

Query: 1  MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENGVAS-EPVPL 59
          MS WRKAGLT+NNY+++AA TVR+ALK E QT  VL RSK+EA+F+K+ENG A+ E  PL
Sbjct: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPL 60

Query: 60 KK 61
          K+
Sbjct: 61 KE 62

>Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 62

 Score = 82.4 bits (202), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 39/61 (63%), Positives = 49/61 (80%), Gaps = 1/61 (1%)

Query: 1  MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENGV-ASEPVPL 59
          MS WRKAGLT+NNY+++AA TVR+ALK +LQT  VL RSK+EA+FIK+E G   +E  PL
Sbjct: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPL 60

Query: 60 K 60
          K
Sbjct: 61 K 61

>TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON}
          Anc_6.6 YPL271W
          Length = 62

 Score = 78.6 bits (192), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 37/60 (61%), Positives = 49/60 (81%), Gaps = 1/60 (1%)

Query: 1  MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENGVA-SEPVPL 59
          MSTWRKAGLT++NY++VAA TVR +LK +L+TNSVL+RSK++ K+  FE G A SEP  +
Sbjct: 1  MSTWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSI 60

>NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}
          Anc_6.6 YPL271W
          Length = 66

 Score = 77.0 bits (188), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 49/59 (83%), Gaps = 1/59 (1%)

Query: 4  WRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENGV-ASEPVPLKK 61
          WRKAG+T++ Y+S+AA T+RAALKPELQT +V+ARS ++A F K+++G  ASEP  L+K
Sbjct: 7  WRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESLQK 65

>ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON}
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271W ATP15 Epsilon subunit of the F1 sector of
          mitochondrial F1F0 ATP synthase which is a large
          evolutionarily conserved enzyme complex required for
          ATP synthesis
          Length = 62

 Score = 76.6 bits (187), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 37/60 (61%), Positives = 46/60 (76%), Gaps = 1/60 (1%)

Query: 1  MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENG-VASEPVPL 59
          MS WRKAGLT+N Y+SVAA TVR+ALKPE QT +VL+R + ++K+ KFE G    EP PL
Sbjct: 1  MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60

>Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)
          Length = 62

 Score = 75.9 bits (185), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 50/62 (80%), Gaps = 1/62 (1%)

Query: 1  MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENG-VASEPVPL 59
          MS WRKAG+++  Y++VAA T+R++LK ELQT SVL+RSK++A + K++NG  ASEP P+
Sbjct: 1  MSAWRKAGISYAAYLNVAAQTIRSSLKTELQTASVLSRSKTDAFYTKYKNGAAASEPTPI 60

Query: 60 KK 61
           K
Sbjct: 61 TK 62

>Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W
          (REAL)
          Length = 62

 Score = 72.8 bits (177), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 50/62 (80%), Gaps = 1/62 (1%)

Query: 1  MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENGV-ASEPVPL 59
          MS WRKAG+++  Y++VAA T+R++LK ELQT +VL+RS+++A + K++NG  ASEPV +
Sbjct: 1  MSAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVSI 60

Query: 60 KK 61
           K
Sbjct: 61 TK 62

>Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON}
          YPL271W (REAL)
          Length = 62

 Score = 72.4 bits (176), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 49/62 (79%), Gaps = 1/62 (1%)

Query: 1  MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENG-VASEPVPL 59
          MS WRKAG+++  Y++VAA  +R++LK ELQT SVL+RSK++A + +++NG  ASEP P+
Sbjct: 1  MSAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPI 60

Query: 60 KK 61
           K
Sbjct: 61 TK 62

>TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa]
          {ON} Anc_6.6 YPL271W
          Length = 65

 Score = 70.9 bits (172), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 34/62 (54%), Positives = 47/62 (75%), Gaps = 1/62 (1%)

Query: 1  MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENGVA-SEPVPL 59
          MS WRKAG+T+N Y+++AA TVR ALKPELQT +V+ RS +EA+F K+  G   ++P  L
Sbjct: 1  MSAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADPALL 60

Query: 60 KK 61
          K+
Sbjct: 61 KE 62

>YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon
          subunit of the F1 sector of mitochondrial F1F0 ATP
          synthase, which is a large, evolutionarily conserved
          enzyme complex required for ATP synthesis;
          phosphorylated
          Length = 62

 Score = 70.5 bits (171), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 32/62 (51%), Positives = 48/62 (77%), Gaps = 1/62 (1%)

Query: 1  MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENGV-ASEPVPL 59
          MS WRKAG+++  Y++VAA  +R++LK ELQT SVL RS+++A + +++NG  ASEP P+
Sbjct: 1  MSAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPI 60

Query: 60 KK 61
           K
Sbjct: 61 TK 62

>Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON}
          similar to Ashbya gossypii ACR021W
          Length = 61

 Score = 68.6 bits (166), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 37/61 (60%), Positives = 50/61 (81%)

Query: 1  MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENGVASEPVPLK 60
          MS WRKAGL++N Y++VAA  VR+ALKPEL+  +VL+RS +EAK I +++G AS+ VPLK
Sbjct: 1  MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDGAASDAVPLK 60

Query: 61 K 61
          K
Sbjct: 61 K 61

>CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271w ATP15
          Length = 69

 Score = 66.6 bits (161), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 48/61 (78%), Gaps = 1/61 (1%)

Query: 2  STWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENGVA-SEPVPLK 60
          + WRKAGL++++++++AA TVR +LK ELQT +V+ R K++A + K+E G   S+P+PL+
Sbjct: 9  TAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPLQ 68

Query: 61 K 61
          +
Sbjct: 69 E 69

>NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6
          YPL271W
          Length = 85

 Score = 62.0 bits (149), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 44/60 (73%), Gaps = 1/60 (1%)

Query: 2  STWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENGVA-SEPVPLK 60
          +T RKAG+T+  Y+ VA+ T+RA+LK ELQT  V+ARS ++A + K+E G   ++P PL+
Sbjct: 22 ATLRKAGVTYAQYLCVASRTLRASLKTELQTPVVMARSNTDAYYTKYEKGSPIADPAPLQ 81

>KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa]
          {ON} Anc_6.6 YPL271W
          Length = 66

 Score = 61.2 bits (147), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 43/61 (70%), Gaps = 1/61 (1%)

Query: 2  STWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENGVA-SEPVPLK 60
          S WRKAGLT+ +Y+S+A+ T+R  LK E QT +V +RS +EA    ++NG   S+P PL+
Sbjct: 3  SVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPLQ 62

Query: 61 K 61
          K
Sbjct: 63 K 63

>ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YPL271W (ATP15)
          Length = 62

 Score = 59.7 bits (143), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/62 (62%), Positives = 50/62 (80%), Gaps = 1/62 (1%)

Query: 1  MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFEN-GVASEPVPL 59
          MS WRKAGLT+N+Y++VAA TVRAALK ELQ+ +VL RS +EAK I + + G A+E VPL
Sbjct: 1  MSAWRKAGLTYNSYLAVAARTVRAALKKELQSPAVLNRSVTEAKVIDYASKGSAAEAVPL 60

Query: 60 KK 61
          +K
Sbjct: 61 RK 62

>KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6
          YPL271W
          Length = 65

 Score = 59.3 bits (142), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 43/59 (72%), Gaps = 1/59 (1%)

Query: 4  WRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENGVA-SEPVPLKK 61
          W+KAG+T+  Y++V A T+R+ALK ELQT +VL+R  ++A +  +E G   ++P PL++
Sbjct: 5  WKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQPLQE 63

>AGL147C Chr7 complement(420751..426441) [5691 bp, 1896 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDR170C
            (SEC7)
          Length = 1896

 Score = 27.3 bits (59), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 23/38 (60%)

Query: 10   TFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIK 47
             F N++ V + T+++  KP L++  + ARS  E+  +K
Sbjct: 1340 CFRNFILVKSTTLKSGWKPILESLQLCARSSKESIVLK 1377

>Ecym_5270 Chr5 complement(555591..556019) [429 bp, 142 aa] {ON}
           similar to Ashbya gossypii AER205W
          Length = 142

 Score = 26.6 bits (57), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 22/43 (51%)

Query: 14  YVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENGVASEP 56
           Y+++  NT+R  + P+     VL   K+E   +K    V ++P
Sbjct: 80  YINIRGNTIRQIILPDSLNLDVLLVDKNEVSRLKRAGKVTNDP 122

>CAGL0A01848g Chr1 complement(187900..190704) [2805 bp, 934 aa] {ON}
           similar to uniprot|P38810 Saccharomyces cerevisiae
           YHR098c SFB3
          Length = 934

 Score = 26.6 bits (57), Expect = 3.7,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 20/35 (57%)

Query: 26  LKPELQTNSVLARSKSEAKFIKFENGVASEPVPLK 60
           LKPEL+T      S+ +  F+ F NG+ ++P   K
Sbjct: 356 LKPELETAQEYVISELDDVFLPFYNGLFADPAESK 390

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.123    0.336 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 5,705,960
Number of extensions: 145767
Number of successful extensions: 333
Number of sequences better than 10.0: 24
Number of HSP's gapped: 333
Number of HSP's successfully gapped: 24
Length of query: 61
Length of database: 53,481,399
Length adjustment: 34
Effective length of query: 27
Effective length of database: 49,582,755
Effective search space: 1338734385
Effective search space used: 1338734385
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 59 (27.3 bits)