Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0M012505.122ON56356328560.0
KAFR0E020205.122ON56456324200.0
CAGL0M07920g5.122ON56456323970.0
TDEL0E050805.122ON56356223800.0
NDAI0C031105.122ON56456323470.0
NDAI0A01400na 1ON56356223390.0
NCAS0D016605.122ON56456323300.0
KAFR0E01520singletonON56356323280.0
YLR044C (PDC1)5.122ON56356323220.0
Smik_12.1065.122ON56356323180.0
Suva_10.1285.122ON56356323150.0
ACL134C5.122ON58656323130.0
Kpol_1010.485.122ON56356323130.0
SAKL0G10164gna 2ON56456323090.0
ZYRO0F01606g5.122ON56356323060.0
NCAS0A14630na 1ON56356223060.0
KLLA0E16303g5.122ON56356223030.0
KLTH0B01188g5.122ON59356223020.0
SAKL0G14894g5.122ON56456323010.0
Skud_12.1105.122ON56356323000.0
TBLA0B075205.122ON56356322960.0
TPHA0H009505.122ON56356322800.0
Suva_10.227na 3ON56356322720.0
Ecym_24795.122ON56456322680.0
TPHA0Q00120singletonON56356322660.0
Smik_12.197na 3ON56356322570.0
YLR134W (PDC5)na 3ON56356322460.0
Skud_12.203na 3ON56356322440.0
TBLA0B10060singletonON56456322390.0
AAL073Wna 2ON56356222370.0
NDAI0A02510singletonON56356222350.0
YGR087C (PDC6)na 4ON56356322140.0
Kwal_33.155405.122ON56456222070.0
Suva_7.369na 4ON56356322030.0
SAKL0F04334gsingletonON56456321980.0
TBLA0D02840singletonON56356321860.0
TBLA0E03070singletonON56356321850.0
NCAS0A14240singletonON56556421790.0
KNAG0J01330singletonON56456321500.0
KNAG0J01340singletonON56556221000.0
KLTH0D08272gsingletonON56356220960.0
NDAI0D03270singletonON52152020760.0
CAGL0G02937gna 4ON56456720130.0
Ecym_3185na 2ON56356319680.0
SAKL0E04972g2.390ON61154818000.0
Suva_4.1672.390ON62055415940.0
YDL080C (THI3)2.390ON60955415930.0
ZYRO0A08426g2.390ON58454815900.0
KLTH0E09702g2.390ON60755015590.0
KNAG0A059002.390ON62056015570.0
Skud_4.1752.390ON62055415490.0
Kwal_47.178782.390ON61055015430.0
Smik_4.1562.390ON62155415410.0
TDEL0G032102.390ON60657115350.0
CAGL0L06842g2.390ON63858315370.0
NCAS0A040002.390ON62556915140.0
TPHA0G026202.390ON68859615080.0
NDAI0E017002.390ON62156614880.0
TBLA0B088202.390ON63558814740.0
KAFR0F029902.390ON60855914690.0
Ecym_60552.390ON59256512951e-173
ADR254W2.390ON58155512641e-168
Kpol_1046.92.390ON59855711831e-156
SAKL0G03036g5.456ON6376038681e-108
CAGL0A03102g5.456ON6496178621e-107
Kpol_1062.125.456ON6305908551e-106
NCAS0A118305.456ON6376098531e-106
KLLA0F16962g2.390ON5785598271e-103
Suva_2.5545.456ON6356148311e-102
YDR380W (ARO10)5.456ON6356138281e-102
Skud_4.6515.456ON6356168201e-101
Smik_4.6495.456ON6356158141e-100
KLTH0F15510g5.456ON6256098111e-100
ZYRO0G04378g5.456ON6136088101e-100
KAFR0E037305.456ON6355998074e-99
ACR211W5.456ON6296027882e-96
KLLA0E02707g5.456ON6315957812e-95
TPHA0J026805.456ON6486247736e-94
KNAG0C047905.456ON6376027631e-92
TBLA0A026705.456ON6406057612e-92
Kpol_440.45.456ON6366067578e-92
TDEL0D024505.456ON6756087538e-91
TPHA0E016005.456ON6515937441e-89
TBLA0A064205.456ON6386077212e-86
SAKL0D00220gsingletonON5775736944e-83
KLTH0D00418gsingletonON5615686421e-75
TDEL0C07020singletonON5605676393e-75
TDEL0F00150singletonON5605676375e-75
NDAI0A044505.456ON5615606159e-72
Skud_7.383na 4ON86922046e-19
YMR108W (ILV2)2.441ON6875081752e-12
Smik_13.2972.441ON6875101733e-12
Kwal_26.75822.441ON6795281715e-12
NCAS0A043202.441ON6895121707e-12
KAFR0A005702.441ON6825091681e-11
CAGL0K03465g2.441ON6775181618e-11
SAKL0E03740g2.441ON6795141619e-11
NCAS0G039601.450ON5775761563e-10
ZYRO0E03454g1.450ON5494941545e-10
KLTH0D04532g2.441ON6783031546e-10
Kpol_297.122.441ON6713051521e-09
Suva_13.2872.441ON6875061511e-09
NDAI0H023802.441ON6855151502e-09
TBLA0I014002.441ON7105121502e-09
TDEL0B055201.450ON5555271482e-09
NCAS0F015002.441ON6845231493e-09
TDEL0A021602.441ON6825191465e-09
KNAG0E023602.441ON6935121456e-09
Skud_13.2672.441ON6875091458e-09
ZYRO0G19954g2.441ON7005201441e-08
TPHA0G024402.441ON6915271431e-08
KNAG0A062502.441ON6805161421e-08
NDAI0E020502.441ON6905061422e-08
Ecym_61072.441ON6895131384e-08
TPHA0B039401.450ON5755291369e-08
AEL305C2.441ON6685101351e-07
Ecym_13601.450ON5444911341e-07
KLLA0B12584g2.441ON6915101341e-07
Skud_5.761.450ON5605081223e-06
TPHA0G028852.441ON6883021215e-06
YEL020C1.450ON5605421206e-06
SAKL0D10934g1.450ON5502611171e-05
Smik_5.871.450ON5605081144e-05
KLTH0H14102g1.450ON5514961135e-05
AEL055C1.450ON5455061036e-04
Kwal_34.161161.450ON5532891037e-04
TBLA0C015601.450ON582325920.013
Suva_5.681.450ON561502920.013
KNAG0H015801.450ON560565890.031
KAFR0H028901.450ON56092840.13
Kpol_1061.501.450ON57156800.37
NDAI0G005201.450ON575344790.61
KNAG0J023703.311ON95776761.4
CAGL0M03245g1.450ON56256751.6
KNAG0H015008.618ON24468722.7
NCAS0A084201.456ON39470723.7
NCAS0B07970na 5ON20589686.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0M01250
         (563 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0M01250 Chr13 complement(229749..231440) [1692 bp, 563 aa] {...  1104   0.0  
KAFR0E02020 Chr5 (400911..402605) [1695 bp, 564 aa] {ON} Anc_5.1...   936   0.0  
CAGL0M07920g Chr13 complement(789467..791161) [1695 bp, 564 aa] ...   927   0.0  
TDEL0E05080 Chr5 (936841..938532) [1692 bp, 563 aa] {ON} Anc_5.1...   921   0.0  
NDAI0C03110 Chr3 (707463..709157) [1695 bp, 564 aa] {ON} Anc_5.122    908   0.0  
NDAI0A01400 Chr1 (313925..315616) [1692 bp, 563 aa] {ON}              905   0.0  
NCAS0D01660 Chr4 complement(313684..315378) [1695 bp, 564 aa] {O...   902   0.0  
KAFR0E01520 Chr5 complement(306988..308679) [1692 bp, 563 aa] {O...   901   0.0  
YLR044C Chr12 complement(232390..234081) [1692 bp, 563 aa] {ON} ...   899   0.0  
Smik_12.106 Chr12 complement(213431..215122) [1692 bp, 563 aa] {...   897   0.0  
Suva_10.128 Chr10 complement(233880..235571) [1692 bp, 563 aa] {...   896   0.0  
ACL134C Chr3 complement(117344..119104) [1761 bp, 586 aa] {ON} S...   895   0.0  
Kpol_1010.48 s1010 (110999..112690) [1692 bp, 563 aa] {ON} (1109...   895   0.0  
SAKL0G10164g Chr7 complement(867445..869139) [1695 bp, 564 aa] {...   894   0.0  
ZYRO0F01606g Chr6 complement(130346..132037) [1692 bp, 563 aa] {...   892   0.0  
NCAS0A14630 Chr1 complement(2878338..2880029) [1692 bp, 563 aa] ...   892   0.0  
KLLA0E16303g Chr5 complement(1457903..1459594) [1692 bp, 563 aa]...   891   0.0  
KLTH0B01188g Chr2 complement(104224..106005) [1782 bp, 593 aa] {...   891   0.0  
SAKL0G14894g Chr7 (1275005..1276699) [1695 bp, 564 aa] {ON} unip...   890   0.0  
Skud_12.110 Chr12 complement(217239..218930) [1692 bp, 563 aa] {...   890   0.0  
TBLA0B07520 Chr2 complement(1789035..1790726) [1692 bp, 563 aa] ...   889   0.0  
TPHA0H00950 Chr8 (199181..200872) [1692 bp, 563 aa] {ON} Anc_5.1...   882   0.0  
Suva_10.227 Chr10 (419251..420942) [1692 bp, 563 aa] {ON} YLR134...   879   0.0  
Ecym_2479 Chr2 (938295..939989) [1695 bp, 564 aa] {ON} similar t...   878   0.0  
TPHA0Q00120 Chr17 complement(8844..10535) [1692 bp, 563 aa] {ON}      877   0.0  
Smik_12.197 Chr12 (392030..393721) [1692 bp, 563 aa] {ON} YLR134...   874   0.0  
YLR134W Chr12 (410723..412414) [1692 bp, 563 aa] {ON}  PDC5Minor...   869   0.0  
Skud_12.203 Chr12 (393390..395081) [1692 bp, 563 aa] {ON} YLR134...   868   0.0  
TBLA0B10060 Chr2 complement(2418979..2420673) [1695 bp, 564 aa] ...   867   0.0  
AAL073W Chr1 (216809..218500) [1692 bp, 563 aa] {ON} Non-synteni...   866   0.0  
NDAI0A02510 Chr1 complement(562483..564174) [1692 bp, 563 aa] {O...   865   0.0  
YGR087C Chr7 complement(651290..652981) [1692 bp, 563 aa] {ON}  ...   857   0.0  
Kwal_33.15540 s33 (1147974..1149668) [1695 bp, 564 aa] {ON} YLR0...   854   0.0  
Suva_7.369 Chr7 complement(627739..629430) [1692 bp, 563 aa] {ON...   853   0.0  
SAKL0F04334g Chr6 complement(347639..349333) [1695 bp, 564 aa] {...   851   0.0  
TBLA0D02840 Chr4 complement(694649..696340) [1692 bp, 563 aa] {O...   846   0.0  
TBLA0E03070 Chr5 (771183..772874) [1692 bp, 563 aa] {ON}              846   0.0  
NCAS0A14240 Chr1 (2804135..2805832) [1698 bp, 565 aa] {ON}            843   0.0  
KNAG0J01330 Chr10 complement(240650..242344) [1695 bp, 564 aa] {...   832   0.0  
KNAG0J01340 Chr10 complement(243186..244883) [1698 bp, 565 aa] {...   813   0.0  
KLTH0D08272g Chr4 complement(695296..696987) [1692 bp, 563 aa] {...   811   0.0  
NDAI0D03270 Chr4 (778452..780017) [1566 bp, 521 aa] {ON}              804   0.0  
CAGL0G02937g Chr7 complement(268985..270679) [1695 bp, 564 aa] {...   780   0.0  
Ecym_3185 Chr3 (352629..354320) [1692 bp, 563 aa] {ON} similar t...   762   0.0  
SAKL0E04972g Chr5 (403578..405413) [1836 bp, 611 aa] {ON} simila...   697   0.0  
Suva_4.167 Chr4 complement(300197..302059) [1863 bp, 620 aa] {ON...   618   0.0  
YDL080C Chr4 complement(310642..312471) [1830 bp, 609 aa] {ON}  ...   618   0.0  
ZYRO0A08426g Chr1 complement(675104..676858) [1755 bp, 584 aa] {...   617   0.0  
KLTH0E09702g Chr5 (874177..876000) [1824 bp, 607 aa] {ON} simila...   605   0.0  
KNAG0A05900 Chr1 complement(880996..882858) [1863 bp, 620 aa] {O...   604   0.0  
Skud_4.175 Chr4 complement(306124..307986) [1863 bp, 620 aa] {ON...   601   0.0  
Kwal_47.17878 s47 (590664..592496) [1833 bp, 610 aa] {ON} YDL080...   598   0.0  
Smik_4.156 Chr4 complement(287087..288952) [1866 bp, 621 aa] {ON...   598   0.0  
TDEL0G03210 Chr7 complement(597217..599037) [1821 bp, 606 aa] {O...   595   0.0  
CAGL0L06842g Chr12 (771870..773786) [1917 bp, 638 aa] {ON} simil...   596   0.0  
NCAS0A04000 Chr1 complement(806883..808760) [1878 bp, 625 aa] {O...   587   0.0  
TPHA0G02620 Chr7 complement(547384..549450) [2067 bp, 688 aa] {O...   585   0.0  
NDAI0E01700 Chr5 (337856..339721) [1866 bp, 621 aa] {ON} Anc_2.390    577   0.0  
TBLA0B08820 Chr2 (2097075..2098982) [1908 bp, 635 aa] {ON} Anc_2...   572   0.0  
KAFR0F02990 Chr6 complement(589562..591388) [1827 bp, 608 aa] {O...   570   0.0  
Ecym_6055 Chr6 complement(105018..106796) [1779 bp, 592 aa] {ON}...   503   e-173
ADR254W Chr4 (1143623..1145368) [1746 bp, 581 aa] {ON} Syntenic ...   491   e-168
Kpol_1046.9 s1046 (18301..18855,18984..18992,19556..19693,19697....   460   e-156
SAKL0G03036g Chr7 (250012..251925) [1914 bp, 637 aa] {ON} simila...   338   e-108
CAGL0A03102g Chr1 (317961..319910) [1950 bp, 649 aa] {ON} simila...   336   e-107
Kpol_1062.12 s1062 complement(31361..33253) [1893 bp, 630 aa] {O...   333   e-106
NCAS0A11830 Chr1 (2347016..2348929) [1914 bp, 637 aa] {ON} Anc_5...   333   e-106
KLLA0F16962g Chr6 complement(1559454..1561190) [1737 bp, 578 aa]...   323   e-103
Suva_2.554 Chr2 (984966..986873) [1908 bp, 635 aa] {ON} YDR380W ...   324   e-102
YDR380W Chr4 (1234218..1236125) [1908 bp, 635 aa] {ON}  ARO10Phe...   323   e-102
Skud_4.651 Chr4 (1157087..1158994) [1908 bp, 635 aa] {ON} YDR380...   320   e-101
Smik_4.649 Chr4 (1154670..1156577) [1908 bp, 635 aa] {ON} YDR380...   318   e-100
KLTH0F15510g Chr6 complement(1265767..1267644) [1878 bp, 625 aa]...   317   e-100
ZYRO0G04378g Chr7 complement(350070..351911) [1842 bp, 613 aa] {...   316   e-100
KAFR0E03730 Chr5 complement(746616..748523) [1908 bp, 635 aa] {O...   315   4e-99
ACR211W Chr3 (716693..718582) [1890 bp, 629 aa] {ON} Syntenic ho...   308   2e-96
KLLA0E02707g Chr5 (251220..253115) [1896 bp, 631 aa] {ON} simila...   305   2e-95
TPHA0J02680 Chr10 (593893..595839) [1947 bp, 648 aa] {ON} Anc_5....   302   6e-94
KNAG0C04790 Chr3 complement(932051..933964) [1914 bp, 637 aa] {O...   298   1e-92
TBLA0A02670 Chr1 complement(648495..650417) [1923 bp, 640 aa] {O...   297   2e-92
Kpol_440.4 s440 (9465..11375) [1911 bp, 636 aa] {ON} (9465..1137...   296   8e-92
TDEL0D02450 Chr4 complement(477063..479090) [2028 bp, 675 aa] {O...   294   8e-91
TPHA0E01600 Chr5 complement(325811..327766) [1956 bp, 651 aa] {O...   291   1e-89
TBLA0A06420 Chr1 complement(1577160..1579076) [1917 bp, 638 aa] ...   282   2e-86
SAKL0D00220g Chr4 complement(18466..20199) [1734 bp, 577 aa] {ON...   271   4e-83
KLTH0D00418g Chr4 complement(37778..39463) [1686 bp, 561 aa] {ON...   251   1e-75
TDEL0C07020 Chr3 complement(1283600..1285282) [1683 bp, 560 aa] ...   250   3e-75
TDEL0F00150 Chr6 (12055..13737) [1683 bp, 560 aa] {ON}                249   5e-75
NDAI0A04450 Chr1 complement(1006559..1008244) [1686 bp, 561 aa] ...   241   9e-72
Skud_7.383 Chr7 complement(638760..638846,638850..638882,638886....    83   6e-19
YMR108W Chr13 (484084..486147) [2064 bp, 687 aa] {ON}  ILV2Aceto...    72   2e-12
Smik_13.297 Chr13 (467578..469641) [2064 bp, 687 aa] {ON} YMR108...    71   3e-12
Kwal_26.7582 s26 (427437..429476) [2040 bp, 679 aa] {ON} YMR108W...    70   5e-12
NCAS0A04320 Chr1 complement(873722..875791) [2070 bp, 689 aa] {O...    70   7e-12
KAFR0A00570 Chr1 complement(101898..103946) [2049 bp, 682 aa] {O...    69   1e-11
CAGL0K03465g Chr11 (320030..322063) [2034 bp, 677 aa] {ON} highl...    67   8e-11
SAKL0E03740g Chr5 (302160..304199) [2040 bp, 679 aa] {ON} highly...    67   9e-11
NCAS0G03960 Chr7 (733213..734946) [1734 bp, 577 aa] {ON} Anc_1.4...    65   3e-10
ZYRO0E03454g Chr5 complement(270926..272575) [1650 bp, 549 aa] {...    64   5e-10
KLTH0D04532g Chr4 (417085..419121) [2037 bp, 678 aa] {ON} highly...    64   6e-10
Kpol_297.12 s297 complement(20788..22803) [2016 bp, 671 aa] {ON}...    63   1e-09
Suva_13.287 Chr13 (465217..467280) [2064 bp, 687 aa] {ON} YMR108...    63   1e-09
NDAI0H02380 Chr8 (578157..580214) [2058 bp, 685 aa] {ON} Anc_2.441     62   2e-09
TBLA0I01400 Chr9 (303028..305160) [2133 bp, 710 aa] {ON} Anc_2.4...    62   2e-09
TDEL0B05520 Chr2 complement(980893..982560) [1668 bp, 555 aa] {O...    62   2e-09
NCAS0F01500 Chr6 (299388..301442) [2055 bp, 684 aa] {ON} Anc_2.4...    62   3e-09
TDEL0A02160 Chr1 complement(389068..391116) [2049 bp, 682 aa] {O...    61   5e-09
KNAG0E02360 Chr5 complement(470361..472442) [2082 bp, 693 aa] {O...    60   6e-09
Skud_13.267 Chr13 (459466..461529) [2064 bp, 687 aa] {ON} YMR108...    60   8e-09
ZYRO0G19954g Chr7 (1653353..1655455) [2103 bp, 700 aa] {ON} high...    60   1e-08
TPHA0G02440 Chr7 complement(498107..500182) [2076 bp, 691 aa] {O...    60   1e-08
KNAG0A06250 Chr1 complement(948840..950882) [2043 bp, 680 aa] {O...    59   1e-08
NDAI0E02050 Chr5 complement(414418..416490) [2073 bp, 690 aa] {O...    59   2e-08
Ecym_6107 Chr6 complement(201133..203202) [2070 bp, 689 aa] {ON}...    58   4e-08
TPHA0B03940 Chr2 (928983..930710) [1728 bp, 575 aa] {ON} Anc_1.4...    57   9e-08
AEL305C Chr5 complement(69381..71387) [2007 bp, 668 aa] {ON} Syn...    57   1e-07
Ecym_1360 Chr1 (739963..741597) [1635 bp, 544 aa] {ON} similar t...    56   1e-07
KLLA0B12584g Chr2 complement(1100489..1102564) [2076 bp, 691 aa]...    56   1e-07
Skud_5.76 Chr5 complement(117925..119607) [1683 bp, 560 aa] {ON}...    52   3e-06
TPHA0G02885 Chr7 complement(616977..619043) [2067 bp, 688 aa] {ON}     51   5e-06
YEL020C Chr5 complement(118617..120299) [1683 bp, 560 aa] {ON} P...    51   6e-06
SAKL0D10934g Chr4 (907649..909301) [1653 bp, 550 aa] {ON} simila...    50   1e-05
Smik_5.87 Chr5 complement(124637..126319) [1683 bp, 560 aa] {ON}...    49   4e-05
KLTH0H14102g Chr8 (1226474..1228129) [1656 bp, 551 aa] {ON} simi...    48   5e-05
AEL055C Chr5 complement(533904..535541) [1638 bp, 545 aa] {ON} S...    44   6e-04
Kwal_34.16116 s34 complement(208847..210508) [1662 bp, 553 aa] {...    44   7e-04
TBLA0C01560 Chr3 (362966..364714) [1749 bp, 582 aa] {ON} Anc_1.4...    40   0.013
Suva_5.68 Chr5 (108954..110639) [1686 bp, 561 aa] {ON} YEL020C (...    40   0.013
KNAG0H01580 Chr8 complement(279178..280860) [1683 bp, 560 aa] {O...    39   0.031
KAFR0H02890 Chr8 complement(551945..553627) [1683 bp, 560 aa] {O...    37   0.13 
Kpol_1061.50 s1061 (141784..143499) [1716 bp, 571 aa] {ON} (1417...    35   0.37 
NDAI0G00520 Chr7 complement(112068..113795) [1728 bp, 575 aa] {O...    35   0.61 
KNAG0J02370 Chr10 (447825..450698) [2874 bp, 957 aa] {ON} Anc_3....    34   1.4  
CAGL0M03245g Chr13 complement(372122..373810) [1689 bp, 562 aa] ...    33   1.6  
KNAG0H01500 Chr8 complement(264925..265659) [735 bp, 244 aa] {ON...    32   2.7  
NCAS0A08420 Chr1 complement(1667102..1668286) [1185 bp, 394 aa] ...    32   3.7  
NCAS0B07970 Chr2 complement(1512368..1512985) [618 bp, 205 aa] {...    31   6.8  

>KNAG0M01250 Chr13 complement(229749..231440) [1692 bp, 563 aa] {ON}
           Anc_5.122 YLR044C
          Length = 563

 Score = 1104 bits (2856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/563 (97%), Positives = 549/563 (97%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL
Sbjct: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           LETPIDLTLKPNDQEA              ASNPVILADACAGRHDVKVETNKLIDMTQF
Sbjct: 181 LETPIDLTLKPNDQEAENEVIETVLELIEEASNPVILADACAGRHDVKVETNKLIDMTQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
           PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG
Sbjct: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI
Sbjct: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML
Sbjct: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540

Query: 541 PVMDAPSNLIAQAKLTACINSKK 563
           PVMDAPSNLIAQAKLTACINSKK
Sbjct: 541 PVMDAPSNLIAQAKLTACINSKK 563

>KAFR0E02020 Chr5 (400911..402605) [1695 bp, 564 aa] {ON} Anc_5.122
           YLR044C
          Length = 564

 Score =  936 bits (2420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/563 (81%), Positives = 496/563 (88%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLG+YLFERL QVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+CIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMSANISETTAMVTDI TAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VP  L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           LETPIDL+LKPND EA              A NPVIL+DACA RHDVK ET +LID TQF
Sbjct: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           PAF TPMGKG+IDE++PRFGGVYVGTLS   V+ AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           YKTKNI+EFHSDY KIRNATFPGVQMKFVL KLLA V  A KGY PV +P R+  N+ C 
Sbjct: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
           P T L QEWMWN+ +KFF++GD+I+TETGT+AFGINQSLFPNN++GISQVLWGSIGFTGG
Sbjct: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           AVLGA+FAAEEIDP KRVILFIGDGSLQLTVQEIST+IRW+LKPYLFVLNN+GYTIERLI
Sbjct: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HG  AGYN IQ W+H  LLE FGA DYEN ++ TTGEW  L  DK+FN+ S+IRMIEVML
Sbjct: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540

Query: 541 PVMDAPSNLIAQAKLTACINSKK 563
           PVMDAPSNL+ QAK+TA  N+K+
Sbjct: 541 PVMDAPSNLVQQAKITAATNAKQ 563

>CAGL0M07920g Chr13 complement(789467..791161) [1695 bp, 564 aa]
           {ON} highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044c PDC1 pyruvate decarboxylase or
           uniprot|P16467 Saccharomyces cerevisiae YLR134w PDC5
          Length = 564

 Score =  927 bits (2397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/563 (81%), Positives = 493/563 (87%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLGRYLFERL QVDVKTIFGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+CIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMSANISETTAMVTDI TAPAEIDRCIRTTY+TQRPVYLGLPANLVDL VP  L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           LETPIDL+LKPND EA              A NPVILADACA RHDVK ET KLID TQF
Sbjct: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKG+IDE++PRFGGVYVGTLS   V+ AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           YKTKNIVEFHSDYIKIRNATFPGVQMKF L KLL  V  A+KGY PVP+P R+  N+ C 
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
           P T L+QEWMWN+VSKF ++GD+++TETGT+AFGINQ+ FPNN  GISQVLWGSIGFT G
Sbjct: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           A LGA+FAAEEIDP KRVILFIGDGSLQLTVQEIST+IRW LKPYLFVLNN+GYTIERLI
Sbjct: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HG  AGYN IQ W H  LL  FGA DYEN ++ TTGEW  LTQDK+FN+ SKIRMIEVML
Sbjct: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540

Query: 541 PVMDAPSNLIAQAKLTACINSKK 563
           PVMDAP++LI QAKLTA IN+K+
Sbjct: 541 PVMDAPTSLIEQAKLTASINAKQ 563

>TDEL0E05080 Chr5 (936841..938532) [1692 bp, 563 aa] {ON} Anc_5.122
           YLR044C
          Length = 563

 Score =  921 bits (2380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/562 (78%), Positives = 483/562 (85%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLGRYLFERL QVD  TIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARVKGMA ++TTFGVGELSALNGIAGSYAEHVGVLH+VGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMSANISETTAM+TDI +APAEIDRCIRTTYV+QRPVYLGLPANLVDL VP  L
Sbjct: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           L+TPIDL+LK ND EA              A NPVILADAC  RHDVK ET KLID+TQF
Sbjct: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKG+IDE+NPRFGGVYVGTLS+  V+ AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           YKTKNIVEFHSDYIKIRNATFPGVQMKF L KLLA VG   K Y PV +P R   N    
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
             T L+Q+W+WN+V KF ++GD+++TETGT+AFGINQS FPN T GISQVLWGSIGFT G
Sbjct: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIGFTTG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           A LGA+FAAEEIDP KRVILFIGDGSLQLTVQEIST++RW LKPYLFVLNN+GYTIERLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HG  A YN IQPW++  LL  FGA DYE  +++TTGEW  LT D +FN+ SKIRMIEVML
Sbjct: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540

Query: 541 PVMDAPSNLIAQAKLTACINSK 562
           PVMDAPS+L+AQA+LTA IN+K
Sbjct: 541 PVMDAPSSLVAQAQLTASINAK 562

>NDAI0C03110 Chr3 (707463..709157) [1695 bp, 564 aa] {ON} Anc_5.122
          Length = 564

 Score =  908 bits (2347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/563 (79%), Positives = 490/563 (87%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLGRYLFERL QVDVKTIFGLPGDFNLSLLDKIYE PGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+CIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMSANISETTAMVTDI TAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VP  L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           LETPIDL+LK ND EA              A NPVILADACA RHDVK ET KLID+TQF
Sbjct: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKG+IDE++PRFGGVYVGTLS+  V+ AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           YKTKNIVEFHSDYIKI+NATFPGVQMKF L KLL  V  A KGY PV +P +   N    
Sbjct: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEAAKGYKPVAVPAKPAANAAVD 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
             T L+QEWMWN+V KF ++GD+++TETGT+AFGINQ+ FPNNT GISQVLWGSIGFT G
Sbjct: 361 AATPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           A LGA+FAAEE+DP KRVILFIGDGSLQLTVQEIST++RW+LKPYLFVLNNNGYTIE+LI
Sbjct: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HGP A YN IQ W H  LL  FGA DYEN ++ TTGEW  LT++K+FN+ S+IR+IE+ML
Sbjct: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540

Query: 541 PVMDAPSNLIAQAKLTACINSKK 563
           PVMDAPSNL+AQA+LTA IN+K+
Sbjct: 541 PVMDAPSNLVAQAQLTAKINAKQ 563

>NDAI0A01400 Chr1 (313925..315616) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  905 bits (2339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/562 (79%), Positives = 490/562 (87%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLGRYLFERL QV+V TIFGLPGDFNLSLLDKIYE PGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLSQVNVNTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+CIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMSANISETTAMVTDI TAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VP  L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           LETPIDL+LKPND EA              A NPVILADAC  RHDVKVET KLID+TQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVLEEVLSLIKNAKNPVILADACCSRHDVKVETRKLIDITQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKG+IDE+NPRFGGVYVGTLS   V+ AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           YKTKNIVEFHSD+IKIRNATFPGVQMKFVL KLL  V +AVKGY PVP+P  +  N+   
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLKSVPAAVKGYKPVPVPAGIPANKKVA 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
             T L+QEWMWN+V KF ++GDI++TETGT+AFGINQ+ FPNNT GISQVLWGSIGFT G
Sbjct: 361 DSTPLKQEWMWNQVGKFLQEGDIVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           A LGA+FAAEEIDP +RVILFIGDGSLQLTVQEIST++RW+LKPYLF+LNNNGYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKRRVILFIGDGSLQLTVQEISTMVRWNLKPYLFILNNNGYTIEKLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HGP A YN IQ W H KLLE FGA DYEN ++ TTGEW  L ++K+FN  S+IR+IEVML
Sbjct: 481 HGPTAQYNEIQSWEHLKLLETFGAKDYENHRVATTGEWNKLCENKEFNVNSRIRVIEVML 540

Query: 541 PVMDAPSNLIAQAKLTACINSK 562
           PVMDAP +LI Q +LTA IN++
Sbjct: 541 PVMDAPQSLIKQGELTAQINAR 562

>NCAS0D01660 Chr4 complement(313684..315378) [1695 bp, 564 aa] {ON}
           Anc_5.122
          Length = 564

 Score =  902 bits (2330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/563 (77%), Positives = 490/563 (87%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLG+YLFERL Q+DVKTIFGLPGDFNLSLLDKIYE+PGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMSANISETTAMVTDI TAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VP  L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           L+TPIDL+LK ND EA              A NP+ILADACA RHDVK ET KLID+TQF
Sbjct: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKG+IDE++PRFGGVYVGTLS+  ++ +VESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           YKTKN+VEFHSDYIKI+NATFPGVQMKFVL KLL V+ +A KGY PV +P +   N    
Sbjct: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIAAAAKGYKPVAVPAKPAANPATA 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
             T L+QEW+WN+V KF ++GD++++ETGT+AFGINQ+ FPNNT GISQVLWGSIGF  G
Sbjct: 361 ASTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
             LGA+FAAEEIDP KRVILF G+GSLQLTVQEIST++RW+LKPYLFVLNN+GYTIERLI
Sbjct: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HG  A YN IQ W H  LL  FGA DYEN +++TTGEW  LT +K+FN+ ++IRMIE+ML
Sbjct: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540

Query: 541 PVMDAPSNLIAQAKLTACINSKK 563
           PVMDAPSNL+AQAKLTA IN+K+
Sbjct: 541 PVMDAPSNLVAQAKLTASINAKQ 563

>KAFR0E01520 Chr5 complement(306988..308679) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  901 bits (2328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/563 (76%), Positives = 491/563 (87%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLGRYLFERL QVDVKTIFGLPGDFNL+LLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+CIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHH+LGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHSLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMSANISETTA++TDI TA AEIDRCI+TTY+TQRPVYLG+PAN+ D  +P  L
Sbjct: 121 DFTVFHRMSANISETTAVLTDIATAAAEIDRCIKTTYITQRPVYLGIPANMFDFKLPAKL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           LETPIDL+LKPND EA              A NPVIL+DACA RH+V+ ET +LID TQF
Sbjct: 181 LETPIDLSLKPNDPEAEDEVIDAILSLVKAAKNPVILSDACASRHNVRKETRQLIDATQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           PAF TPMGKG+IDE++PR+GGVYVGTLS   V+ AVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFTTPMGKGSIDEQHPRYGGVYVGTLSRPEVKKAVESSDLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           YKTKN+VEFHSDY KI+NATFPGVQMKFVL KL  V+   VKGY P+P+P ++  N+PC 
Sbjct: 301 YKTKNVVEFHSDYTKIKNATFPGVQMKFVLQKLSKVIDQTVKGYKPIPVPAKVPSNKPCS 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
           P T L QEWMWN+ SKFF++GDII+TETGTAAFGINQS FP + +GISQVLWGSIGFTGG
Sbjct: 361 PSTPLSQEWMWNQASKFFQEGDIIITETGTAAFGINQSEFPTHAVGISQVLWGSIGFTGG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           AVLGA+FAAEE+D ++RVILFIGDGSLQLTVQEIST+IRW+L+PYLFVLNNNGYTIE+LI
Sbjct: 421 AVLGAAFAAEELDINRRVILFIGDGSLQLTVQEISTMIRWNLRPYLFVLNNNGYTIEKLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HG NA YN IQ W+H KLLE FGA DYEN +I TTGEW  L  +K FN+ S+IR+IE+ML
Sbjct: 481 HGENAQYNEIQNWKHLKLLETFGAKDYENHRIATTGEWDALLSNKDFNKNSRIRLIEIML 540

Query: 541 PVMDAPSNLIAQAKLTACINSKK 563
           PVMDAPSNL+ QAK+TA  N+++
Sbjct: 541 PVMDAPSNLVQQAKITAATNAQQ 563

>YLR044C Chr12 complement(232390..234081) [1692 bp, 563 aa] {ON}
           PDC1Major of three pyruvate decarboxylase isozymes, key
           enzyme in alcoholic fermentation, decarboxylates
           pyruvate to acetaldehyde; subject to glucose-, ethanol-,
           and autoregulation; involved in amino acid catabolism
          Length = 563

 Score =  899 bits (2322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/563 (77%), Positives = 481/563 (85%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLG+YLFERL QV+V T+FGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+CIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMSANISETTAM+TDI TAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VP  L
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           L+TPID++LKPND E+              A NPVILADAC  RHDVK ET KLID+TQF
Sbjct: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTPMGKG+IDE++PR+GGVYVGTLS   V+ AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           YKTKNIVEFHSD++KIRNATFPGVQMKFVL KLL  +  A KGY PV +P R   N   P
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
             T L+QEWMWN++  F ++GD+++ ETGT+AFGINQ+ FPNNT GISQVLWGSIGFT G
Sbjct: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           A LGA+FAAEEIDP KRVILFIGDGSLQLTVQEIST+IRW LKPYLFVLNN+GYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HGP A YN IQ W H  LL  FGA DYE  ++ TTGEW  LTQDK FN+ SKIRMIE+ML
Sbjct: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540

Query: 541 PVMDAPSNLIAQAKLTACINSKK 563
           PV DAP NL+ QAKLTA  N+K+
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>Smik_12.106 Chr12 complement(213431..215122) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score =  897 bits (2318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/563 (77%), Positives = 480/563 (85%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLG+YLFERL QV+V T+FGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+CIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMSANISETTAM+TDI TAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VP  L
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           LETPID++LK ND E+              A NPVILADAC  RHDVK ET KLID+TQF
Sbjct: 181 LETPIDMSLKANDAESEKEVIDTILSLVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTPMGKG+IDE++PR+GGVYVGTLS   V+ AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           YKTKNIVEFHSD++KIRNATFPGVQMKFVL KLL V+  A KGY PV +P     N   P
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTVIADAAKGYKPVAVPANTPANAAVP 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
             T L+QEWMWN++  F ++GD+++ ETGT+AFGINQ+ FPNNT GISQVLWGSIGFT G
Sbjct: 361 ASTPLKQEWMWNQLGSFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           A LGA+FAAEEIDP KRVILFIGDGSLQLTVQEIST+IRW LKPYLFVLNN+GYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HGP A YN IQ W H  LL  FGA DYE  ++ TTGEW  LTQDK FN+ SKIRMIEVML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEVML 540

Query: 541 PVMDAPSNLIAQAKLTACINSKK 563
           PV DAP NL+ QAKLTA  N+K+
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>Suva_10.128 Chr10 complement(233880..235571) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score =  896 bits (2315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/563 (77%), Positives = 480/563 (85%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLG+YLFERL QV+V T+FGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLNQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+CIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMSANISETTAM+TDI TAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VP  L
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           LETPID++LKPND E+              A NP+ILADAC  RHDVK ET KLID+TQF
Sbjct: 181 LETPIDMSLKPNDAESEKEVIDTILALVKDAKNPIILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKG+IDE++PR+GGVYVGTLS   V+ AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEKHPRYGGVYVGTLSKPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           YKTKNIVEFHSD++KIRNATFPGVQMKFVL KLL  V  A KGY PV +P     N   P
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTVADAAKGYKPVAVPAPTPANAAVP 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
             T L+QEWMWN++ +F ++GD+++ ETGT+AFGINQ  FPNNT GISQVLWGSIGFT G
Sbjct: 361 ASTPLKQEWMWNQLGEFLQEGDVVIAETGTSAFGINQVAFPNNTYGISQVLWGSIGFTTG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           A LGA+FAAEEIDP KRVILFIGDGSLQLTVQEIST+IRW LKPYLFVLNN+GYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HGP A YN IQ W H  LL  FGA DYE  ++ TTGEW  LTQDK FNE SKIRMIE+ML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNENSKIRMIEIML 540

Query: 541 PVMDAPSNLIAQAKLTACINSKK 563
           PV DAP NL+ QAKLTA  N+K+
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>ACL134C Chr3 complement(117344..119104) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR044C
           (PDC1) and Non-syntenic homolog of Saccharomyces
           cerevisiae YLR134W (PDC5) and YGR087C (PDC6)
          Length = 586

 Score =  895 bits (2313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/563 (77%), Positives = 488/563 (86%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLGRYLFERL Q++V+TIFGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 23  MSEITLGRYLFERLRQIEVQTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 82

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 83  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 142

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMSANIS TTAM++DI +APAEIDRCIRT Y+TQRPVYLGLPAN+VDL VP  L
Sbjct: 143 DFTVFHRMSANISGTTAMISDITSAPAEIDRCIRTCYITQRPVYLGLPANMVDLKVPASL 202

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           LETPIDL LKPND EA              A NPVIL+DACA RHDVK ET KLID+TQF
Sbjct: 203 LETPIDLNLKPNDPEAEAEVVETVLEMIAAAKNPVILSDACASRHDVKAETMKLIDVTQF 262

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTPMGKG+I E++PRFGGVYVGTLS+  V+ AVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 263 PAFVTPMGKGSIYEQHPRFGGVYVGTLSSPEVKEAVESADLVLSVGALLSDFNTGSFSYS 322

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           YKTKN+VEFHSD+IKIRNATFPGVQMK+VL KL+  V   +K Y PVP+P +   NE   
Sbjct: 323 YKTKNVVEFHSDHIKIRNATFPGVQMKYVLRKLVDNVAEVIKSYVPVPVPSKPANNEEID 382

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
             T L+QEW+WN+V KF R+GD+++TETGT+AFGINQ+ FPNNT GISQVLWGSIGFT G
Sbjct: 383 SATPLKQEWLWNQVGKFLREGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 442

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           A LGA+FAAEE+DP++RVILFIGDGSLQLTVQEIST++RW LKPYLFVLNN+GYTIERLI
Sbjct: 443 ACLGAAFAAEELDPNRRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 502

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HG  A YN IQPW+H  LL  FGA DYE V+++TTGEW  LTQDK FNE SKIRMIEVML
Sbjct: 503 HGETAQYNDIQPWQHLNLLPTFGAKDYEAVRVSTTGEWDALTQDKAFNENSKIRMIEVML 562

Query: 541 PVMDAPSNLIAQAKLTACINSKK 563
           PVMDAPSNL+ QA+LTA  N+K+
Sbjct: 563 PVMDAPSNLVKQAELTAATNAKQ 585

>Kpol_1010.48 s1010 (110999..112690) [1692 bp, 563 aa] {ON}
           (110999..112690) [1692 nt, 564 aa]
          Length = 563

 Score =  895 bits (2313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/563 (77%), Positives = 486/563 (86%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLGRYLFERL QV V+TIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVQVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMAC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMSA ISETTAM+TDI  APAEIDRCIRTTY+TQR VYLGLPAN+VDL VP  L
Sbjct: 121 DFTVFHRMSACISETTAMITDIANAPAEIDRCIRTTYITQRTVYLGLPANMVDLMVPADL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           L+TPIDL+LKPND EA              A NP+ILADACA RHDVK ET +LID TQF
Sbjct: 181 LKTPIDLSLKPNDPEAETEVLDTILAMVKEAKNPIILADACASRHDVKAETKQLIDTTQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKG+IDE++PRFGGVYVGTLS   V+ AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PCFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKAAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           Y+TKN+VEFHSD+ KI+ A+FPGVQMKFVL KL+A +G+AVK Y PV  P     N  CP
Sbjct: 301 YQTKNVVEFHSDHTKIKKASFPGVQMKFVLQKLVAQIGAAVKDYKPVAAPALPASNAECP 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
             T L+QEW+WN+V KF ++GDI+LTETGT+AFGINQ+ FPNNT GISQVLWGSIGFTGG
Sbjct: 361 ASTPLKQEWLWNQVGKFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGFTGG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           A LGA+FAAEEIDP KR I+FIGDGSLQLTVQEIST+IRW+LKPY+FVLNN+GYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNDGYTIEKLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HGP A YN IQ W+H  +L  FGA DYE +++ TTGE+  L +DK FNE SKIRMIE+ML
Sbjct: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYEAIRVATTGEFNKLCEDKAFNENSKIRMIEIML 540

Query: 541 PVMDAPSNLIAQAKLTACINSKK 563
           PVMDAPSNL+AQAKLTA IN+K+
Sbjct: 541 PVMDAPSNLVAQAKLTASINAKQ 563

>SAKL0G10164g Chr7 complement(867445..869139) [1695 bp, 564 aa] {ON}
           uniprot|Q6W9G6 Saccharomyces kluyveri PDC11 Pyruvate
           decarboxylase
          Length = 564

 Score =  894 bits (2309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/563 (79%), Positives = 495/563 (87%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLG YLFERL QVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGLYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARVKGM+CIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARVKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMSANISETTA VTDI TAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VP  L
Sbjct: 121 DFTVFHRMSANISETTAWVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLMVPASL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           L+TPIDL+LKPND EA              A NP+ILADACA RHDVK ET +LID+TQF
Sbjct: 181 LDTPIDLSLKPNDPEAEAEVVNSVLELIKDAKNPIILADACASRHDVKPETKQLIDITQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTP+GKG+IDE++PRFGGVYVGTLSN++V+ AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRFGGVYVGTLSNDDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           YKTKNIVEFHSDYIKIRNATFPGVQMKF L KLL+ +G+ VK Y PV +PP+ TPN  C 
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLSEIGAVVKDYKPVAVPPKPTPNPACD 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
           P T L+QEW+WN+V +F ++GD+++TETGT+AFGINQ+ FPNNT GISQVLWGSIGFT G
Sbjct: 361 PSTPLKQEWVWNQVGRFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           A LGA+ AAEE+D +KRVILFIGDGSLQLTVQEIST+IRW L+PYLFVLNN+GYTIERLI
Sbjct: 421 ACLGAACAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLRPYLFVLNNDGYTIERLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HG NA YN IQPW++  LL  FGA DYE  ++ TTGEW  L QD+ FN+ S+IRM+EVML
Sbjct: 481 HGENAQYNEIQPWKNLDLLPTFGAKDYETYRVATTGEWDKLAQDEAFNKNSRIRMVEVML 540

Query: 541 PVMDAPSNLIAQAKLTACINSKK 563
           PVMDAPSNL+ QA+LTA IN+K+
Sbjct: 541 PVMDAPSNLVKQAQLTASINAKQ 563

>ZYRO0F01606g Chr6 complement(130346..132037) [1692 bp, 563 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 563

 Score =  892 bits (2306), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/563 (76%), Positives = 477/563 (84%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLGRYLFERL QVD  TIFG+PGDFNLSLLDK+YEV G+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVDTNTIFGVPGDFNLSLLDKVYEVQGLRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARVKG+A +ITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARVKGLAALITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMSANISETTAM+TDI  APAEIDRCIR  YV QRPVYLGLPANLVD  VP  L
Sbjct: 121 DFTVFHRMSANISETTAMLTDITAAPAEIDRCIRVAYVNQRPVYLGLPANLVDQKVPASL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           L TPIDL+LK ND EA              A NPVILADAC  RHDVK ET KLID+TQF
Sbjct: 181 LNTPIDLSLKENDPEAETEVVDTVLELIKEAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKG+IDE+NPRFGGVYVGTLS+  V+ AVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           YKTKN+VEFHSD+IKIRNATFPGVQMKFVL KLL  V  AVK Y P P+P   +PN    
Sbjct: 301 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLKKLLQAVPEAVKNYKPGPVPAPPSPNAEVA 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
             T L+QEW+W +V  F R+GD+++TETGT+AFGINQ+ FPN T GISQVLWGSIG+T G
Sbjct: 361 DSTTLKQEWLWRQVGSFLREGDVVITETGTSAFGINQTHFPNQTYGISQVLWGSIGYTTG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           + LGA+FAAEEIDP KRVILFIGDGSLQLTVQEIST+IRW LKPYLFVLNN+GYTIERLI
Sbjct: 421 STLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HG  A YN IQPW+H +LL  FGA DYEN +++T GEW  LTQD +FNE S+IRMIEVML
Sbjct: 481 HGETAEYNCIQPWKHLELLNTFGAKDYENHRVSTVGEWNKLTQDPKFNENSRIRMIEVML 540

Query: 541 PVMDAPSNLIAQAKLTACINSKK 563
            VMDAPS+L+AQA+LTA  N+K+
Sbjct: 541 EVMDAPSSLVAQAQLTAATNAKQ 563

>NCAS0A14630 Chr1 complement(2878338..2880029) [1692 bp, 563 aa]
           {ON} 
          Length = 563

 Score =  892 bits (2306), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/562 (76%), Positives = 487/562 (86%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLGRYLFERL QV+V TIFGLPGDFNL+LLDKIYEVPGMRWAGNANELNA+YAADG
Sbjct: 1   MSEITLGRYLFERLKQVNVNTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNASYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARVKGMAC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS SSQAKQLLLHHTLGNG
Sbjct: 61  YARVKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMS+NISETTAMVTD+  A +EIDRCIRTTYVTQR VYLGLPAN+ DL V   L
Sbjct: 121 DFTVFHRMSSNISETTAMVTDLANATSEIDRCIRTTYVTQRTVYLGLPANMFDLKVKASL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           L+TPIDL+LKPND  A              A NP+ILADAC  RHDVK ET KLID+TQF
Sbjct: 181 LDTPIDLSLKPNDAAAENEVVETILSLVKDAKNPIILADACCSRHDVKAETKKLIDITQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKG+IDE+NPR+GGVYVGTLSN +V+ AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRYGGVYVGTLSNPDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           YKTKN+VEFHSD+IKI++ATFPGVQMKFVL KLL V+ S  KGY PV +P R  PN+P P
Sbjct: 301 YKTKNVVEFHSDHIKIKSATFPGVQMKFVLQKLLKVIPSVAKGYKPVAVPGRPAPNKPSP 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
            +T ++QEWMWNE++KFF++GD+I+TETGT+AFGINQ+ FP N  GISQVLWGSIGF  G
Sbjct: 361 ANTPMKQEWMWNELAKFFQEGDVIITETGTSAFGINQTPFPKNAYGISQVLWGSIGFATG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
             LGA+FAAEEIDP KRVILF G+GSLQLTVQEIST++RW+LKPYLFVLNN GYTIERLI
Sbjct: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNAGYTIERLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HG  AGYN IQPW H  LLE FGA DYEN +++TTGEW+ LT +K FN+ S+IR+IE+ML
Sbjct: 481 HGEKAGYNDIQPWNHLNLLETFGAKDYENHRVSTTGEWEKLTTNKDFNQNSRIRLIEIML 540

Query: 541 PVMDAPSNLIAQAKLTACINSK 562
            VMDAPSNL+AQA+LTA IN+K
Sbjct: 541 EVMDAPSNLVAQAQLTASINAK 562

>KLLA0E16303g Chr5 complement(1457903..1459594) [1692 bp, 563 aa]
           {ON} highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism
          Length = 563

 Score =  891 bits (2303), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/562 (77%), Positives = 483/562 (85%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLGRYLFERL QV+V+TIFGLPGDFNLSLLD IYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVEVQTIFGLPGDFNLSLLDNIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+CIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMS+NISETTAM+TDI TAPAEIDRCIRTTYV+QRPVYLGLPANLVDL VP  L
Sbjct: 121 DFTVFHRMSSNISETTAMITDINTAPAEIDRCIRTTYVSQRPVYLGLPANLVDLTVPASL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           L+TPIDL+LKPND EA              A NPVILADAC  RHD K ET KLID+TQF
Sbjct: 181 LDTPIDLSLKPNDPEAEEEVIENVLQLIKEAKNPVILADACCSRHDAKAETKKLIDLTQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTPMGKG+IDE++PRFGGVYVGTLS+  V+ AVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           YKTKNIVEFHSDY KIR+ATFPGVQMKF L KLL  V  A KGY PVP+P     NE   
Sbjct: 301 YKTKNIVEFHSDYTKIRSATFPGVQMKFALQKLLTKVADAAKGYKPVPVPSEPEHNEAVA 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
             T L+QEW+W +V +F R+GD+++TETGT+AFGINQ+ FPNNT GISQVLWGSIGFT G
Sbjct: 361 DSTPLKQEWVWTQVGEFLREGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           A LGA+FAAEEIDP KRVILFIGDGSLQLTVQEIST+IRW LKPYLFVLNN+GYTIERLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HG  A YN IQ W+H +LL  FGA DYE V+++TTGEW  LT D++F + ++IR+IEVML
Sbjct: 481 HGETAQYNCIQNWQHLELLPTFGAKDYEAVRVSTTGEWNKLTTDEKFQDNTRIRLIEVML 540

Query: 541 PVMDAPSNLIAQAKLTACINSK 562
           P MDAPSNL+ QA+LTA  N+K
Sbjct: 541 PTMDAPSNLVKQAQLTAATNAK 562

>KLTH0B01188g Chr2 complement(104224..106005) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 593

 Score =  891 bits (2302), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/562 (74%), Positives = 476/562 (84%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLGRY+FERL QVDV T+FGLPGDFNL LLD+IYEV GMRWAGN NELNA+YAAD 
Sbjct: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+C+ITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+S+QAKQLLLHHTLGNG
Sbjct: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMSANISETTAM+TD+ TAP+EIDRCIRTTY+ QRPVYLGLP+N VD  VP  L
Sbjct: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           L+TPIDL LKPNDQ+A              A NPVILADACA RHDVK ET KLID+TQF
Sbjct: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKG+IDE++PRFGGVYVGTLS+  V+ AVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           YKTKN+VEFHSD+IKIRNATFPGVQMKFVL  LL  VG+ VK Y PVP+P    PN    
Sbjct: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
           P T L+Q+W+WN+V +F ++GDI+LTETGT+AFGINQ+ FPNNT GISQVLWGSIG+  G
Sbjct: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           A LGA  AAEE+D SKRVILF G+GSLQLT QEIST++RW+LKPYLFVLNN GYTIE+LI
Sbjct: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HGP A YN IQ W H  LL  FGA DYE ++++TTGEW  L +DK FN+ SKIR+IE+ML
Sbjct: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569

Query: 541 PVMDAPSNLIAQAKLTACINSK 562
           PVMDAP +L+ QA+LTA  N+K
Sbjct: 570 PVMDAPESLVKQAQLTAATNAK 591

>SAKL0G14894g Chr7 (1275005..1276699) [1695 bp, 564 aa] {ON}
           uniprot|Q6XAF0 Saccharomyces kluyveri PDC12 Pyruvate
           decarboxylase
          Length = 564

 Score =  890 bits (2301), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/563 (78%), Positives = 494/563 (87%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLGRYLFERL QV+V+TIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLNQVEVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+CIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMSANISETTA VTDI TAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VP  L
Sbjct: 121 DFTVFHRMSANISETTAWVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLMVPASL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           L+TPIDL+LKPND EA              A NPVILADACA RH+VK ET +LID+TQF
Sbjct: 181 LDTPIDLSLKPNDPEAEAEVVNTVLELIKDAKNPVILADACASRHNVKSETKQLIDITQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTP+GKG+IDE++PRFGGVYVGTLSN++V+ AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRFGGVYVGTLSNDDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           YKTKNIVEFHSDYIKIRNATFPGVQMKF L KLL+ VG  VK Y PV +P + TPN  C 
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLSQVGEVVKDYKPVAVPAKPTPNPACD 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
           P T L+QEW+WN+V +F ++GD+++TETGT+AFGINQ+ FPNNT GISQVLWGSIGFT G
Sbjct: 361 PSTPLKQEWVWNQVGRFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           A LGA+ AAEE+D +KRVILFIGDGSLQLTVQEIST+IRW LKPYLFVLNN+GYTIERLI
Sbjct: 421 ACLGAACAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HG NA YN IQPW++  LL  FGA DYE  ++ TTGEW  L QD+ FN+ S+IRM+EVML
Sbjct: 481 HGENAQYNEIQPWKNLDLLPTFGAKDYETYRVATTGEWDKLAQDEAFNKNSRIRMVEVML 540

Query: 541 PVMDAPSNLIAQAKLTACINSKK 563
           PVMDAPSNL+ QA+LTA IN+K+
Sbjct: 541 PVMDAPSNLVKQAQLTASINAKQ 563

>Skud_12.110 Chr12 complement(217239..218930) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score =  890 bits (2300), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/563 (77%), Positives = 478/563 (84%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M +LTLG+YLFERL QV+V T+FGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+CIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMSANISETTAM+TDI TAPAEIDRCIRTTYVTQRPVYLGLPANLVDL V   L
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           L+TPID++LKPND E+              A NPVILADAC  RHDVK ET KLID+TQF
Sbjct: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTPMGKG+IDE++PR+GGVYVGTLS   V+ AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           YKTKNIVEFHSD+IKIRNATFPGVQMKFVL KLL  +  A KGY PV +P     N    
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPAGTPANAAVA 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
             T L+QEWMWN++  F ++GD+++ ETGT+AFGINQ+ FPNNT GISQVLWGSIGFT G
Sbjct: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           A LGA+FAAEEIDP KRVILFIGDGSLQLTVQEIST+IRW LKPYLF+LNN+GYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HGP A YN IQ W H  LL  FGA DYE  ++ TTGEW  LTQDK FN+ SKIRMIE+ML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540

Query: 541 PVMDAPSNLIAQAKLTACINSKK 563
           PV DAP NL+ QAKLTA  N+K+
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>TBLA0B07520 Chr2 complement(1789035..1790726) [1692 bp, 563 aa]
           {ON} Anc_5.122 YLR044C
          Length = 563

 Score =  889 bits (2296), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/563 (76%), Positives = 488/563 (86%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLG+YLFERL QV V+TIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MAEITLGKYLFERLNQVKVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMAC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMSA ISETTAM+TDI TAPAEIDRCIRTTYV QR VYLGLPANLVDL VP  L
Sbjct: 121 DFTVFHRMSAEISETTAMITDIATAPAEIDRCIRTTYVKQRTVYLGLPANLVDLTVPASL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           LETPIDL+LKPND EA              A NP+I+ADAC  RHDVK ET +LI+ TQF
Sbjct: 181 LETPIDLSLKPNDAEAENEVIETVLELVREAKNPIIIADACCSRHDVKSETEELINATQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKG+I+ER+PRFGGVYVGTLS   V+ AVESADL+LSVGALLSDFNTGSFSY+
Sbjct: 241 PSFTTPMGKGSINERHPRFGGVYVGTLSRPEVKAAVESADLVLSVGALLSDFNTGSFSYA 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           YKTKNIVEFHSD+IK++NATFPGVQMKFVL KL++ +G+A+KGY PV +P  +  N+  P
Sbjct: 301 YKTKNIVEFHSDHIKVKNATFPGVQMKFVLQKLVSKIGAAIKGYKPVAVPAGIPANKEVP 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
            +T L+QEW+WN++  F ++GDI+LTETGT+AFGINQ+ FP +T GISQVLWGSIGFTGG
Sbjct: 361 ANTPLKQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTTFPKDTYGISQVLWGSIGFTGG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
            VLGA+FAAEEI+P+KR ILFIGDGSLQLTVQEISTLIRW+LKPYLFVLNNNGYTIE+LI
Sbjct: 421 CVLGAAFAAEEINPNKRTILFIGDGSLQLTVQEISTLIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HGP A YN IQ W H ++L  FGA DYE +++ TTGEW  LT DK F + SKIRMIE+ML
Sbjct: 481 HGPTAQYNEIQGWNHLQILPTFGAKDYEALRVATTGEWIKLTTDKAFQKNSKIRMIEIML 540

Query: 541 PVMDAPSNLIAQAKLTACINSKK 563
           PVMDAPSNL+AQAKLTA  N+K+
Sbjct: 541 PVMDAPSNLVAQAKLTAATNAKQ 563

>TPHA0H00950 Chr8 (199181..200872) [1692 bp, 563 aa] {ON} Anc_5.122
           YLR044C
          Length = 563

 Score =  882 bits (2280), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/563 (76%), Positives = 480/563 (85%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M  +TLG+YLFERL QV  +TIFGLPGDFNLSLLDKIYEVPGMRWAGN NELNAAYAADG
Sbjct: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMAC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMSA ISETT+M+TDI +A AEIDRCI+ TY++QR VYLGLPAN+VDL VP  +
Sbjct: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           L TPIDL+LKPND +A              A NP+ILADACA RHDVK ET  LID TQF
Sbjct: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKG+IDE++PRFGGVYVGTLS   V+ AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           Y TKNIVEFHSD+IKIR A+FPGVQMKFVL KL+A VGS VKGY PV +P  +  N   P
Sbjct: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKPVAIPAPVPANPATP 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
            +T L+QEW+WN+V KF ++GDI+LTETGT+AFGINQ+ FP NT GISQVLWGSIGFTGG
Sbjct: 361 AETPLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIGFTGG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           A LGA+FAAEEIDP KR I+FIGDGSLQLTVQEIST+IRW+LKPY+FVLNNNGYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HGP A YN IQ W+H  +L  FGA DYE +++ TTGEW  L  DK FNE SKIRMIE+ML
Sbjct: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540

Query: 541 PVMDAPSNLIAQAKLTACINSKK 563
           PVMDAPSNLIAQAKLTA  N+K+
Sbjct: 541 PVMDAPSNLIAQAKLTAATNAKQ 563

>Suva_10.227 Chr10 (419251..420942) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score =  879 bits (2272), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/563 (75%), Positives = 476/563 (84%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLG+YLFERL QVD  T+FGLPGDFNLSLLDK+YEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVDCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+CIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMSANISETTAM+TDI  APAEIDRCIRTT+ TQRPVYLGLPANLVDL VP  L
Sbjct: 121 DFTVFHRMSANISETTAMITDIANAPAEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           LETPID+ LKPND EA              A NPVILADACA RHDVK ET KLID+TQF
Sbjct: 181 LETPIDMALKPNDAEAEAEVVRTVIEMIQDAKNPVILADACASRHDVKAETKKLIDLTQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKG+IDE++PR+GGVYVGTLS   V+ AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PTFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           Y+TKNIVEFHSD+IKIRNATFPGVQMKF L +LL+ +   VK Y PV +P R   N+  P
Sbjct: 301 YRTKNIVEFHSDHIKIRNATFPGVQMKFALQRLLSAIPEVVKDYKPVAVPARTPANKALP 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
             T ++QEWMWN++S F ++GDI++ ETGT+AFGINQ+ FP +   I QVLWGSIGFT G
Sbjct: 361 ASTPMKQEWMWNQLSTFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           A+LGA+ AAEEIDP KRVILFIGDGSLQLTVQEIST+IRW LKPY+FVLNNNGYTIE+LI
Sbjct: 421 ALLGATMAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HGP+A YN +QPW H  LL  FGA DYE  ++ TTGEW  LTQDK+F + S+IRMIEVML
Sbjct: 481 HGPHAEYNEVQPWDHLALLPTFGAKDYETHRVVTTGEWDKLTQDKEFQDNSRIRMIEVML 540

Query: 541 PVMDAPSNLIAQAKLTACINSKK 563
           PV DAP NL+ QA+LTA  N+K+
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAKQ 563

>Ecym_2479 Chr2 (938295..939989) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii ACL134C
          Length = 564

 Score =  878 bits (2268), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/563 (76%), Positives = 485/563 (86%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++T+G YLF+RL QV+V+TIFGLPGDFNL+LLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITIGHYLFQRLKQVEVQTIFGLPGDFNLTLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCVITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMSANISE+TAM+TD+ TA  EIDRCIRT Y++QRPVYLGLPANLVD  VP  L
Sbjct: 121 DFTVFHRMSANISESTAMITDVATAAREIDRCIRTCYISQRPVYLGLPANLVDAKVPASL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           LETPID +LKPND EA              + NPVIL+DACA RHDVK ET +LID+TQF
Sbjct: 181 LETPIDFSLKPNDAEAENEVVGTVLEMIANSKNPVILSDACASRHDVKEETKRLIDVTQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTPMGKG+IDE++PRFGGVYVGTLS+  V+ AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           YKTKNIVEFHSD+ K+RNATFPGVQMKFVL KL+ VVG   K Y PVP+P +        
Sbjct: 301 YKTKNIVEFHSDHTKVRNATFPGVQMKFVLKKLVDVVGDVAKNYVPVPVPTQPVHGSDVD 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
           P T LRQEW+W EV++F R+GD+++TETGT+AFGINQ+ FPN+T GISQVLWGSIGFT G
Sbjct: 361 PATPLRQEWIWREVARFLREGDVVITETGTSAFGINQTHFPNDTYGISQVLWGSIGFTTG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           A LGA+FAAEEIDP KRVILFIGDGSLQLTVQEIST+IRW LKPYLFVLNN+GYTIERLI
Sbjct: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HG  A YN IQPW H KLL  FGA DYE V+++T GEWQ LTQDK F+E SKIRMIEVML
Sbjct: 481 HGETAQYNDIQPWDHLKLLPTFGAKDYEAVRVSTAGEWQQLTQDKAFSENSKIRMIEVML 540

Query: 541 PVMDAPSNLIAQAKLTACINSKK 563
           PVMDAPSNL+ QA+LTA  N+K+
Sbjct: 541 PVMDAPSNLVKQAQLTAATNAKQ 563

>TPHA0Q00120 Chr17 complement(8844..10535) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  877 bits (2266), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/563 (75%), Positives = 478/563 (84%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M  +TLG+YLFERL QV   TIFGLPGDFNLSLLDKIYEVPGMRWAGN NELNAAYAADG
Sbjct: 1   MSQITLGKYLFERLKQVQCNTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMAC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMSA ISETT+M+TDI +A AEIDRCI+ TY++QR VYLGLPAN+VDL VP  +
Sbjct: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           L TPIDL+LKPND +A              A NP+ILADACA RHDVK ET  LID TQF
Sbjct: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDTTQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKG+IDE++PRFGGVYVGTLS   V+ AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           Y TKNIVEFHSD+IKIR A+FPGVQMKFVL KL+A VGS +KGY PV +P  +  N   P
Sbjct: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVIKGYKPVAIPAPVPANPATP 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
            +T L+QEW+WN+V KF ++GDI+LTETGT+AFGINQ+ FP NT GISQVLWGSIGFTGG
Sbjct: 361 AETPLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIGFTGG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           A LGA+FAAEEIDP KR I+FIGDGSLQLTVQEIST+IRW+LKPY+FVLNNNGYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HGP A YN IQ W+H  +L  FGA DYEN ++ TTGEW  L  D+ FNE SKIR+IE+ML
Sbjct: 481 HGPTAEYNEIQNWKHLDILSTFGAKDYENHRVATTGEWDKLASDRAFNENSKIRLIEIML 540

Query: 541 PVMDAPSNLIAQAKLTACINSKK 563
           PVMDAPSNLIAQAKLT   N+K+
Sbjct: 541 PVMDAPSNLIAQAKLTEATNAKQ 563

>Smik_12.197 Chr12 (392030..393721) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score =  874 bits (2257), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/563 (76%), Positives = 476/563 (84%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLG+YLFERL QV   T+FGLPGDFNLSLLDK+YEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVKCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KG+ACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGIACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMSANISETTAMVTDI  APAEIDRCIRTT+ TQRPVYLGLPANLVDL VP  L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIANAPAEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           LETPIDL+LKPND EA              A NPVILADACA RHDVK ET KLI++TQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVVRTVIEMIKDAKNPVILADACASRHDVKAETKKLIELTQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           P +VTPMGKG IDE++PR+GGVYVGTLS   V+  VE+ADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PVYVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKEGVENADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           YKTKNIVEFHSD+IKIRNATFPGVQMKF L KLL  + + VK Y PV +P R+  N+P P
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFALQKLLGAIPAVVKDYKPVAVPARVPLNKPSP 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
            +T ++QEWMWN++S F ++GDI++ ETGT+AFGINQ+ FP +   I QVLWGSIGFT G
Sbjct: 361 ANTPMKQEWMWNQLSNFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           A+LGA+ AAEEIDP KRVILFIGDGSLQLTVQEIST+IRW LKPY+FVLNNNGYTIE+LI
Sbjct: 421 ALLGATMAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HGP A YN IQ W H  LL  FGA DYEN +I TTGEW  LTQDK F + S+IR+IEVML
Sbjct: 481 HGPYADYNEIQGWDHLALLPTFGAKDYENHRIATTGEWDKLTQDKDFQDNSRIRLIEVML 540

Query: 541 PVMDAPSNLIAQAKLTACINSKK 563
           PV DAP NL+ QA+LTA IN+K+
Sbjct: 541 PVFDAPENLVQQAQLTASINAKQ 563

>YLR134W Chr12 (410723..412414) [1692 bp, 563 aa] {ON}  PDC5Minor
           isoform of pyruvate decarboxylase, key enzyme in
           alcoholic fermentation, decarboxylates pyruvate to
           acetaldehyde, regulation is glucose- and
           ethanol-dependent, repressed by thiamine, involved in
           amino acid catabolism
          Length = 563

 Score =  869 bits (2246), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/563 (75%), Positives = 473/563 (84%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLG+YLFERL QV+  T+FGLPGDFNLSLLDK+YEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVNCNTVFGLPGDFNLSLLDKLYEVKGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+CIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMSANISETTAM+TDI  APAEIDRCIRTTY TQRPVYLGLPANLVDL VP  L
Sbjct: 121 DFTVFHRMSANISETTAMITDIANAPAEIDRCIRTTYTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           LETPIDL+LKPND EA              A NPVILADACA RHDVK ET KL+D+TQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVVRTVVELIKDAKNPVILADACASRHDVKAETKKLMDLTQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           P +VTPMGKG IDE++PR+GGVYVGTLS   V+ AVESADLILS+GALLSDFNTGSFSYS
Sbjct: 241 PVYVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKKAVESADLILSIGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           YKTKNIVEFHSD+IKIRNATFPGVQMKF L KLL  +   VK Y PV +P R+   +  P
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFALQKLLDAIPEVVKDYKPVAVPARVPITKSTP 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
            +T ++QEWMWN +  F R+GDI++ ETGT+AFGINQ+ FP +   I QVLWGSIGFT G
Sbjct: 361 ANTPMKQEWMWNHLGNFLREGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           A+LGA+ AAEE+DP KRVILFIGDGSLQLTVQEIST+IRW LKPY+FVLNNNGYTIE+LI
Sbjct: 421 ALLGATMAAEELDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HGP+A YN IQ W H  LL  FGA +YE  ++ TTGEW+ LTQDK F + SKIRMIEVML
Sbjct: 481 HGPHAEYNEIQGWDHLALLPTFGARNYETHRVATTGEWEKLTQDKDFQDNSKIRMIEVML 540

Query: 541 PVMDAPSNLIAQAKLTACINSKK 563
           PV DAP NL+ QA+LTA  N+K+
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAKQ 563

>Skud_12.203 Chr12 (393390..395081) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score =  868 bits (2244), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/563 (74%), Positives = 475/563 (84%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLG+YLFERL QV+  T+FGLPGDFNLSLLDK+YEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVNCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+CIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAK LLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKHLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMSANISETTAM+TDI +AP+EIDRCIRTT+ TQRPVYLGLPANLVDL VP  L
Sbjct: 121 DFTVFHRMSANISETTAMITDIASAPSEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           L+TPID++LKPND EA              A NPVILADACA RHDVK ET KLI++TQF
Sbjct: 181 LDTPIDMSLKPNDAEAEAEVVRTVIEMIKDAKNPVILADACASRHDVKAETKKLIELTQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKG IDE++PR+GGVYVGTLS   V+ AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PIFVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           YKTKN+VEFHSD+IKIRNATFPGVQMKF L KLL  +   VK Y PV +P R+  N+  P
Sbjct: 301 YKTKNVVEFHSDHIKIRNATFPGVQMKFTLQKLLNAIPEVVKDYKPVAVPARVPINKATP 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
            +T ++QEWMWN++  F ++GDI++ ETGT+AFGINQ+ FP +   I QVLWGSIGFT G
Sbjct: 361 ANTSMKQEWMWNQLGNFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           A+LGA+ AAEE+DP KRVILFIGDGSLQLTVQEIST+IRW LKPY+FVLNNNGYTIE+LI
Sbjct: 421 ALLGATMAAEELDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HGP+A YN +Q W H  LL  FGA DYE  +ITTTGEW  LTQDK F + S+IRMIEVML
Sbjct: 481 HGPHAEYNEVQSWDHLSLLPTFGARDYETHRITTTGEWDKLTQDKDFQDNSRIRMIEVML 540

Query: 541 PVMDAPSNLIAQAKLTACINSKK 563
           PV DAP NL+ QA+LTA  N+K+
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAKQ 563

>TBLA0B10060 Chr2 complement(2418979..2420673) [1695 bp, 564 aa]
           {ON} 
          Length = 564

 Score =  867 bits (2239), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/563 (75%), Positives = 483/563 (85%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M  +TLG+YLFERL QV V+TIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MSQITLGKYLFERLNQVKVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMAC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS++SQAK+LLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVASQAKKLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DF  FHRMSA ISETTAM+TDI  APAEIDRCIRTTYVTQR VYLGLPANLVDL VP  L
Sbjct: 121 DFDAFHRMSAEISETTAMITDIANAPAEIDRCIRTTYVTQRTVYLGLPANLVDLMVPASL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           LETPIDL LKPN  E+              A NP+I+ADACA RH+VK ET +LID+TQF
Sbjct: 181 LETPIDLALKPNCPESESEVIETILDMVKNAKNPIIIADACASRHNVKKETEQLIDITQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           PAF TPMGKG+I+E++PRFGGVYVGTLS   ++ AVESADLILSVGALLSDFNTGSFSY+
Sbjct: 241 PAFTTPMGKGSINEKHPRFGGVYVGTLSRPEIKQAVESADLILSVGALLSDFNTGSFSYA 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           Y+TKNIVEFHSD++KI+NATF GVQMKFVL KL+A +G  +K Y PV +P  +  N+P P
Sbjct: 301 YQTKNIVEFHSDHMKIKNATFQGVQMKFVLEKLIAKIGDYIKDYKPVAVPAAVPANKPVP 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
            +T L+QEW+WN++  F ++GDI+LTETGT+AFGINQ+ FP +T GISQVLWGSIGFTGG
Sbjct: 361 AETPLKQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTTFPKDTYGISQVLWGSIGFTGG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
            VLGA+FAAEEI+P KR ILFIGDGSLQLTVQEISTLIRW+LKPYLFVLNNNGYTIE+LI
Sbjct: 421 CVLGAAFAAEEINPDKRTILFIGDGSLQLTVQEISTLIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HGP A YN IQ W H ++L  FGA DYE V++ TTGEW  LT DK FN+ SKIRMIE+ML
Sbjct: 481 HGPTAQYNEIQGWNHLQILPTFGAKDYEAVRVATTGEWDKLTTDKAFNKNSKIRMIEIML 540

Query: 541 PVMDAPSNLIAQAKLTACINSKK 563
           PVMDAPSNL+AQA+LTA IN+K+
Sbjct: 541 PVMDAPSNLVAQAQLTAAINAKQ 563

>AAL073W Chr1 (216809..218500) [1692 bp, 563 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGR087C (PDC6) and
           YLR134W (PDC5)
          Length = 563

 Score =  866 bits (2237), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/562 (74%), Positives = 481/562 (85%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLGRYLFERL QV+V+TIFG+PGDFNLSLLDK+YEV GMRWAGNANELNA+YAADG
Sbjct: 1   MSEITLGRYLFERLKQVEVRTIFGVPGDFNLSLLDKVYEVDGMRWAGNANELNASYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARVK ++C++TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS S+QAKQLLLHHTLGNG
Sbjct: 61  YARVKKISCLVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMSANIS+TTA++TDI +APAEIDRCIR  YV QRPVYLGLPAN+VDL VP  L
Sbjct: 121 DFTVFHRMSANISDTTAVITDISSAPAEIDRCIRACYVHQRPVYLGLPANMVDLTVPASL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           L T IDL+LKPND EA              A +PVIL+DACA RHDVK ET +LID+TQF
Sbjct: 181 LNTEIDLSLKPNDPEAEEEVVSTVLELVANAKHPVILSDACASRHDVKQETKQLIDVTQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTPMGKG+IDE++PRFGGVYVGTLS  +V+ AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRFGGVYVGTLSAPDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           YKTKNIVEFHSD+ KIR+ATFPG++MK VL  L+  +G A KGY P P+P    PNE   
Sbjct: 301 YKTKNIVEFHSDHTKIRSATFPGIKMKTVLQNLVKRIGEAAKGYQPSPVPTYAAPNEDAD 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
           P T L+QEW+WN+VS F ++GDI++TETGTAAFGINQ+ FP++TIGISQVLWGSIGFT G
Sbjct: 361 PKTPLKQEWLWNQVSSFLKEGDIVITETGTAAFGINQTRFPSSTIGISQVLWGSIGFTTG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           A LGA+FAAEEIDP+KRVILFIGDGSLQLTVQEIST++RW LKPYLFVLNN+GYTIERLI
Sbjct: 421 ACLGAAFAAEEIDPNKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HG  A YN IQPW+H  LL  FGA DYE  ++ TTGEW+ LT+ ++FN+ S IRMIE+ML
Sbjct: 481 HGETAQYNCIQPWKHLDLLPTFGAKDYETHRVATTGEWRALTEKQEFNKNSSIRMIEIML 540

Query: 541 PVMDAPSNLIAQAKLTACINSK 562
            VMDAPS+LI QAKLTA  N++
Sbjct: 541 DVMDAPSSLIKQAKLTAATNAQ 562

>NDAI0A02510 Chr1 complement(562483..564174) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  865 bits (2235), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/562 (71%), Positives = 468/562 (83%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLGRYLFERL+QV V TIFGLPGDFNL+LLDK+YEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLHQVSVDTIFGLPGDFNLTLLDKVYEVAGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVG PS +SQAK LLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGTPSTTSQAKGLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMS+NISETTAM+TDI  APAEIDRCIRTTY+ QRPVYLG+PAN  DL VP +L
Sbjct: 121 DFTVFHRMSSNISETTAMLTDITAAPAEIDRCIRTTYIAQRPVYLGIPANFFDLKVPANL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           L TPIDL+L  N+ EA              + NP+I+ DACA RHDVK ETNKLI++TQF
Sbjct: 181 LNTPIDLSLHENEPEAEKEALGMVLELVKKSKNPIIVVDACASRHDVKAETNKLIELTQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKG I+E++PR+GGVYVGTLS   V+ AVESADLILS+GALLSDFNTGSFSYS
Sbjct: 241 PTFVTPMGKGAINEQHPRYGGVYVGTLSRPEVKEAVESADLILSIGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           Y TK++VEFHSDY++I+ ATFPGVQMKF+L+KL  ++ + V+ Y P P+P R+  N P  
Sbjct: 301 YDTKSVVEFHSDYVRIKKATFPGVQMKFLLDKLNYIIPNYVQSYKPRPVPTRVPDNAPIG 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
           P T L+Q W+WN++SKF ++GDI++ ETGT+ FGIN++ FP N   ISQVLWGSIGF  G
Sbjct: 361 PSTSLKQAWLWNQLSKFLKEGDIVIVETGTSGFGINETTFPKNVTCISQVLWGSIGFATG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
             LGA+ AAEE+DP +RVILF GDGSLQLTVQEIST+IRW+LKPYLFVLNN GYTIE+LI
Sbjct: 421 CTLGATMAAEELDPKRRVILFTGDGSLQLTVQEISTMIRWNLKPYLFVLNNKGYTIEKLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HGP A YN IQ W H KLLE FGA DYEN +++TTG W  +T DK+FNE SKIRMIEVML
Sbjct: 481 HGPTAAYNEIQHWEHLKLLETFGAKDYENYRVSTTGAWNEMTGDKKFNENSKIRMIEVML 540

Query: 541 PVMDAPSNLIAQAKLTACINSK 562
           PVMDAP +LI Q +LTA INSK
Sbjct: 541 PVMDAPESLIKQGELTAQINSK 562

>YGR087C Chr7 complement(651290..652981) [1692 bp, 563 aa] {ON}
           PDC6Minor isoform of pyruvate decarboxylase,
           decarboxylates pyruvate to acetaldehyde, involved in
           amino acid catabolism; transcription is glucose- and
           ethanol-dependent, and is strongly induced during sulfur
           limitation
          Length = 563

 Score =  857 bits (2214), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/563 (74%), Positives = 480/563 (85%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLG+YLFERL QV+V TIFGLPGDFNLSLLDKIYEV G+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTIFGLPGDFNLSLLDKIYEVDGLRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KG++ ++TTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGLSVLVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMSANISETT+M+TDI TAP+EIDR IRTT++TQRP YLGLPANLVDL VP  L
Sbjct: 121 DFTVFHRMSANISETTSMITDIATAPSEIDRLIRTTFITQRPSYLGLPANLVDLKVPGSL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           LE PIDL+LKPND EA              + NPVIL+DACA RH+VK ET KLID+TQF
Sbjct: 181 LEKPIDLSLKPNDPEAEKEVIDTVLELIQNSKNPVILSDACASRHNVKKETQKLIDLTQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTP+GKG+IDE++PR+GGVYVGTLS ++V+ AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRYGGVYVGTLSKQDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           YKTKN+VEFHSDY+K++NATF GVQMKF L  LL V+   VKGY  VP+P +   N+  P
Sbjct: 301 YKTKNVVEFHSDYVKVKNATFLGVQMKFALQNLLKVIPDVVKGYKSVPVPTKTPANKGVP 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
             T L+QEW+WNE+SKF ++GD+I++ETGT+AFGINQ++FP +  GISQVLWGSIGFT G
Sbjct: 361 ASTPLKQEWLWNELSKFLQEGDVIISETGTSAFGINQTIFPKDAYGISQVLWGSIGFTTG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           A LGA+FAAEEIDP+KRVILFIGDGSLQLTVQEIST+IRW LKPYLFVLNN+GYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HGP+A YN IQ W H  LL AFGA  YEN KI TTGEW  LT D +F + S IR+IE+ L
Sbjct: 481 HGPHAEYNEIQTWDHLALLPAFGAKKYENHKIATTGEWDALTTDSEFQKNSVIRLIELKL 540

Query: 541 PVMDAPSNLIAQAKLTACINSKK 563
           PV DAP +LI QA+LTA  N+K+
Sbjct: 541 PVFDAPESLIKQAQLTAATNAKQ 563

>Kwal_33.15540 s33 (1147974..1149668) [1695 bp, 564 aa] {ON} YLR044C
           (PDC1) - pyruvate decarboxylase [contig 290] FULL
          Length = 564

 Score =  854 bits (2207), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/562 (76%), Positives = 477/562 (84%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLGRYLFERL QV+  TIFGLPGDFNL LLD+IYE  GMRWAGNANELNAAYAAD 
Sbjct: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWAGNANELNAAYAADA 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMSANISETTAM++D+ TAPAEIDRCIRTTYV QRPVYLGLP+N VD  VP  L
Sbjct: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           LETPIDL+LKPND  A              A NPVILADACA RHDVK ET KLID+TQF
Sbjct: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKG+IDE++PRFGGVYVGTLS+  V+ AVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           YKTKNIVEFHSD+IKIRNATFPGVQMKFVL KLL  VG  VK Y PV +P    PN    
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
             T L+Q+W+WN+V KF ++GD+++TETGT+AFGINQ+ FPNNT GISQVLWGSIGFT G
Sbjct: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           A LGA+FAAEE+D +KRVILFIGDGSLQLTVQEIST+IRW LKPYLFVLNNNGYTIE+LI
Sbjct: 421 ATLGAAFAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HG  A YN IQPW H  LL  FGA DYE V++ TTGEW  L +D++FN+ SKIRMIEVML
Sbjct: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540

Query: 541 PVMDAPSNLIAQAKLTACINSK 562
           PVMDAP +L+ QA+LTA  N+K
Sbjct: 541 PVMDAPESLVKQAQLTAATNAK 562

>Suva_7.369 Chr7 complement(627739..629430) [1692 bp, 563 aa] {ON}
           YLR134W (REAL)
          Length = 563

 Score =  853 bits (2203), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/563 (73%), Positives = 476/563 (84%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLGRYLFERL QV+V TIFGLPGDFNLSLLDKIYEV G+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVNVNTIFGLPGDFNLSLLDKIYEVDGLRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KG++ +ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGLSALITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMS NISETT+M+TDI TAP+EIDR IRTT+VTQRP YLGLPANLVDL VP  L
Sbjct: 121 DFTVFHRMSTNISETTSMITDIATAPSEIDRLIRTTFVTQRPSYLGLPANLVDLKVPASL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           L  PIDL+LKPND EA              + NP+IL+DACA RH VK ET KLID+TQF
Sbjct: 181 LNKPIDLSLKPNDPEAEKEVIDTVLELIQKSKNPIILSDACASRHHVKKETQKLIDLTQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTP+GKG+IDE++PR+GGVYVGTLS  +V+ AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRYGGVYVGTLSKPDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           YKTKN+VEFHSDYIK++NATFPGVQMKF L KLL+V+ S +K Y  VP+P +  PN+   
Sbjct: 301 YKTKNVVEFHSDYIKVKNATFPGVQMKFALQKLLSVIPSVIKSYKAVPVPTKTAPNKEVA 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
             T L+QEW+WNE+SKF ++GD+I++ETGT+AFGINQ+ FP +  GISQVLWGSIGFT G
Sbjct: 361 ASTPLKQEWLWNELSKFLQEGDVIVSETGTSAFGINQTSFPKDAYGISQVLWGSIGFTTG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           A LGA+FAAEE+DP++RVILFIGDGSLQLTVQEIST++RW LKPYLFVLNN+GYTIE+LI
Sbjct: 421 ATLGAAFAAEELDPNRRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HGP A YN IQ W H  LL  FGA  YEN K+ TTGEW  LT D +F + S IR+IE+ L
Sbjct: 481 HGPYAEYNEIQTWDHLALLPTFGAKKYENHKVATTGEWDKLTHDPEFQKNSVIRLIELKL 540

Query: 541 PVMDAPSNLIAQAKLTACINSKK 563
           PV DAP +LI QA+LTA  N+K+
Sbjct: 541 PVFDAPESLIKQAELTAATNAKQ 563

>SAKL0F04334g Chr6 complement(347639..349333) [1695 bp, 564 aa] {ON}
           uniprot|Q6XAE9 Saccharomyces kluyveri PDC13 Pyruvate
           decarboxylase
          Length = 564

 Score =  851 bits (2198), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/563 (73%), Positives = 474/563 (84%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLGRYLFERL QV V+TIFGLPGDFNLSLLDKIYEVPG+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVQVQTIFGLPGDFNLSLLDKIYEVPGLRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARVKGM+CI+TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SSQA+QLLLHHTLGNG
Sbjct: 61  YARVKGMSCIVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAQQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMS+ ISETTA++TDI  AP EIDRCI+ TY  QRPVYLGLPANLVDL V   L
Sbjct: 121 DFTVFHRMSSEISETTAVITDIKDAPKEIDRCIKVTYSKQRPVYLGLPANLVDLKVSASL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           L+TPIDL++ PND +A              A NPVILADAC  RHDVK ET KLID+TQF
Sbjct: 181 LDTPIDLSMTPNDADAEDEVVETVLAMVSKAKNPVILADACCTRHDVKRETKKLIDLTQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTPMGKG+IDE +PRFGGVYVGTLS+  V+ AVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEDHPRFGGVYVGTLSDPEVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           YKTKNIVEFHSDY K+RNATFPGVQMK VL KLL+ V  A  GY PVP+P     N    
Sbjct: 301 YKTKNIVEFHSDYTKVRNATFPGVQMKLVLQKLLSKVSDAASGYKPVPVPKGTRSNPGVE 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
             T L+QEW+WN +S +  +GD+++TETGT+AFGINQS FPN+T GISQVLWGSIG++ G
Sbjct: 361 SSTPLKQEWIWNHISDWLEEGDVVITETGTSAFGINQSRFPNSTYGISQVLWGSIGYSVG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           + LGA+FAAEE+D ++RVILF+GDGSLQLTVQEIST++RW LKPYLFVLNN+GYTIERLI
Sbjct: 421 SCLGAAFAAEELDKNRRVILFVGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HG  A YN +QPW H  LL  FGA DY++++I+TTGE+  LT+D+ F+  SKIR+IEVML
Sbjct: 481 HGETAQYNDVQPWLHLNLLPTFGAKDYDSIRISTTGEFLKLTEDQAFSRNSKIRLIEVML 540

Query: 541 PVMDAPSNLIAQAKLTACINSKK 563
           PVMDAPS L+ QA+LTA  N+K+
Sbjct: 541 PVMDAPSTLVKQAQLTAATNAKQ 563

>TBLA0D02840 Chr4 complement(694649..696340) [1692 bp, 563 aa] {ON}
           Anc_2.390 YDL080C
          Length = 563

 Score =  846 bits (2186), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/563 (71%), Positives = 475/563 (84%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M  +TLGRYLFERL Q+ ++TIFGLPGDFNL LLDKIYE+PGMRW GNANELNAAYAADG
Sbjct: 1   MSQVTLGRYLFERLNQIKIQTIFGLPGDFNLPLLDKIYEIPGMRWVGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+ +QAK+LLLHHTLG+G
Sbjct: 61  YARIKGMSCMITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLEAQAKKLLLHHTLGDG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DF  F+RMS+ ISET  M+ D+ TAPAEIDRCI+T YV QRPVYLGLP NLV+  VP  L
Sbjct: 121 DFNAFYRMSSEISETAVMIKDVTTAPAEIDRCIKTAYVMQRPVYLGLPVNLVNAMVPVSL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           L+TPIDL+L+PND ++              A NP+I+ADACA RHDVK ET KLID+TQF
Sbjct: 181 LQTPIDLSLRPNDADSESEVIQTILEMVKQAKNPIIIADACASRHDVKAETEKLIDITQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKG+I+E++PRFGGVYVGTL+   V+ AVESADLILS+GALLSDFNTGSFSY+
Sbjct: 241 PSFVTPMGKGSINEQHPRFGGVYVGTLTRPEVKKAVESADLILSIGALLSDFNTGSFSYN 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           Y+TKN++EFHSD+ KI+NA + G+QMKFVL+KL+  +G  VK Y PV +P  +  N    
Sbjct: 301 YETKNVIEFHSDHTKIKNAVYEGIQMKFVLSKLITKIGEVVKNYKPVAVPAPILANPKTS 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
           P+T LRQEW+WN++  F ++GDI+LTETGT+AFGINQ+ FP NT GISQVLWGSIGFTGG
Sbjct: 361 PETPLRQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTYFPKNTYGISQVLWGSIGFTGG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
            VLGA+FAAEEIDP KRV+LFIGDGSLQLTVQEIST++ W+LKPYLFVLNN+GYTIERLI
Sbjct: 421 CVLGAAFAAEEIDPKKRVVLFIGDGSLQLTVQEISTMVNWNLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HGP A YN IQPW + +LL  FGA DY+ V++ TTGEW  LTQ+ +FN+ SKIRMIEVML
Sbjct: 481 HGPTAQYNEIQPWNNLELLSTFGAKDYQAVRVATTGEWNILTQNPEFNQNSKIRMIEVML 540

Query: 541 PVMDAPSNLIAQAKLTACINSKK 563
           P MDAPSNLI+QA+LTA IN+K+
Sbjct: 541 PTMDAPSNLISQAELTASINAKQ 563

>TBLA0E03070 Chr5 (771183..772874) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  846 bits (2185), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/563 (72%), Positives = 471/563 (83%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLG+YLFERL QV+V TIFGLPGDFNL+LLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS +SQAK+LLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTTSQAKKLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DF VFHRMS  ISETTAM+TD+  A ++ID CIR TY TQRPVYLG+PAN+ D  +P  L
Sbjct: 121 DFDVFHRMSTEISETTAMITDLSKAASQIDNCIRVTYTTQRPVYLGIPANMFDFTLPAKL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           LETPI++ L PN+QE+              A NPVI+ADAC  RH+VK ET KLID TQF
Sbjct: 181 LETPINMKLSPNNQESEDEVVETILRMVKGAKNPVIIADACCSRHNVKAETEKLIDATQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           PAF TPMGKG+I+E +PRFGGVYVGTL+   V+ AVESADLILSVGALLSDFNTG+FSY 
Sbjct: 241 PAFTTPMGKGSINEHHPRFGGVYVGTLTRPEVKKAVESADLILSVGALLSDFNTGTFSYD 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           Y+TKNIVEFHSD+IKI+NATF GVQMKFVL++L+  +G  VK Y PVP+P  +  N+PCP
Sbjct: 301 YETKNIVEFHSDHIKIKNATFQGVQMKFVLDRLIKEIGDYVKDYKPVPVPAGIPDNKPCP 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
            +T L+QEW+WN++  F ++GDI+LTETGT+AFGIN + FP NT GI+QVLWGSIGFTGG
Sbjct: 361 DETPLQQEWLWNQLGNFLQEGDIVLTETGTSAFGINHTKFPKNTYGINQVLWGSIGFTGG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
            VLGA+FAAEEIDP KRV LFIGDGSLQLTVQEIST+IRW+LKPYLFVLNNNGYTIE+LI
Sbjct: 421 CVLGAAFAAEEIDPKKRVHLFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HGP A YN IQ W H  +L  FGA DYE +++ T GEW  LT D +FN+ SKIRMIE+ML
Sbjct: 481 HGPTAQYNEIQGWDHLSILPTFGATDYEAIRVATIGEWNKLTTDDKFNKNSKIRMIEIML 540

Query: 541 PVMDAPSNLIAQAKLTACINSKK 563
           PVMDAPSNLIAQ KLT  IN+ +
Sbjct: 541 PVMDAPSNLIAQGKLTEAINAAQ 563

>NCAS0A14240 Chr1 (2804135..2805832) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  843 bits (2179), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/564 (72%), Positives = 471/564 (83%), Gaps = 2/564 (0%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M  ++LGRYLFERL+QV V TIFGLPGDFNL+LLDKIYEVPGMRWAGNANELNAAYAADG
Sbjct: 1   MSTISLGRYLFERLHQVSVDTIFGLPGDFNLTLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARVKGMAC++TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS SSQAK LLLHHTLGNG
Sbjct: 61  YARVKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSSQAKNLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFTVFHRMS+NISETT++VTD+  APAEIDRCIR TY+ QRPVYLG+PAN  DLP+   L
Sbjct: 121 DFTVFHRMSSNISETTSIVTDVAQAPAEIDRCIRETYIKQRPVYLGIPANFFDLPISAKL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           L TPIDL+L  ND+EA              A NP+IL DACA RHDVK ET KLID+TQ+
Sbjct: 181 LNTPIDLSLHENDEEAETEAIDLVLGLVKDAVNPIILVDACASRHDVKEETKKLIDITQY 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKG I+E++PR+GGVYVG L++  ++ AVESADLILSVGALLSDFNTGSFSY 
Sbjct: 241 PTFVTPMGKGAINEQHPRYGGVYVGNLTDPAIKEAVESADLILSVGALLSDFNTGSFSYG 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
            KTKN+VEFHSDY+KIRNA+FPGVQMKFVL KL   +    K Y PVP+P +   N+   
Sbjct: 301 LKTKNVVEFHSDYVKIRNASFPGVQMKFVLQKLNRQLPPYTKNYKPVPVPTKTASNKNVA 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
             T ++QEWMWN+++KF ++GDI+++ETGT+ FGINQ+ FPNNT GISQVLWGSIGF  G
Sbjct: 361 ASTPMKQEWMWNQLAKFLQEGDIVISETGTSGFGINQTSFPNNTTGISQVLWGSIGFATG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
             LGA+ AAEEIDP KRVILF GDGSLQLTVQEIST++RW+LKPYLFVLNNNGYTIE+LI
Sbjct: 421 CTLGATMAAEEIDPKKRVILFTGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGAND--YENVKITTTGEWQTLTQDKQFNEPSKIRMIEV 538
           HG +AGYN IQPW H +L  AFGA +  +EN +++TTGEW  LT+ KQF + +KIRMIEV
Sbjct: 481 HGEHAGYNEIQPWNHLELFHAFGAKEGTFENHRVSTTGEWNKLTESKQFQDNTKIRMIEV 540

Query: 539 MLPVMDAPSNLIAQAKLTACINSK 562
           MLPVMDAP++LI QAKLTA IN+K
Sbjct: 541 MLPVMDAPTSLIKQAKLTASINAK 564

>KNAG0J01330 Chr10 complement(240650..242344) [1695 bp, 564 aa] {ON}
           
          Length = 564

 Score =  832 bits (2150), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/563 (71%), Positives = 466/563 (82%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M  ++LG YLFERL QV V TIFGLPGDFNL LLDKIY++PGMRW GNANELNA+YAADG
Sbjct: 1   MSTVSLGHYLFERLKQVGVNTIFGLPGDFNLVLLDKIYDIPGMRWVGNANELNASYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMAC++TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS  SQAK LLLHHTLGNG
Sbjct: 61  YARIKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTLSQAKGLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DF VFHRMSA ISETTA++TD+  A +EIDRCIRTTYV QR VYLG+PAN+ D  +P  L
Sbjct: 121 DFDVFHRMSAEISETTAVITDLSKAASEIDRCIRTTYVKQRTVYLGIPANMFDYEMPRSL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           L+TPIDL+LK N+ E+              A NP+ILADACA RHDVK ET +LID TQF
Sbjct: 181 LDTPIDLSLKANNPESESEVLDTILDLVSKAKNPIILADACASRHDVKKETQQLIDATQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTPMGKG+IDE +PR+GG+YVGTLS+  V+ AVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDETHPRYGGIYVGTLSSPAVKKAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           Y+TKNIVEFHSD+IKIRNA FP +QMK +L KL+  +   +  Y+PV +P R   N    
Sbjct: 301 YQTKNIVEFHSDHIKIRNALFPDMQMKSILQKLITQIKPVIANYSPVAVPARAPANAAVD 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
           P T L+QEWMW E+  F ++GDI++TETGT+AFGIN + FP NT+GISQVLWGSIGFTGG
Sbjct: 361 PSTPLKQEWMWKELGNFLQEGDIVITETGTSAFGINGTTFPKNTVGISQVLWGSIGFTGG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           AVLGA+FAAEEIDP++RVILFIGDGSLQLTVQEIST I+W+LKPYLF+LNNNGYTIE+LI
Sbjct: 421 AVLGAAFAAEEIDPNRRVILFIGDGSLQLTVQEISTCIKWNLKPYLFILNNNGYTIEKLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HGP A YN IQ W H +LL  FGA DYE V+I T GEW  LTQDK+FN+ S+IR+IEVML
Sbjct: 481 HGPTAQYNEIQSWEHLQLLPTFGAKDYEAVRIATVGEWNKLTQDKEFNKNSRIRLIEVML 540

Query: 541 PVMDAPSNLIAQAKLTACINSKK 563
           PVMDAP +LI Q +LTA IN+KK
Sbjct: 541 PVMDAPESLIKQGQLTAAINAKK 563

>KNAG0J01340 Chr10 complement(243186..244883) [1698 bp, 565 aa] {ON}
           
          Length = 565

 Score =  813 bits (2100), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/562 (70%), Positives = 462/562 (82%), Gaps = 1/562 (0%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M  ++LG YLFERL QV V TIFGLPGDFNL LLDKIY+VPG+RWAGNANELNAAYAADG
Sbjct: 1   MSTISLGHYLFERLKQVGVNTIFGLPGDFNLVLLDKIYDVPGIRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMAC++TTFGVGELSALNGIAGSYAEHVGVLHVVG PS  SQA  LLLHHTLGNG
Sbjct: 61  YARIKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGTPSTHSQANGLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DF VFHRMSA ISETT M+TD   A  +IDRCIRTTYV QR VYLG+PAN+ D  +P  L
Sbjct: 121 DFDVFHRMSAQISETTEMITDPHKAADQIDRCIRTTYVKQRTVYLGIPANMFDYEMPRSL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           L+TPIDL+LK N+  +              A NP+I++DACA RHDVK ET +LI++TQF
Sbjct: 181 LDTPIDLSLKANNPTSERQVLDTILQSVKDAKNPIIISDACASRHDVKEETQQLINITQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTP+GKG+IDE +PR+GG+YVGTLS   V+ AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDETHPRYGGIYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           Y+TKN+VEFHSD++KI+NA FPGVQM+ +L KLL  + + VKGY PV +P ++  N+   
Sbjct: 301 YETKNVVEFHSDHMKIKNAVFPGVQMEPLLRKLLKEIPAVVKGYNPVAVPAKIPANDKSI 360

Query: 361 PDTI-LRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTG 419
             T  LRQEWMWN++S+F ++GDII+TETGT+AFGIN + FP N +GISQVLWGSIGFT 
Sbjct: 361 SATAPLRQEWMWNQLSEFLQEGDIIITETGTSAFGINGTTFPKNAVGISQVLWGSIGFTV 420

Query: 420 GAVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERL 479
           GA+LGA+FAAEEIDP KRVILFIGDGSLQLTVQEIST+I+W+LKPYLF+LNNNGYTIE+L
Sbjct: 421 GALLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIKWNLKPYLFILNNNGYTIEKL 480

Query: 480 IHGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVM 539
           IHGP A YN IQ W H KLL   GA DYE V++ T GEW  LTQDK+FN+ S+IR+IEVM
Sbjct: 481 IHGPTAEYNEIQSWDHLKLLPTLGAKDYEAVRVATVGEWNKLTQDKEFNKNSRIRVIEVM 540

Query: 540 LPVMDAPSNLIAQAKLTACINS 561
           LPVMDAP +LI Q KLT  IN+
Sbjct: 541 LPVMDAPQSLIEQGKLTEKINA 562

>KLTH0D08272g Chr4 complement(695296..696987) [1692 bp, 563 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 563

 Score =  811 bits (2096), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/562 (69%), Positives = 464/562 (82%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M  +TLGRYLFERL QV+  TIFGLPGDFNL LLD+IYEV GMRWAGN NELNAAYAADG
Sbjct: 1   MSSITLGRYLFERLRQVECFTIFGLPGDFNLRLLDEIYEVEGMRWAGNTNELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KG+AC+ITTFGVGELSALNG+ GSYAEHVGVLHVVGVPS++SQAKQ LLHHTLG+G
Sbjct: 61  YARLKGIACLITTFGVGELSALNGVVGSYAEHVGVLHVVGVPSLASQAKQQLLHHTLGDG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DF VFHRMSANIS+TTAMVTD+ TAP EIDRCIRTTYVTQRPVYLGLPAN+V+  V   L
Sbjct: 121 DFAVFHRMSANISQTTAMVTDLATAPQEIDRCIRTTYVTQRPVYLGLPANIVNQMVDRRL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           L+TPIDL+L+PND++               A NP+ILADAC  RHD K E  +L D TQF
Sbjct: 181 LDTPIDLSLEPNDEDTEEEVLTQVLALVQKAQNPIILADACCSRHDAKKEAWQLTDATQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKG++ E++PRFGGVYVGTLS+ +V++AVE+ADLILS+GALLSDFNTGSFSYS
Sbjct: 241 PCFVTPMGKGSVPEKHPRFGGVYVGTLSSPDVKSAVEAADLILSLGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           Y T+N+VEFHSD+ K+RNA FP V MKFVL KL+  + +A++ Y+P P+P R   N P P
Sbjct: 301 YGTRNVVEFHSDHTKVRNAIFPRVGMKFVLQKLIQRIPAAIQHYSPRPVPTRPARNAPTP 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
            DT L QEW+W ++ +F R+GD+++TETGT+AFGINQ+ FPNNT GISQVLWGSIGFT G
Sbjct: 361 RDTPLTQEWLWTQIGEFLREGDVVVTETGTSAFGINQTRFPNNTYGISQVLWGSIGFTTG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           A LGA+ AAEE+D +KRVILFIGDGSLQLTVQEIS+++RW L+PYLFV NN+GYTIE+LI
Sbjct: 421 ATLGAAMAAEELDKNKRVILFIGDGSLQLTVQEISSMVRWGLRPYLFVPNNDGYTIEKLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HGP A YN IQ W H +LL  FGA DYE V++ TTGEW  LT D  FN  S+IR++EVML
Sbjct: 481 HGPTAQYNEIQNWHHLRLLPTFGATDYEAVRVATTGEWDALTNDPAFNRNSRIRLVEVML 540

Query: 541 PVMDAPSNLIAQAKLTACINSK 562
            VMDAPS+L+ QA+LTA  N++
Sbjct: 541 EVMDAPSSLVRQAQLTAATNAQ 562

>NDAI0D03270 Chr4 (778452..780017) [1566 bp, 521 aa] {ON} 
          Length = 521

 Score =  804 bits (2076), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/520 (73%), Positives = 430/520 (82%)

Query: 43  MRWAGNANELNAAYAADGYARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP 102
           MRWAGNANELNAAYAADGYARVKGM+CIITTFGVGELSALNGIAGSYAEHVGVLHVVG P
Sbjct: 1   MRWAGNANELNAAYAADGYARVKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGTP 60

Query: 103 SISSQAKQLLLHHTLGNGDFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRP 162
           S +SQAK LLLHHTLGNGDFTVFHRMS+N+SETTAM+TD+ TAPAEIDRCIRTTY+ QRP
Sbjct: 61  STTSQAKNLLLHHTLGNGDFTVFHRMSSNLSETTAMITDVTTAPAEIDRCIRTTYIAQRP 120

Query: 163 VYLGLPANLVDLPVPTHLLETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACA 222
           VYLG+PAN  DL VP  LL TPIDL L PN+ EA              + NP IL DACA
Sbjct: 121 VYLGIPANYFDLKVPAALLNTPIDLELHPNEPEAEKEALDMILELIKDSKNPAILVDACA 180

Query: 223 GRHDVKVETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLI 282
            RHDVK ETNKLI++TQFP FVTPMGKG I+E++PR+GGVYVGTLS   V+ AVESADLI
Sbjct: 181 SRHDVKAETNKLIELTQFPHFVTPMGKGAINEQHPRYGGVYVGTLSKPEVKKAVESADLI 240

Query: 283 LSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVK 342
           LSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFVL+KL A++   V 
Sbjct: 241 LSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFVLDKLNAIIPEVVT 300

Query: 343 GYTPVPLPPRLTPNEPCPPDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPN 402
           GY P  +P R   N+     T L+Q WMWN++SKF ++GD+++ ETGT  FGIN++ FP 
Sbjct: 301 GYKPTAVPARAPANKAVSGTTPLKQAWMWNQLSKFLKEGDVVIVETGTPGFGINETTFPK 360

Query: 403 NTIGISQVLWGSIGFTGGAVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDL 462
           N IGISQVLWGSIG+  G  LGA+ AAEE+DP KRVILF GDGSLQLTVQEIST+IRW+L
Sbjct: 361 NVIGISQVLWGSIGYATGCTLGATMAAEELDPHKRVILFTGDGSLQLTVQEISTMIRWNL 420

Query: 463 KPYLFVLNNNGYTIERLIHGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLT 522
           +PYLF+LNNNGYTIE+LIHGP A YN IQ W H KLLE FGA DYEN ++ TTGEW  LT
Sbjct: 421 RPYLFILNNNGYTIEKLIHGPTAQYNEIQSWDHLKLLETFGAKDYENHRVATTGEWTKLT 480

Query: 523 QDKQFNEPSKIRMIEVMLPVMDAPSNLIAQAKLTACINSK 562
           ++K FN+ S+IR+IEVMLPVMDAP +LI Q +LTA IN+K
Sbjct: 481 ENKDFNKNSRIRVIEVMLPVMDAPESLIKQGELTAKINAK 520

>CAGL0G02937g Chr7 complement(268985..270679) [1695 bp, 564 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044c PDC1 or uniprot|P16467 Saccharomyces
           cerevisiae YLR134w PDC5 or uniprot|P26263 Saccharomyces
           cerevisiae YGR087c PDC6
          Length = 564

 Score =  780 bits (2013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/567 (67%), Positives = 451/567 (79%), Gaps = 9/567 (1%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++TLGRYLFERL+Q+ + TIFGLPGDFNL+LLDKIYEV G+RWAGNANELNAAYAADG
Sbjct: 1   MTEITLGRYLFERLHQIHIDTIFGLPGDFNLTLLDKIYEVEGLRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMAC++TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS  S+AKQLLLHHTLGNG
Sbjct: 61  YARLKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTVSRAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DF  FHRMS+ ISETT +V+D  TAPAEIDRCIR  Y+TQRPVYLG+PAN+ D  V + L
Sbjct: 121 DFDAFHRMSSVISETTFIVSDPQTAPAEIDRCIRVCYLTQRPVYLGIPANMFDSKVSSKL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           L+TPIDL L+PN  +A              +  P+ILADAC  RHDVK ET +LI++TQF
Sbjct: 181 LDTPIDLALRPNLPDAEREVLDEIITMIKASKRPIILADACTSRHDVKKETKRLIEVTQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKG+IDE  PRFGGVYVG LS+  V+  VE +DL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PSFTTPMGKGSIDEDTPRFGGVYVGNLSDPEVKTFVEESDLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
             T+N++EFHSD++KIRNATFPGVQMKFVL KLL  + + VKG T      R+ P +  P
Sbjct: 301 LNTRNVIEFHSDHMKIRNATFPGVQMKFVLEKLLEELPAVVKGRT----DNRVVPRQKEP 356

Query: 361 PDTI-----LRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSI 415
             T+     ++QEWMW  V KF ++GD+++TETGT+ FGI +S FP NT+GISQVLWGSI
Sbjct: 357 STTLNGKDAIKQEWMWKHVGKFLQEGDVVVTETGTSGFGIVESKFPRNTVGISQVLWGSI 416

Query: 416 GFTGGAVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYT 475
           G+  G+ +GA+FAA+EIDP KRVILFIGDGSLQLTVQE+ST  RW L PY+FVLNNNGYT
Sbjct: 417 GYALGSTVGAAFAAQEIDPKKRVILFIGDGSLQLTVQELSTAARWGLTPYIFVLNNNGYT 476

Query: 476 IERLIHGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRM 535
           IERLIHG   GYN IQ W H+ +L AFGA +YEN ++ T GEW  +  DKQFN+  K+RM
Sbjct: 477 IERLIHGETQGYNDIQSWDHSLILPAFGAKNYENKRVATYGEWNDMVNDKQFNKNDKLRM 536

Query: 536 IEVMLPVMDAPSNLIAQAKLTACINSK 562
           IEVMLP MD P NL  QAKLTA IN+K
Sbjct: 537 IEVMLPTMDGPENLKKQAKLTASINAK 563

>Ecym_3185 Chr3 (352629..354320) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AAL073W
          Length = 563

 Score =  762 bits (1968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/563 (63%), Positives = 440/563 (78%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M ++++GRYLFERL QV VKTIFGLPGDFNLSLLDK+YEVPG+RWAGNANELNAAYAADG
Sbjct: 1   MSEISIGRYLFERLNQVGVKTIFGLPGDFNLSLLDKLYEVPGLRWAGNANELNAAYAADG 60

Query: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARV GM C++TTFGVGELSA+NGIAGSYAE + VLHVVGVPS   QAK+LLLHHTLG+G
Sbjct: 61  YARVNGMGCLVTTFGVGELSAINGIAGSYAECISVLHVVGVPSTMVQAKRLLLHHTLGDG 120

Query: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180
           DFT FHRM   I++TTA+++D  TA +EIDRCI+T  +T  PVYLG+PAN+    +   L
Sbjct: 121 DFTAFHRMYQRITKTTAILSDDATAASEIDRCIKTCIMTHGPVYLGVPANMATATIDASL 180

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           LETPIDL+ + NDQ+A              A NP+IL+DACA R+D+K E   LID+TQF
Sbjct: 181 LETPIDLSPELNDQDAENEVIDAVLHLIQNARNPIILSDACASRYDIKEEIKTLIDITQF 240

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
           P +VTPMGK +++E++PR+GGVY G++S   V+ AVESADLILS+G+LL+D NTG+FS S
Sbjct: 241 PTYVTPMGKSSVNEQHPRYGGVYAGSISKPEVKKAVESADLILSIGSLLADMNTGNFSQS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360
           Y TK+IVEFHS +  I+NATF GVQMKFVL KL   VG  V+ Y PVP+  + +PN+P  
Sbjct: 301 YSTKDIVEFHSTFTMIKNATFNGVQMKFVLQKLAEKVGDVVQNYVPVPIASKPSPNKPLD 360

Query: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420
           P T L Q+W+W EVS F ++GDI++ E+GT AFGIN+   P  T  ISQ+LWGSIG+T G
Sbjct: 361 PLTPLAQQWLWKEVSTFLKEGDIVIAESGTPAFGINEVTLPTGTRCISQLLWGSIGYTVG 420

Query: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480
           A LG   A +EIDPS+RVILFIGDGSLQL VQE+ST+IRW LKPYLFVLNN+GYTIERLI
Sbjct: 421 ACLGICLATQEIDPSRRVILFIGDGSLQLAVQELSTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
           HGP A YN IQPW H +LL  FGA +YE V+I+T G W  LTQD +FNE SKIR+IE++L
Sbjct: 481 HGPEAQYNDIQPWNHLQLLPDFGAKNYEAVRISTVGGWSQLTQDPEFNESSKIRLIELIL 540

Query: 541 PVMDAPSNLIAQAKLTACINSKK 563
           P +D+   L+ QAK+   INSK+
Sbjct: 541 PRLDSTDALVKQAKMITDINSKR 563

>SAKL0E04972g Chr5 (403578..405413) [1836 bp, 611 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080C THI3
           Probable decarboxylase required for expression of
           enzymes involved in thiamine biosynthesis may have a
           role in catabolism of amino acids to long-chain and
           complex alcohols
          Length = 611

 Score =  697 bits (1800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/548 (59%), Positives = 419/548 (76%), Gaps = 1/548 (0%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           ++LG YLF+RL Q+ V+TIFGLPGDFN++LLDKIYEVPG+RWAGN NELNAAYAADGYAR
Sbjct: 14  ISLGHYLFQRLRQLQVQTIFGLPGDFNMALLDKIYEVPGLRWAGNTNELNAAYAADGYAR 73

Query: 64  VKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
           +KG+ C++TTFGVGELSA+NGIAGS+AEHV VLHVVG+P+  +Q K+LLLHHTLGNGD+ 
Sbjct: 74  IKGLGCLVTTFGVGELSAINGIAGSFAEHVAVLHVVGMPASHAQVKKLLLHHTLGNGDYA 133

Query: 124 VFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHLLET 183
           VFHRM+AN++  T +++D  TA  EID+C++  +  QRPVYLG+P NL ++ V   +L+ 
Sbjct: 134 VFHRMAANMAAYTTVLSDSETATKEIDKCLKIAWKRQRPVYLGIPMNLANMIVDGSMLQI 193

Query: 184 PIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQFPAF 243
           P+DL+LK ND E               A NPVI+ADAC  RHDV  ET +L+D+TQFP F
Sbjct: 194 PLDLSLKRNDPEVEKDVVNSIVQEMKRAKNPVIIADACVTRHDVIQETRRLVDLTQFPVF 253

Query: 244 VTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG IDE++PRFGGVYVG++S+  VR  V+ AD IL  G +LSDFNT SF++SYK 
Sbjct: 254 VTPMGKGAIDEQHPRFGGVYVGSMSSPEVREVVDFADFILVAGTVLSDFNTSSFNFSYKA 313

Query: 304 KNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCPPDT 363
           KN+V  ++++ K++NA +P +++KFVL  LL  + +    Y P P+P  + P      + 
Sbjct: 314 KNVVLLYANHAKLKNAMYPDMKLKFVLQSLLQSLSNITLPYKPQPVPEMIKPRVTLQDNV 373

Query: 364 ILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGAVL 423
            LRQEW+WN++S +F +GDI++TETGT+AFGINQ+ FPNNT  ISQVLWGSIG++ GA L
Sbjct: 374 PLRQEWVWNQISHWFHEGDIVITETGTSAFGINQTRFPNNTRAISQVLWGSIGYSLGACL 433

Query: 424 GASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLIH-G 482
           GASFA EE+    RVILF+GDG+LQLTVQEIST+IRW LKPYLFV+NN GYTI+RL+H  
Sbjct: 434 GASFAVEELGTKNRVILFVGDGALQLTVQEISTMIRWGLKPYLFVMNNKGYTIDRLLHKS 493

Query: 483 PNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVMLPV 542
             AGY+ IQPW + KLL AFGA +Y+  K+TT G++  L  D QF    K++MIEV+LP 
Sbjct: 494 STAGYHDIQPWDNLKLLPAFGAVNYDARKVTTVGDFLKLVHDPQFAIDDKLKMIEVVLPS 553

Query: 543 MDAPSNLI 550
           MDAP  L+
Sbjct: 554 MDAPPALL 561

>Suva_4.167 Chr4 complement(300197..302059) [1863 bp, 620 aa] {ON}
           YDL080C (REAL)
          Length = 620

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/554 (50%), Positives = 392/554 (70%), Gaps = 7/554 (1%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           + +  YLF RL Q+++ TIFGL G+F++ LLDK+Y++P +RWAGN+NELNAAYAADGY+R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYDIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  VKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
           +KG+ C+ITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  S+Q KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHLLET 183
           VFHR++++++  T ++ D      E+D+CI+  ++ QRPVY+G+P N V+LP+ +  L T
Sbjct: 135 VFHRIASDVACYTTLIVDSDLCADEVDKCIQKAWIEQRPVYMGMPVNQVNLPIESERLNT 194

Query: 184 PIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQFPAF 243
           P+DL L  ND +               + NP I+ DAC  R ++  E  +L    +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVITRILSFIYKSKNPAIIVDACTSRQNLIEEAKELCSRLKFPIF 254

Query: 244 VTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKGT++E +P+FGGV+ G++S   VR  V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCPPDT 363
           KN    +S  +K++NAT+P + +K +L KLLA +  +   Y P   P  + P      + 
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSVKILLQKLLATLDESKLSYRPDEQPSMMVPRPYPAGNV 374

Query: 364 ILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGAVL 423
           +LRQEW+WNE+S++F+ GDII+TETG +AFG+NQ+ FP NT+GISQ LWGS+G+T GA L
Sbjct: 375 LLRQEWVWNEISRWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 GASFAAEEIDPSK------RVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIE 477
           GA FA +EI+  K      RVILF+GDG+ QLTVQE+ST+++W L PY+FV+NN GY+++
Sbjct: 435 GAEFAVQEINKDKFPATKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 RLIHG-PNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMI 536
           R +H   +A Y  IQPW +  LL  FG  +YE  KI T GE++++  D  F    KIRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMINDANFAVNDKIRMI 554

Query: 537 EVMLPVMDAPSNLI 550
           E+MLP  D P  L+
Sbjct: 555 EIMLPPRDVPQALL 568

>YDL080C Chr4 complement(310642..312471) [1830 bp, 609 aa] {ON}
           THI3Probable alpha-ketoisocaproate decarboxylase, may
           have a role in catabolism of amino acids to long-chain
           and complex alcohols; required for expression of enzymes
           involved in thiamine biosynthesis
          Length = 609

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/554 (50%), Positives = 392/554 (70%), Gaps = 7/554 (1%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           + +  YLF RL Q+++ TIFGL G+F++ LLDK+Y +P +RWAGN+NELNAAYAADGY+R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYNIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  VKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
           +KG+ C+ITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  S+Q KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHLLET 183
           VFHR++++++  T ++ D      E+D+CI+  ++ QRPVY+G+P N V+LP+ +  L T
Sbjct: 135 VFHRIASDVACYTTLIIDSELCADEVDKCIKKAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 184 PIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQFPAF 243
           P+DL L  ND +               + NP I+ DAC  R ++  ET +L +  +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVISRILSFIYKSQNPAIIVDACTSRQNLIEETKELCNRLKFPVF 254

Query: 244 VTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKGT++E +P+FGGV+ G++S   VR  V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCPPDT 363
           KN    +S  +K++NAT+P + +K +L K+LA +  +   Y P   P  + P      + 
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSIKLLLQKILANLDESKLSYQPSEQPSMMVPRPYPAGNV 374

Query: 364 ILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGAVL 423
           +LRQEW+WNE+S +F+ GDII+TETG +AFG+NQ+ FP NT+GISQ LWGS+G+T GA L
Sbjct: 375 LLRQEWVWNEISHWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 GASFAAEEIDPSK------RVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIE 477
           GA FA +EI+  K      RVILF+GDG+ QLTVQE+ST+++W L PY+FV+NN GY+++
Sbjct: 435 GAEFAVQEINKDKFPATKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 RLIHG-PNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMI 536
           R +H   +A Y  IQPW +  LL  FG  +YE  KI T GE++++  D  F    KIRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMISDPNFATNDKIRMI 554

Query: 537 EVMLPVMDAPSNLI 550
           E+MLP  D P  L+
Sbjct: 555 EIMLPPRDVPQALL 568

>ZYRO0A08426g Chr1 complement(675104..676858) [1755 bp, 584 aa] {ON}
           similar to uniprot|Q07471 Saccharomyces cerevisiae
           YDL080C THI3 Probable decarboxylase required for
           expression of enzymes involved in thiamine biosynthesis
           may have a role in catabolism of amino acids to
           long-chain and complex alcohols
          Length = 584

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/548 (51%), Positives = 391/548 (71%), Gaps = 1/548 (0%)

Query: 2   PDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGY 61
           P +T+  Y F RL Q++V TIFGLPG+FN  L+DK+Y + G+RWAGN NELNAAYAADGY
Sbjct: 10  PTITIADYFFHRLKQLEVLTIFGLPGEFNAPLIDKLYGIEGLRWAGNTNELNAAYAADGY 69

Query: 62  ARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGD 121
           AR+KG+ CII+TFGVGELSA+NGIAGSYAEHVG+LHVVG+P  S+Q +QLLLHHTLGNGD
Sbjct: 70  ARLKGLGCIISTFGVGELSAINGIAGSYAEHVGLLHVVGMPPTSAQTRQLLLHHTLGNGD 129

Query: 122 FTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHLL 181
           +TVFHRM+  +S  +A++ D      E+D CIR  Y+ QRPVY+G+P NLV +PV +  L
Sbjct: 130 YTVFHRMATEVSCHSAVIIDTELCAQEVDECIRNAYIFQRPVYMGIPVNLVSMPVDSDRL 189

Query: 182 ETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQFP 241
             PIDL++ PND                 A+NPVI+ADAC  RH ++ ET +L   T+FP
Sbjct: 190 NEPIDLSVPPNDTSKENEVIDQILTHFYKATNPVIVADACVTRHRIEAETEELCRRTKFP 249

Query: 242 AFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYSY 301
            FVTPMGKG++DE  P+FGGVY G++S+ +VR  V+ AD ++ +G +L+DF T +F ++Y
Sbjct: 250 LFVTPMGKGSVDEGLPQFGGVYTGSISSPSVREVVDFADCLIVIGCMLADFETTTFHFNY 309

Query: 302 KTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCPP 361
           +   +V  +   +K ++AT+P + +K +L+ LLA +      Y   P P  + P    P 
Sbjct: 310 RANELVLLYPTSVKFKHATYPDLSIKPLLHSLLANLQERQLSYQWQPRPRMVIPKLELPT 369

Query: 362 DTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGA 421
              LRQEW+WN++S++F +GD+I+TETGT+AFGINQ+ FP +T+GISQ LWGS+G++ GA
Sbjct: 370 THPLRQEWVWNQISQWFMEGDVIITETGTSAFGINQTNFPPHTLGISQALWGSVGYSLGA 429

Query: 422 VLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLIH 481
            LGA+ A +E   + RV+LF+GDG+ QLT QE+ST+IRW L PY+F++NN GY+++R +H
Sbjct: 430 CLGAAMAVDEKPRTHRVVLFVGDGAFQLTAQELSTVIRWGLTPYIFIMNNQGYSVDRFLH 489

Query: 482 GPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVMLP 541
             NA Y  IQ W ++ L   FGA DYE+ KI T G++Q++  D  F+   +IR++E+MLP
Sbjct: 490 S-NASYYDIQQWNYSTLPSVFGAKDYESRKIITVGDFQSMVNDPAFSVGDRIRILEIMLP 548

Query: 542 VMDAPSNL 549
            MD P  L
Sbjct: 549 PMDVPQAL 556

>KLTH0E09702g Chr5 (874177..876000) [1824 bp, 607 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080C THI3
           Probable decarboxylase required for expression of
           enzymes involved in thiamine biosynthesis may have a
           role in catabolism of amino acids to long-chain and
           complex alcohols
          Length = 607

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/550 (51%), Positives = 390/550 (70%), Gaps = 1/550 (0%)

Query: 2   PDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGY 61
           P++ L +Y+  RL Q+ + TIFG+PG FN+ LL +I  VP M+WAGN NELNAAYAADGY
Sbjct: 13  PEIPLAQYMLHRLRQLGIATIFGVPGGFNVPLLREICNVPQMKWAGNTNELNAAYAADGY 72

Query: 62  ARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGD 121
           +R+K +AC++TTFGVGELSA+NG+AGS+AEHVG+LH VG+P +++Q ++LLLHHTLGNG+
Sbjct: 73  SRIKHLACLVTTFGVGELSAVNGVAGSFAEHVGLLHFVGMPPLAAQRRRLLLHHTLGNGN 132

Query: 122 FTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHLL 181
           + VFHR+ +++++ T+++TD  T   E+D+CI   +  QRPVYLG+P N+ D  V + LL
Sbjct: 133 YKVFHRLGSDVTQYTSVLTDTETCSKEVDKCISIAFTKQRPVYLGVPTNISDTLVSSALL 192

Query: 182 ETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQFP 241
             P+DL+    + E                 +P I+ DAC  RH+V  E  +L+++TQFP
Sbjct: 193 NIPLDLSAHEGNTEVQEDFVNAILSAMYKCRSPAIVVDACVSRHNVVAEVRQLVELTQFP 252

Query: 242 AFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYSY 301
            F TPMGKG I+E +PRFGG +VG++S   VR  V+ +D +L VGALLSDFN+ SF ++Y
Sbjct: 253 VFCTPMGKGAINEHHPRFGGTFVGSISPPQVREVVDFSDFVLVVGALLSDFNSSSFHFAY 312

Query: 302 KTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCPP 361
           K KN     S Y +++NA +P +++K  L  LL  +  +   Y P  +P  + P      
Sbjct: 313 KAKNTALLFSSYARLKNAMYPDLELKTALRVLLTKLDPSKLRYRPEEVPEVIRPKIKLMS 372

Query: 362 DTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGA 421
           +  LRQEW+WN++S +FR+GDI++TETGT+AFG+NQS FPNNT  I+Q LWGS+G++ GA
Sbjct: 373 NVPLRQEWVWNQISNWFREGDIVITETGTSAFGVNQSKFPNNTRCITQALWGSVGYSVGA 432

Query: 422 VLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLIH 481
            LGASFAA E   + RVILF+GDG+LQLTVQE+ST+IRW LKP +FV+NN+GYTI+RL+H
Sbjct: 433 CLGASFAAREEGNNSRVILFVGDGALQLTVQELSTMIRWGLKPIIFVMNNSGYTIDRLLH 492

Query: 482 -GPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
              NAGY+ IQ W + KLL  FGA DY+   + T G++  L  D  F   +KI+M+EV+L
Sbjct: 493 RKSNAGYHDIQAWDNLKLLPLFGALDYDTRVVKTVGDFLGLVSDPGFALNNKIKMVEVVL 552

Query: 541 PVMDAPSNLI 550
           P MDAP  L+
Sbjct: 553 PPMDAPPALM 562

>KNAG0A05900 Chr1 complement(880996..882858) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/560 (50%), Positives = 387/560 (69%), Gaps = 10/560 (1%)

Query: 1   MPD-LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAAD 59
           +PD +T+  YLF RL Q+ VKTIFGLPG+FN+ LLDKIY +P MRWAGNANELNAAYAAD
Sbjct: 13  LPDQITITDYLFHRLRQLKVKTIFGLPGEFNMPLLDKIYRIPDMRWAGNANELNAAYAAD 72

Query: 60  GYARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGN 119
           GY+R+K + C++TTFGVGELSA+NG+AGS+AEHVG+LHVVG+P  S+Q KQLLLHHTLGN
Sbjct: 73  GYSRIKRLGCLVTTFGVGELSAINGVAGSFAEHVGLLHVVGMPPTSAQTKQLLLHHTLGN 132

Query: 120 GDFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTH 179
           GD+ VF+RM+ +++  T +V D      E+D+C+   +  Q+P YLG+P N VDL V + 
Sbjct: 133 GDYNVFYRMANDVTCHTGLVADSDLCCMEVDKCVEMAWREQKPAYLGIPVNQVDLTVDSV 192

Query: 180 LLETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQ 239
            L+TP++L  +PN+QE                 NP I+ DAC  RHD+  ET +   MT 
Sbjct: 193 RLDTPLNLESEPNNQEIENDVVKTILKKLYTCENPAIIVDACVIRHDLVEETKQFRQMTN 252

Query: 240 FPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSY 299
           FP FVTPMGKG +DE    FGGV+ G+LS+ +VR  V+ AD I+ +G+LL++F+T +F +
Sbjct: 253 FPTFVTPMGKGAVDESLSNFGGVFTGSLSSPSVREVVDFADFIIVIGSLLAEFSTPTFHF 312

Query: 300 SYKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPC 359
            YKTKN    HS  +K++NAT+P + +K ++  LL+ + ++    T    PP        
Sbjct: 313 FYKTKNYALIHSSSVKLKNATYPDIHIKHLMQVLLSRLDTSKISCTFRNTPPINVSRPKL 372

Query: 360 PPDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTG 419
             + +L+QEW+WNE+S +F+ GDII+TE GT+AFGINQ+ FP  T GISQ LW S G++ 
Sbjct: 373 SGNQLLKQEWVWNELSHWFQQGDIIITEIGTSAFGINQTRFPPRTKGISQALWASSGYSV 432

Query: 420 GAVLGASFAAEEIDP--------SKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNN 471
           GA LGASFAA+E+            RV+LF+GDG+ Q+T+QEIST+IRW L PY+F+LNN
Sbjct: 433 GACLGASFAAQELQEENPGDASLQHRVLLFVGDGAFQITMQEISTMIRWKLTPYIFLLNN 492

Query: 472 NGYTIERLIHG-PNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEP 530
            GY+++R +H    A Y  +QPW + K  +AFGA+DYE  KI T G+ + +  DK F + 
Sbjct: 493 QGYSVDRFLHHRSKASYYDVQPWHYLKFFDAFGADDYETRKIVTLGDLRDVMNDKHFCKD 552

Query: 531 SKIRMIEVMLPVMDAPSNLI 550
            KIRM+E+MLP  D P  L+
Sbjct: 553 DKIRMLEIMLPSTDVPQVLV 572

>Skud_4.175 Chr4 complement(306124..307986) [1863 bp, 620 aa] {ON}
           YDL080C (REAL)
          Length = 620

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/554 (51%), Positives = 395/554 (71%), Gaps = 7/554 (1%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           + +  YLF RL Q+++ TIFGL G+F++ LLDK+Y++P +RWAGN+NELNAAYAADGY+R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYDIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  VKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
           +KG+ C+ITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  S+Q KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHLLET 183
           VFHR++++++  T ++ D      E+D+CI+  ++ QRPVY+G+P N V+LP+ +  L T
Sbjct: 135 VFHRIASDVACYTTLIVDSELCADEVDKCIKMAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 184 PIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQFPAF 243
           P+DL L  ND +               + NP I+ DAC  R ++  ET +L    +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVITRILSIMYKSQNPAIIVDACTSRQNLIEETKELCSRLKFPIF 254

Query: 244 VTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKGT++E +P+FGGV+ G++S   VR  V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCPPDT 363
           KN    +S  +K++NAT+P + +K +L KLLA +  +   Y P   P  + P      + 
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSVKLLLQKLLASLDESKLSYRPSEQPNMMVPRPYPAGNV 374

Query: 364 ILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGAVL 423
           +LRQEW+WNE+S++F+ GDII+TETG +AFG+NQ+ FP NT+GISQ LWGS+G+T GA L
Sbjct: 375 LLRQEWVWNEISRWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 GASFAAEEID-----PSK-RVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIE 477
           GA FA +EI+     P+K RVILF+GDG+ QLTVQE+ST+++W L PY+FV+NN GY+++
Sbjct: 435 GAEFAVQEINKNEFPPTKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 RLIHG-PNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMI 536
           R +H   +A Y  IQPW +  LL  FG  +YE  KI T GE+++L  D  F    KIRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCANYETKKIITVGEFRSLINDPNFAINDKIRMI 554

Query: 537 EVMLPVMDAPSNLI 550
           E+MLP  D P  L+
Sbjct: 555 EIMLPPRDVPQALL 568

>Kwal_47.17878 s47 (590664..592496) [1833 bp, 610 aa] {ON} YDL080C
           (THI3) - alpha-ketoisocaproate decarboxylase [contig
           204] FULL
          Length = 610

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/550 (50%), Positives = 390/550 (70%), Gaps = 1/550 (0%)

Query: 2   PDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGY 61
           PD+TL ++L  RL Q+ + TIF +PG F++  + +IY+ P M+WAGN NELNAAYAADGY
Sbjct: 13  PDITLAQFLVHRLRQLGITTIFAVPGGFSMPFIMQIYQTPQMQWAGNTNELNAAYAADGY 72

Query: 62  ARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGD 121
           +R+K + C+ TTFGVGELSA+NG+AG++AEHVG+LHVVG+P +++Q KQLL HHTLGNGD
Sbjct: 73  SRIKRLGCLATTFGVGELSAVNGVAGAFAEHVGLLHVVGMPPVAAQVKQLLWHHTLGNGD 132

Query: 122 FTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHLL 181
           + VFHR+ +++++   ++ D      E+D+CI      QRPVYLG+P N+ ++ V + LL
Sbjct: 133 YQVFHRLGSDVAQYATVLRDAEACAQEVDKCIIIALTKQRPVYLGVPVNMNNVLVSSVLL 192

Query: 182 ETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQFP 241
             P+DL     + +                SNP I+ADAC  RH+V+ E   L+D+TQFP
Sbjct: 193 NVPLDLEPHATNPDTERRFVNTVLNAIYKCSNPAIIADACVSRHEVEAELKHLVDLTQFP 252

Query: 242 AFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYSY 301
            F TPMGKG+IDE++PRFGG +VG++S+  VR  V+ +D +L VGALLS+FNT SF ++Y
Sbjct: 253 VFCTPMGKGSIDEQHPRFGGTFVGSISSPQVREVVDFSDFVLVVGALLSEFNTSSFHFAY 312

Query: 302 KTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCPP 361
           +TKN V   SDY K++NA +P + +K VL  +LA +  +   Y P  +P  + P      
Sbjct: 313 RTKNSVLLFSDYAKLKNAIYPDLNLKTVLRAILAKLDPSKITYRPEQVPDVIKPRIKLMS 372

Query: 362 DTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGA 421
           +  LRQEW+W ++S++FR+GDI++TETGT+AFG+NQ+ FP++T  I+Q LWGS+G++ GA
Sbjct: 373 NVPLRQEWVWGQISRWFREGDIVITETGTSAFGVNQAKFPSHTRCIAQALWGSVGYSVGA 432

Query: 422 VLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLIH 481
            LGASFAA E   + RVILF+GDG+LQLTVQEIST+IRW L P +F++NN+GYTI+RL+H
Sbjct: 433 CLGASFAAREEGCNSRVILFVGDGALQLTVQEISTMIRWGLTPIIFLMNNSGYTIDRLLH 492

Query: 482 -GPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540
              NA Y+ IQ W + ++L  FGA +YE   + T G++  L  D QF    KI+M+EV+L
Sbjct: 493 KKSNAAYHDIQTWDNLRILPTFGALNYEARAVRTVGDFLHLIHDTQFAVNDKIKMVEVVL 552

Query: 541 PVMDAPSNLI 550
           P MDAP  L+
Sbjct: 553 PPMDAPPALM 562

>Smik_4.156 Chr4 complement(287087..288952) [1866 bp, 621 aa] {ON}
           YDL080C (REAL)
          Length = 621

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/554 (50%), Positives = 391/554 (70%), Gaps = 7/554 (1%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +++  YLF RL Q+++ TIFGL G+F++ LLDK+Y +P +RWAGN+NELNAAYAADGY+R
Sbjct: 15  ISISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYNIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  VKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
           +KG+ C+ITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  S+Q KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHLLET 183
           VFHR++++++  T ++ D      E+D+CIR  ++ QRPVY+G+P N V+LP+ +  L T
Sbjct: 135 VFHRIASDVACYTTLIVDSELCADEVDKCIRKAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 184 PIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQFPAF 243
           P+DL L  ND +               + NP I+ DAC  R ++  E+ +L    +FP F
Sbjct: 195 PLDLQLPKNDPDVEKEVISRILSFMYKSQNPAIIVDACTSRQNLIEESKELCSRLKFPVF 254

Query: 244 VTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKGT++E  P+FGGV+ G++S   VR  V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETIPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCPPDT 363
           KN    +S  +K++NAT+P + +K +L KLLA +  +   Y P   P  + P      + 
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSIKLLLQKLLASLDESKLSYRPNEQPSMMVPRPYPAGNV 374

Query: 364 ILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGAVL 423
           +LRQEW+WNE+S +F+ GDII+TETG +AFG+NQ+ FP NT+GISQ LWGS+G+T GA L
Sbjct: 375 LLRQEWVWNEISHWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 GASFAAEEIDPSK------RVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIE 477
           GA FA +EI   K      RVILF+GDG+ QLTVQE+ST+++W L PY+FV+NN GY+++
Sbjct: 435 GAEFAVQEIKKDKFPVTKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 RLIHG-PNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMI 536
           R +H   +A Y  IQPW +  LL  FG  +YE  KI T GE++++  D +F    KIRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMIDDPEFAINDKIRMI 554

Query: 537 EVMLPVMDAPSNLI 550
           E+MLP  D P  L+
Sbjct: 555 EIMLPPRDVPQVLL 568

>TDEL0G03210 Chr7 complement(597217..599037) [1821 bp, 606 aa] {ON}
           Anc_2.390 YDL080C
          Length = 606

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/571 (49%), Positives = 389/571 (68%), Gaps = 9/571 (1%)

Query: 1   MPD-LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAAD 59
           +PD +++  YLF RL Q+ ++TIFGLPG FN +LLDK+ E+PG+RWAGN NELNAAYAAD
Sbjct: 9   LPDSISIAEYLFHRLKQLHIETIFGLPGAFNATLLDKLNEIPGLRWAGNTNELNAAYAAD 68

Query: 60  GYARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGN 119
           GY+R+KG+ CIITTFGVGELSA+NG+AGS+AEHVG+LHVVG+P  S+Q KQLLLHHTLGN
Sbjct: 69  GYSRLKGLGCIITTFGVGELSAINGVAGSFAEHVGLLHVVGMPPTSAQTKQLLLHHTLGN 128

Query: 120 GDFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTH 179
           GD+ VFHRM++ ++  + ++ D      E+D CI   +  Q+PVY+G+P NLVD  V + 
Sbjct: 129 GDYKVFHRMASEVTCYSTVINDKDLCGDEVDDCIAKAWTLQKPVYMGIPVNLVDTSVNSQ 188

Query: 180 LLETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQ 239
            L T ++L L  ND++               + NPVI+ADAC  RH +  ET +L   T 
Sbjct: 189 RLNTALNLNLPSNDEQTENELVKQILQQLYKSKNPVIIADACVTRHRIVPETVELCQRTN 248

Query: 240 FPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSY 299
           FP F TPM KG IDE  P FGGV++G++S+  VR  V  AD ++ +G +LSDF+T SF +
Sbjct: 249 FPIFATPMSKGAIDETLPNFGGVFMGSISSPEVREVVNFADFLIVIGCMLSDFSTSSFHF 308

Query: 300 SYKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPC 359
           +YKTK  V  +   +K ++A +P +++K ++  LL  +  +   Y   P P  + P    
Sbjct: 309 NYKTKECVLLYPTSVKFKHAIYPDLRIKSLMANLLRNLNESKIKYQSQPTPQMIIPRSEL 368

Query: 360 PPDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTG 419
           P    LR EW+WN++S +F++GDII+TETGT+AFGINQ+ FP+++ GISQ LWGS+G+T 
Sbjct: 369 PSRHSLRHEWVWNQMSHWFQEGDIIITETGTSAFGINQTHFPHSSRGISQALWGSVGYTL 428

Query: 420 GAVLGASFAAEEIDPSK------RVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNG 473
           GA LGASFAA E+   +      RVILF+GDG+ QLTVQE+ST+IRW L PY+FV+NN G
Sbjct: 429 GACLGASFAANEMARDQVTAVPHRVILFVGDGAFQLTVQEVSTMIRWGLTPYIFVMNNQG 488

Query: 474 YTIERLIHG-PNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSK 532
           Y+++R +H   NA Y  IQ W + +L+  FGA  YE  KI T G++  +  D  F    K
Sbjct: 489 YSVDRFLHHRSNASYYDIQTWEYLRLIPLFGARHYETRKIVTVGDFLEMIHDPLFATNDK 548

Query: 533 IRMIEVMLPVMDAPSNLIAQAKLTACINSKK 563
           IRM+E+MLP MD P  L+ +  LT   N K+
Sbjct: 549 IRMLEIMLPPMDVPQALMDRW-LTEQENKKR 578

>CAGL0L06842g Chr12 (771870..773786) [1917 bp, 638 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080c THI3
           or uniprot|P06169 Saccharomyces cerevisiae YLR044c PDC1
           or uniprot|P16467 Saccharomyces cerevisiae YLR134w PDC5
           or uniprot|P26263 Saccharomyces cerevisiae YGR087c PDC6
          Length = 638

 Score =  596 bits (1537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/583 (48%), Positives = 389/583 (66%), Gaps = 27/583 (4%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +++  YLF RL Q+ + TIFGLPGDFN+ LLDK+Y +P MRWAGN NELNAAYAADGY+R
Sbjct: 13  ISISEYLFHRLNQLKIWTIFGLPGDFNMPLLDKLYSIPTMRWAGNTNELNAAYAADGYSR 72

Query: 64  VKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
           +K + C+ITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  S+Q KQLLLHHTLGNGD++
Sbjct: 73  LKHLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDYS 132

Query: 124 VFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHLLET 183
           VF+R++ +I+  TA++ D      E+D CIR  +  Q+PVYLG+P N VD+PV +  L  
Sbjct: 133 VFYRIANDIACHTAIINDTDLCADEVDNCIRAAWGYQKPVYLGVPVNQVDIPVDSSRLNN 192

Query: 184 PIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQFPAF 243
           PIDL++    +E               AS P+I+ DAC  RHD   ET+ L ++T FP F
Sbjct: 193 PIDLSILKKTKETDAQVIDLLLKQMYSASKPIIVVDACVRRHDALKETHALCELTNFPVF 252

Query: 244 VTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKGTIDE    FGGVY G+LS+  VR   + AD +L +GA+L +F+T +F + +K 
Sbjct: 253 VTPMGKGTIDESYKNFGGVYSGSLSSPEVREVTDFADFVLFIGAILPEFSTSTFHFGFKK 312

Query: 304 KNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVP----LPPRLTPNEPC 359
           KN        +KI+ ATFP + +K  L  L+  +  +   Y        + P++ P++  
Sbjct: 313 KNCCILFPTSVKIKKATFPDMLLKGTLQSLVDTIEPSKITYKHQAKVDIIAPKMEPSD-- 370

Query: 360 PPDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTG 419
               +LRQEW+WNE+S +F++ DII+TETG++AFGINQ+ FP NTIGI+Q LWGS+GF  
Sbjct: 371 --SNLLRQEWVWNEISHWFKENDIIITETGSSAFGINQTRFPTNTIGINQALWGSVGFAL 428

Query: 420 GAVLGASFAAEE------------------IDPSKRVILFIGDGSLQLTVQEISTLIRWD 461
            + LGA FA EE                  I    R ILF+GDG+ QLTVQE+ST+IRW 
Sbjct: 429 CSCLGALFAVEEKTVVKHNLEIKLRNYNRNIFTENRTILFVGDGAFQLTVQELSTIIRWK 488

Query: 462 LKPYLFVLNNNGYTIERLIHG-PNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQT 520
           LKPY+F++NNNGY+++R +H   +A Y  +QPW +  LLE FG   +E  KI T  +++ 
Sbjct: 489 LKPYIFIMNNNGYSVDRFLHHRSDASYYDVQPWNYLYLLELFGCTSFETRKIVTVSDFKE 548

Query: 521 LTQDKQFNEPSKIRMIEVMLPVMDAPSNLIAQAKLTACINSKK 563
           L  D+ F +P KIRMIE+MLP  D P  LIA+ +    +++K+
Sbjct: 549 LLADESFAKPDKIRMIEIMLPQSDVPKTLIARWQAEKELSNKR 591

>NCAS0A04000 Chr1 complement(806883..808760) [1878 bp, 625 aa] {ON}
           Anc_2.390
          Length = 625

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/569 (48%), Positives = 382/569 (67%), Gaps = 15/569 (2%)

Query: 2   PDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGY 61
           P +T+  YLF RL Q+ ++TIFGL G++N+ L+DK+Y+V  +RWAGNANELNAAYAADGY
Sbjct: 11  PQITISEYLFHRLKQLHIETIFGLSGEYNMPLIDKLYQVHNLRWAGNANELNAAYAADGY 70

Query: 62  ARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGD 121
           AR+KG+  +ITTFGVGELSALNG+AGS+AEHVG+LH+VG+P  S+Q KQLLLHHTLGNGD
Sbjct: 71  ARLKGLGVLITTFGVGELSALNGVAGSFAEHVGLLHIVGMPPTSAQTKQLLLHHTLGNGD 130

Query: 122 FTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHLL 181
           ++VFHR++++I+    ++ D      E+D+CI   ++ QRPVY+G+P N V+L V +  L
Sbjct: 131 YSVFHRIASDIAVYNTVIDDTDLCFQEVDKCITLAWMEQRPVYMGMPVNQVNLLVDSKFL 190

Query: 182 ETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQFP 241
           + P+DL +  N  E                 +P I+ DAC  RH+   E  +    T+FP
Sbjct: 191 DIPLDLDMFENATEVNSEITNKILQKIYKCKHPAIVVDACTIRHECIDEVEEFCRRTKFP 250

Query: 242 AFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYSY 301
            FVTPMGKG I+E  P FGGV++G+LS+ +VR  V+ AD I+ +G++LS+F+T +F + +
Sbjct: 251 VFVTPMGKGAINENTPHFGGVFMGSLSSPSVREVVDFADFIIVIGSMLSEFSTSTFHFVF 310

Query: 302 KTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCPP 361
           K K+ V   SD +KI+N+ +  + +K ++  LL  +  +   Y     P  + P    P 
Sbjct: 311 KVKDSVLLFSDLVKIKNSVYANIHIKPLMKSLLHSLDESKIKYIFEEAPSMILPKTKIPD 370

Query: 362 DTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGA 421
           D +LRQEW+WNE+S +FR+GDII+TE GT+AFGINQ+ FPN   GISQ LWGS G++ GA
Sbjct: 371 DVLLRQEWVWNEISHWFREGDIIITEIGTSAFGINQTRFPNEAQGISQSLWGSSGYSLGA 430

Query: 422 VLGASFAAEEID--------------PSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLF 467
            LG SFA +E +                 RVILF+GDG+ QLT+QE+ST+IRW+L PY+F
Sbjct: 431 CLGTSFAIQEFEREHNHNFHRHTQNVEKHRVILFVGDGAFQLTMQELSTIIRWNLTPYIF 490

Query: 468 VLNNNGYTIERLIH-GPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQ 526
           VLNN GY+++R +H   NA Y  IQPW +  L+  F A +YE  KI T G+++ + QD  
Sbjct: 491 VLNNEGYSVDRFLHPEANASYYDIQPWNYLDLMATFNAKNYETKKIVTVGDFRDMVQDPL 550

Query: 527 FNEPSKIRMIEVMLPVMDAPSNLIAQAKL 555
           F    KIRM+E++LP  D P  L+   KL
Sbjct: 551 FAINDKIRMVEILLPSTDVPQALVDTWKL 579

>TPHA0G02620 Chr7 complement(547384..549450) [2067 bp, 688 aa] {ON}
           Anc_2.390 YDL080C
          Length = 688

 Score =  585 bits (1508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/596 (48%), Positives = 394/596 (66%), Gaps = 44/596 (7%)

Query: 1   MPD-LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAAD 59
           +PD LT+  YLF RL Q++V TIFGLPG+FN+SLLDK+Y V GMRWAGNANELNA+YAAD
Sbjct: 15  LPDELTVSEYLFHRLKQLNVNTIFGLPGEFNMSLLDKLYNVEGMRWAGNANELNASYAAD 74

Query: 60  GYARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGN 119
           GY+R+K + C++TTFGVGELS +NGIAGS++E+VG++H+VG+P I  Q  QLL+HHTLGN
Sbjct: 75  GYSRLKKLGCLMTTFGVGELSVINGIAGSFSENVGIIHIVGMPPIQIQRSQLLMHHTLGN 134

Query: 120 GDFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTH 179
           GD+ +FHR+S +I   +A+VT       EID+C+   +++Q+PVYLGLP NLV + V + 
Sbjct: 135 GDYNIFHRLSDDIYCYSAVVTHPNLCIQEIDKCLSKAWLSQKPVYLGLPENLVSVKVKST 194

Query: 180 LLETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQ 239
           LL TP+DL L  ND++               A NP I+ADAC  RH V+ ET  LI+ T+
Sbjct: 195 LLNTPLDLKLPNNDKDNENIAIDQILKKIYSAKNPAIIADACVTRHSVEKETQMLIEKTK 254

Query: 240 FPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSY 299
           FP FVTPMGKG +DE + +FGGV+VG++S+  VR  V+ ADLI+ +G L SDF T SF +
Sbjct: 255 FPYFVTPMGKGGVDEYSKQFGGVFVGSISSAKVREIVDFADLIIVIGNLQSDFKTTSFHF 314

Query: 300 SYKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPC 359
           +YKTK+IV   S  +K++N  +P + +K  L KL+  + +    Y P+  P    PN   
Sbjct: 315 TYKTKDIVMISSSCVKLKNGLYPELHIKEFLGKLVDNIVTTKITYKPIISPIMNIPNNIT 374

Query: 360 P-------------PD--------TILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQS 398
                         PD        T+L+QEW+WNE S +FR+GDII+TETGT+AFGINQ+
Sbjct: 375 SEESFESLTNYSKTPDKNDSNVNKTLLKQEWVWNEFSLWFREGDIIITETGTSAFGINQT 434

Query: 399 LFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEIDPSK------RVILFIGDGSLQLTVQ 452
            FPN TIGISQ LWGS G++ GA LGASFAAEEI  S       RVILF+GDG+ QLT+Q
Sbjct: 435 KFPNRTIGISQTLWGSTGYSVGACLGASFAAEEIHQSNPNIEKPRVILFVGDGAFQLTMQ 494

Query: 453 EISTLIRWDLKPYLFVLNNNGYTIERLI----------------HGPNAGYNAIQPWRHT 496
           E+ST+++W+L PY+F++NN GY+++R +                   N  Y  IQ W + 
Sbjct: 495 ELSTMVKWNLDPYIFLMNNQGYSVDRFLTHQSRRNNSNANNILKSNNNNDYFDIQLWDYL 554

Query: 497 KLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVMLPVMDAPSNLIAQ 552
            L   F A +YE  K+ +  +   +   K F+   +IRM+E++LP MD P +L+ +
Sbjct: 555 NLFNLFNAMNYETYKVLSCNDLLKILNSKSFSNEHRIRMVEIILPPMDVPKSLMER 610

>NDAI0E01700 Chr5 (337856..339721) [1866 bp, 621 aa] {ON} Anc_2.390
          Length = 621

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/566 (47%), Positives = 381/566 (67%), Gaps = 15/566 (2%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T+  Y+F RL Q+ ++TIFGLPG+FN+ L+DK+Y++P +RWAG+ANELNAAYAADGY+R
Sbjct: 13  ITIAEYIFHRLKQLKIETIFGLPGEFNMPLIDKLYKIPQLRWAGDANELNAAYAADGYSR 72

Query: 64  VKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
           +KG+  ++TTFGVGELSA+NG+AGS+AEHVG+LH+VG+P  S+Q KQLLLHHTLGNGD+ 
Sbjct: 73  LKGLGVLVTTFGVGELSAINGVAGSFAEHVGLLHIVGMPPTSAQTKQLLLHHTLGNGDYN 132

Query: 124 VFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHLLET 183
           VF R+++ ++  T ++ D      E+D+CI   +  Q+PVY+G+P N VD+PV +  L  
Sbjct: 133 VFWRIASEVACHTVIINDTDLCFMEVDKCIEIAWKRQKPVYIGIPVNQVDIPVRSLHLNV 192

Query: 184 PIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQFPAF 243
           P+ L+   N  +               +++PVI+ D C  RH    E  + I  T+FP F
Sbjct: 193 PLTLSPDMNLNDIGNDVVQLLLQKIYKSTHPVIIVDGCIIRHGCIDEMEEFIQRTKFPVF 252

Query: 244 VTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG IDE NP F GV+ G++S+ +VR  V+ AD ++ +G +L+ FNT +F + YK+
Sbjct: 253 VTPMGKGAIDENNPNFKGVFTGSISSPSVREVVDFADFLMVMGCMLAAFNTSTFHFGYKS 312

Query: 304 KNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCPPDT 363
           KN    +SD IK  NAT+P V +K +L  LL  +  +   Y P   P  + P    P D 
Sbjct: 313 KNRALLYSDSIKFNNATYPDVYLKPLLQSLLQNLDESQINYVPKETPKMIIPKRELPDDE 372

Query: 364 ILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGAVL 423
           +LRQEW+WNE+S +F++GDII+TETGT+AFGINQ+ FPN   GISQ LWGS+G++ GA L
Sbjct: 373 LLRQEWVWNEISHWFQEGDIIITETGTSAFGINQTRFPNEAQGISQALWGSVGYSLGACL 432

Query: 424 GASFAAEEID--------------PSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVL 469
           G+ FA +E                   RVILF+GDG+ QLT+QE+ST++RW L PY+F+L
Sbjct: 433 GSLFAVQEFQRDHNHDFHHHTQKSEKHRVILFVGDGAFQLTMQELSTIVRWKLTPYIFIL 492

Query: 470 NNNGYTIERLIHG-PNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFN 528
           NN+GY+++R++H   +A Y  IQ W +  L+  F A D +  KI T G+ + + +D +F 
Sbjct: 493 NNHGYSVDRILHHRSDASYYDIQQWDYLNLMNTFNATDADTRKIITVGDMKDMLRDPEFA 552

Query: 529 EPSKIRMIEVMLPVMDAPSNLIAQAK 554
             ++IRMIEVMLP MD P  L+   K
Sbjct: 553 VDNRIRMIEVMLPSMDVPKALVDTWK 578

>TBLA0B08820 Chr2 (2097075..2098982) [1908 bp, 635 aa] {ON}
           Anc_2.390 YDL080C
          Length = 635

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/588 (48%), Positives = 387/588 (65%), Gaps = 30/588 (5%)

Query: 3   DLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYA 62
           D+TL  YLF RL Q  + T+FGLPG+FN+ L+DK+  +P ++WAGNANELNAAYAADGYA
Sbjct: 12  DITLADYLFHRLNQFKIHTVFGLPGEFNMPLIDKLLTIPDLKWAGNANELNAAYAADGYA 71

Query: 63  RVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
           R+KG+ C++TTFGVGELS++NGIAGSYAEHVGVLH++G+P  S Q  QLLLHHTLGNGD+
Sbjct: 72  RIKGIGCLLTTFGVGELSSINGIAGSYAEHVGVLHIIGMPPSSIQTSQLLLHHTLGNGDY 131

Query: 123 TVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHLLE 182
           TVFHR+++ ++  + ++ D      EID  I   +  QRPVYLG+P N +  P+ ++LL 
Sbjct: 132 TVFHRIASELACYSTVLNDTDYLTKEIDLSIVKAWTLQRPVYLGIPMNFISYPIKSNLLN 191

Query: 183 TPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQFPA 242
             +D TL+ N++ +                 PVI+ DAC  RH+++ ET +L   T+FP 
Sbjct: 192 KDLDFTLESNNEISQDDVIELILKNIYRCKKPVIVVDACVTRHNIEKETEELFRRTKFPV 251

Query: 243 FVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYSYK 302
            VTPM KG++DE  P F GV+ G++S+  VR  ++S DL+L +G  L +F T SF +SYK
Sbjct: 252 LVTPMAKGSVDESLPEFAGVFCGSISSPQVREVLDSVDLLLVIGCTLPEFTTSSFHFSYK 311

Query: 303 TKNIVEFHSDYIKIRNATFPGVQMKFVLNK-LLAVVGSAVKGYTPVPLPPR-----LTPN 356
           +K+ +   SDYIK RN TF  + +K ++ K LLA+  S +K +    L          PN
Sbjct: 312 SKHCIFIFSDYIKYRNTTFADLNIKQLIKKLLLALDVSKIKNFQ---LQENNNGNIYIPN 368

Query: 357 EPCPPDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIG 416
               P  +LRQEW+WN++S +F+DGDII+TETGT AFGINQ+ FP+N  GISQ LWGS G
Sbjct: 369 IKLNPTLLLRQEWVWNQLSHWFQDGDIIITETGTTAFGINQTKFPHNARGISQSLWGSTG 428

Query: 417 FTGGAVLGASFAAEEI-------------------DPSK-RVILFIGDGSLQLTVQEIST 456
           ++ GA LGASFA  EI                   DP K RVILFIGDG+ QLTVQE+ST
Sbjct: 429 YSLGACLGASFALSEIRKEQQVINNITQNVFPLFKDPPKHRVILFIGDGAFQLTVQELST 488

Query: 457 LIRWDLKPYLFVLNNNGYTIERLIHG-PNAGYNAIQPWRHTKLLEAFGANDYENVKITTT 515
           +IRW L PY+F++NN+GY+ +R +H   +AGY  I  W +  LLE FGA  YE+ KI T 
Sbjct: 489 IIRWGLTPYIFIMNNHGYSGDRFLHHRSDAGYYDIPQWDYLGLLEVFGAKIYESKKIITV 548

Query: 516 GEWQTLTQDKQFNEPSKIRMIEVMLPVMDAPSNLIAQAKLTACINSKK 563
           G+++ +  +  F   S +RMIE++LP MD P  L+ + +L      KK
Sbjct: 549 GDFEKMVNNPNFAIDSVLRMIEIVLPPMDVPQALMDKWRLEQEEEKKK 596

>KAFR0F02990 Chr6 complement(589562..591388) [1827 bp, 608 aa] {ON}
           Anc_2.390 YDL080C
          Length = 608

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/559 (47%), Positives = 377/559 (67%), Gaps = 8/559 (1%)

Query: 2   PDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGY 61
           P++T+  YLF RL Q+ V+TIFGLPG+FN+ LLD++Y +PG++WAGNANELNA YAADGY
Sbjct: 11  PEITIADYLFHRLKQLHVETIFGLPGEFNMPLLDRLYNIPGLKWAGNANELNATYAADGY 70

Query: 62  ARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGD 121
           AR+KG+ CIITTFGVGELSA+NGIAG++AEHVGVLHVVG+P  S+Q KQLLLHHTLGNGD
Sbjct: 71  ARLKGLGCIITTFGVGELSAINGIAGAFAEHVGVLHVVGMPPTSAQTKQLLLHHTLGNGD 130

Query: 122 FTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHLL 181
           + VFHRM+ ++S  + ++ D      E+D+CI   Y+ Q+PVYLG+P N V+L V +  L
Sbjct: 131 YRVFHRMANDVSFYSRIINDTDLCSNEVDKCIELAYLKQKPVYLGVPVNQVNLKVNSAKL 190

Query: 182 ETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQFP 241
              +   +  N+ +                 +P I+ DAC  R D   ET + I +T FP
Sbjct: 191 NKELRFRVLKNNLDMENEAINLILKKIYTCESPAIVVDACVNRQDTVKETEQFIRLTNFP 250

Query: 242 AFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYSY 301
            FVTPMGKG+IDE  P FGGV+ G++S+ NVR  V+ AD ++ +G+LL++F+T +F + Y
Sbjct: 251 VFVTPMGKGSIDENIPTFGGVFSGSISSPNVREVVDFADFVIVIGSLLTEFSTSAFHFFY 310

Query: 302 KTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLP--PRLTPNEPC 359
           K+KN V    D ++ + + +P + +K ++  +L+ +      + P      P + P    
Sbjct: 311 KSKNCVLLFDDCVRFKGSIYPDLFLKPLMKNILSRLDPGKISFRPTSDCNNPMIVPKSKP 370

Query: 360 PPDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTG 419
             D +LRQEW+W+E S +F++GDII+TE GT++FGINQ  FP++T GISQ LWGS G++ 
Sbjct: 371 SDDQLLRQEWVWHEFSHWFQEGDIIITELGTSSFGINQIRFPSHTKGISQALWGSSGYSM 430

Query: 420 GAVLGASFAAEEIDPS-----KRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGY 474
           G+ LGA FA  E   +     +RVILFIGDG+ Q+T+QEIST+IRW+L PY+F+LNN GY
Sbjct: 431 GSCLGACFATLESQSASTSTRQRVILFIGDGAFQITMQEISTMIRWNLTPYIFLLNNQGY 490

Query: 475 TIERLIHG-PNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKI 533
           +I+R +H   N     +Q W +    + FGA DYE  KI T G+ + +  ++ F+   +I
Sbjct: 491 SIDRFLHHRKNTTLYDVQQWNYLSFFKVFGATDYETRKIVTLGDLRQMLGNEDFSRADRI 550

Query: 534 RMIEVMLPVMDAPSNLIAQ 552
           RM E+MLP MD P  ++ +
Sbjct: 551 RMAEIMLPSMDVPKAIVDK 569

>Ecym_6055 Chr6 complement(105018..106796) [1779 bp, 592 aa] {ON}
           similar to Ashbya gossypii ADR254W
          Length = 592

 Score =  503 bits (1295), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 261/565 (46%), Positives = 362/565 (64%), Gaps = 20/565 (3%)

Query: 2   PDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGY 61
           P + LG+YLF RL Q++V TIFGLP +FN  LLD+IY++P MRW GNANELNA+YAADGY
Sbjct: 12  PQIPLGKYLFHRLNQLNVTTIFGLPSEFNSPLLDQIYQIPSMRWCGNANELNASYAADGY 71

Query: 62  ARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGD 121
           +R+K ++C++TTFGVGE+S LNGIAGS++EHV VLHVVG+P  S+Q K+LLLHHTLGN D
Sbjct: 72  SRIKRLSCLVTTFGVGEMSVLNGIAGSFSEHVAVLHVVGMPPSSAQLKKLLLHHTLGNSD 131

Query: 122 FTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHLL 181
           + +FHR++++I   TA++ +       ID CI   Y  Q+PVY G+P NL    V +  L
Sbjct: 132 YDIFHRLASDICVHTAVLKESDNICDVIDNCIVRCYNQQQPVYCGIPVNLAGHLVDSKSL 191

Query: 182 ETPIDLTLKPND--QEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQ 239
           ++P+ L    N    +A              A +PVI+AD CA RHD   E  ++   T 
Sbjct: 192 DSPLHLMRGFNQPISDAVEELVDILLEKIYSAQHPVIVADGCASRHDCIEELTEIAQKTG 251

Query: 240 FPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSY 299
           FP   TPMGKG+ DE++ R+ GVY+G++S+  VR  V+ AD +L  GAL +D+ T S+ +
Sbjct: 252 FPLCCTPMGKGSFDEQSKRYVGVYMGSISSPQVREVVDFADFVLVAGALTADYATSSYHF 311

Query: 300 SYKTKNIVEFHSDYIKIR-NATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPP----RLT 354
            YK KNIV     Y K+    T+P V++K VL  L   +      Y    +P     R+ 
Sbjct: 312 CYKPKNIVLLFDKYAKVSGTKTYPDVRLKDVLQLLARCLDPTKLQYIQEEIPESSCLRVK 371

Query: 355 PNEPCPPDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGS 414
           P+   P    LRQEWMW  +S +FR GD+I+TE GT+  G+NQ  FP+ T  +SQ LWGS
Sbjct: 372 PDANTP----LRQEWMWARLSHWFRPGDVIVTEMGTSGLGVNQIKFPSGTKVVSQPLWGS 427

Query: 415 IGFTGGAVLGASFAAEEID-----PSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVL 469
           +G++ GA LG   A +E          R+ILF+GDG+LQLTVQEIST+I+W L PY+FV+
Sbjct: 428 LGYSVGACLGVLIAVQEESRGNRLKDNRIILFVGDGALQLTVQEISTIIKWGLAPYIFVI 487

Query: 470 NNNGYTIERLI----HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDK 525
           NN GYTI+RL+    H   A Y  IQPW +  ++ AFG  +Y+  K+   G+   L +D+
Sbjct: 488 NNQGYTIDRLLSRDTHHATADYYNIQPWNNLSIIPAFGGTNYDVRKVVKVGQLDQLLKDQ 547

Query: 526 QFNEPSKIRMIEVMLPVMDAPSNLI 550
           +F+    ++M+E++LP MDAP  L+
Sbjct: 548 RFSNQDILKMVEIILPSMDAPQALL 572

>ADR254W Chr4 (1143623..1145368) [1746 bp, 581 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL080C (THI3)
          Length = 581

 Score =  491 bits (1264), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 247/555 (44%), Positives = 344/555 (61%), Gaps = 14/555 (2%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           + L  YLF RL Q+ V T FGLP D+N+ LLD +  V  M    N NELNA+YAADGYAR
Sbjct: 14  IPLAEYLFHRLRQLGVTTGFGLPSDYNMFLLDGLENVADMHLCCNTNELNASYAADGYAR 73

Query: 64  VKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
           ++ ++C+++TFGVGELS +NGIAGS+AEHV VL +VG+P  S+Q ++LLLHHTLGNGD+ 
Sbjct: 74  MQRLSCLVSTFGVGELSVVNGIAGSFAEHVAVLLIVGMPPASAQRRKLLLHHTLGNGDYD 133

Query: 124 VFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHLLET 183
           VF R++++I   + +V    TA   +D CI   Y  Q+PVY G+P NL +  +P+  L+ 
Sbjct: 134 VFRRLASDICTYSTVVRSAHTAAEVLDHCIARCYRDQKPVYCGVPINLAEAMLPSAPLDV 193

Query: 184 PIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQFPAF 243
           P+ L  +P                   A +PV++ DAC  RH    +  +L   T FP  
Sbjct: 194 PLPLLDEPC--APLDELVALLLDKIYAAKHPVLVVDACVARHGCMQQLQRLAQATDFPVC 251

Query: 244 VTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYSYKT 303
            TPMGKG +DE+  RF GVYVG+LS   VR  V+ AD +L VGAL ++F T +F ++YK 
Sbjct: 252 CTPMGKGIVDEQGARFAGVYVGSLSAPQVREVVDFADFVLVVGALTAEFCTFAFHFAYKP 311

Query: 304 KNIVEFHSDYIKIRNATFPGVQMKFVLNKLLA--VVGSAVKGYTPVPLPP--RLTPNEPC 359
           KNI   H+ + ++    FP   ++ +L  L+      ++     PVP P   R+ PN   
Sbjct: 312 KNIGLVHARHARVGARGFPDAPLRALLGLLVQRWTPRASANAREPVPEPSALRVAPN--- 368

Query: 360 PPDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTG 419
            P T LR EW+W  +S++F  GDI+++ETGT+AFG+ Q+  P     +SQ LWGS+G++ 
Sbjct: 369 -PATPLRHEWLWARLSRWFAPGDILVSETGTSAFGVLQTRLPPGVCVVSQPLWGSVGYSV 427

Query: 420 GAVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERL 479
           GA LG   A     P +RV+LF+GDG+LQLTVQE+ST++R  L P +FVLNN GY+ +RL
Sbjct: 428 GACLGVLVATRAAAPPRRVVLFVGDGALQLTVQELSTMVRLRLAPLIFVLNNRGYSADRL 487

Query: 480 I----HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRM 535
           +    H  NA Y  +QPW +  L  AFGA+ Y+   +TT GE   L  D  F +PS ++M
Sbjct: 488 LNRARHRANARYYDVQPWHNLALAPAFGASAYDPRAVTTVGELDALLSDPAFAQPSVLKM 547

Query: 536 IEVMLPVMDAPSNLI 550
           +EV LP MD P  L+
Sbjct: 548 VEVALPSMDGPPALL 562

>Kpol_1046.9 s1046
           (18301..18855,18984..18992,19556..19693,19697..19987,
           19994..20797) [1797 bp, 598 aa] {ON}
           (18301..18855,18984..18992,19556..19693,19697..19987,
           19994..20797) [1797 nt, 599 aa]
          Length = 598

 Score =  460 bits (1183), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 242/557 (43%), Positives = 346/557 (62%), Gaps = 38/557 (6%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T+  YLF RL Q+D++TIFGLPG+FN+ L+DK+Y++P +RWAGNANELNAAYAADGYAR
Sbjct: 14  ITVAEYLFHRLKQMDIRTIFGLPGEFNMPLIDKLYKIPSLRWAGNANELNAAYAADGYAR 73

Query: 64  VKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
           +K + C+ITTFGVGELSALNGIAGS++EH+G+LHVV +P +      +L+     NGD+ 
Sbjct: 74  LKRLGCLITTFGVGELSALNGIAGSFSEHLGILHVVRMPPLRLNHSIVLI--LFRNGDYK 131

Query: 124 VFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHLLET 183
                            DI   P    R +    +     ++     L       +   +
Sbjct: 132 F-----------PMKARDILVTPRISHRNLWDEMIKPNQAWISSAGILA----YRYWRGS 176

Query: 184 PIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQFPAF 243
            I     P  + A              +S  +   + C      +  ++  +   +FP F
Sbjct: 177 KI-----PKGKGADXXXKNLQCRTSYLSSRSLRFKEQCR-----RCNSDYSVRKQKFPYF 226

Query: 244 VTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYSYKT 303
           V P  +    E N +FGGV+ G++S+ +VR  V+ ADL++ +G  L DF+T SF +SY+ 
Sbjct: 227 V-PQWERVQHENNDQFGGVFSGSISSPHVREVVDFADLVIVIGCTLPDFHTSSFHFSYRA 285

Query: 304 KNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCPPDT 363
           K++V   S Y+KIRN  +P + +K +LN LL+ V S++  Y  +   P + P    P  +
Sbjct: 286 KDVVLITSTYVKIRNRLYPDLNIKPLLNTLLSRVDSSLIKYDSIK--PMVVPTSKLPSKS 343

Query: 364 ILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGAVL 423
           +LRQEW+WNE+S +F++ D+I+TETGT+AFGINQ+ FP  + GISQ LWGS+G++ GA L
Sbjct: 344 VLRQEWVWNEISHWFQEKDVIITETGTSAFGINQTRFPKQSHGISQCLWGSVGYSLGACL 403

Query: 424 GASFAAEEIDPS-------KRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTI 476
           GASFA +E+  S        RVILF+GDG+ QLT+QE+ST+I+W+LKPY+F++NN GY+I
Sbjct: 404 GASFAVDELYESGKTNGIMPRVILFVGDGAFQLTMQEVSTMIKWNLKPYIFLMNNQGYSI 463

Query: 477 ERLI-HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRM 535
           +R + H  NA Y  IQ W +  LL+ FGA DYE  KI T  ++Q + +D  F    KIRM
Sbjct: 464 DRFLSHRSNAKYYDIQQWEYLNLLQVFGAIDYEAKKIVTVEDFQNILKDANFARNDKIRM 523

Query: 536 IEVMLPVMDAPSNLIAQ 552
           IE+MLP MD P +L+ Q
Sbjct: 524 IEIMLPPMDVPQSLMEQ 540

>SAKL0G03036g Chr7 (250012..251925) [1914 bp, 637 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380W ARO10
           Phenylpyruvate decarboxylase catalyzes decarboxylation
           of phenylpyruvate to phenylacetaldehyde which is the
           first specific step in the Ehrlich pathway
          Length = 637

 Score =  338 bits (868), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 207/603 (34%), Positives = 318/603 (52%), Gaps = 52/603 (8%)

Query: 6   LGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIY----EVPGMRWAGNANELNAAYAADGY 61
            G+Y+FERL     K++FG+PGDFNLSLL+ +Y    +   ++W G  NELNAAYAADGY
Sbjct: 34  FGQYVFERLISAGTKSVFGVPGDFNLSLLEHMYSRTVQRKDLKWFGTCNELNAAYAADGY 93

Query: 62  AR-VKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHH----- 115
           +R    + C+ITT+GVGELSA+NG+AG++AE+V VLH+VGV     +  +  +HH     
Sbjct: 94  SRYTNKIGCVITTYGVGELSAINGVAGAFAENVKVLHIVGVTPSKFRNDETFIHHNVHHL 153

Query: 116 --TLGNGDFT-----VFHRM-SANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGL 167
              + N +F       +H M    IS +T  V ++  A  ++D+ +   Y   +P Y+ +
Sbjct: 154 IPAMDNPNFRGPNHRSYHDMIDGRISCSTEFVDNVDQACDQLDKVVNDIYKYSKPGYIFI 213

Query: 168 PANLVDLPVPTHLLETPIDLTL-----KPNDQEAXXXXXXXXXXXXXXASNPVILADACA 222
           PA+  D  V    L T   +TL     +  +QE               +  P ++ D   
Sbjct: 214 PADFADKMVNAQNLITTPTITLENVISQGFNQEVVDSMATKIIDLLYKSKTPAVIGDVLC 273

Query: 223 GRHDVKVETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLI 282
            R     E    + +T+  AF + MG+  +DE  P F GVY G  S+ ++  A+ S DLI
Sbjct: 274 DRFGCVNEIRNFVRITKMWAFSSFMGRSILDESEPNFHGVYNGAESSPHIIQAIGSCDLI 333

Query: 283 LSVGALLSDFNTGSFSYSYKTKNI-VEFHSDYIKI------RNATFPGVQMKFVLNKLLA 335
           L  G L ++ N G +S+S+      VE HSDY+              GV    VLN+++ 
Sbjct: 334 LHFGVLKNEINNGHYSFSFNANATEVELHSDYLNFVDYKSGNEVLVKGVHFVSVLNRIIQ 393

Query: 336 VVGSAVKG--YTPVPLPPRL-TPNEPCPPDTILRQEWMWNEVSKFFRDGDIILTETGTAA 392
           ++        Y  + + P + TP     P++ + Q+++ N +S++   GD+ + ETG+  
Sbjct: 394 LIDVTKINLKYPDLTVNPEMATPAGIHSPESQITQKFLQNAMSEYLSPGDVFVVETGSFQ 453

Query: 393 FGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEE-------------IDPSKRVI 439
           F +    FP N   ISQ  + SIG    + LG   A ++             +D + ++I
Sbjct: 454 FVVRDFQFPTNVKYISQGFYLSIGMALPSCLGIGCAMKDYPGSHICDAGVSTLDYTPKLI 513

Query: 440 LFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLIHGPNAGYNAIQPWRHTKLL 499
           L  GDG+ Q+T+QE+++ +R+ +   +F+ NN+GYT+ER I GP   YN I  W+ TKLL
Sbjct: 514 LCEGDGAAQMTIQELTSFLRYQIPVEIFLWNNHGYTVERAIRGPTRSYNDIMEWKWTKLL 573

Query: 500 EAFGAND---YENVKITTTGEWQTLTQD-KQFNEPSKIRMIEVMLPVMDAPSNLIAQAKL 555
           EAFG  D    E  K+   GE++ +    K   E SK+R+IEVML +MD P  L+A A  
Sbjct: 574 EAFGDFDGSISEACKVKNVGEFKDVVGSLKHSKERSKVRLIEVMLGMMDIPKQLLAMA-- 631

Query: 556 TAC 558
           +AC
Sbjct: 632 SAC 634

>CAGL0A03102g Chr1 (317961..319910) [1950 bp, 649 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380w
          Length = 649

 Score =  336 bits (862), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 215/617 (34%), Positives = 316/617 (51%), Gaps = 60/617 (9%)

Query: 3   DLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYE---VPGMRWAGNANELNAAYAAD 59
           ++T G Y+F RL     K++FG+PGDFNL+LL+ +Y+      +RW GN NELNAAYAAD
Sbjct: 30  EITFGEYVFRRLLSCGTKSVFGVPGDFNLALLEHLYDDSVADALRWVGNCNELNAAYAAD 89

Query: 60  GYAR-VKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLL---LHH 115
           GY+R    + C+ITT+GVGELSALNG+AGS+AE V VLH+VGV S  +  K      +HH
Sbjct: 90  GYSRYTNKIGCLITTYGVGELSALNGVAGSFAEDVKVLHIVGVASSQTSCKNTDNKNVHH 149

Query: 116 ---TLGNGDF------TVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLG 166
               L + +F      T +  +   +      + DI  A   +D+ I   Y   +P YL 
Sbjct: 150 LIPALNDSNFVSPNHKTYYEMVKDRVCCAAEYLEDIDVACDMLDKVIEDMYRYSKPGYLF 209

Query: 167 LPANLVDLPVPTHLLETPIDLTLKPN-------DQEAXXXXXXXXXXXXXXASNPVILAD 219
           +PA+  D+ V T  L     +TL+          +                +SNP IL D
Sbjct: 210 IPADFADMMVSTRNLVARPTITLEQAIAPLVGCGESQLEAIVAKVAQLIYNSSNPCILGD 269

Query: 220 ACAGRHDVKVETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESA 279
               R+ V  + N LI   Q   F T MGK  IDE NP + G+Y G   + +V       
Sbjct: 270 VLTDRYGVSQQLNSLISHCQMWNFSTVMGKSVIDESNPYYKGLYNGRECSSSVIEDFSKC 329

Query: 280 DLILSVGALLSDFNTGSFSYSYKTK---NIVEFHSDYIKIRNAT------FPGVQMKFVL 330
           DLIL  G   ++ N G ++  Y      N+VEFHSDYI+  N+         GV    VL
Sbjct: 330 DLILHFGIERNEINNGHYTIDYNEHIGANVVEFHSDYIRFFNSKTKEEDMIRGVNFVHVL 389

Query: 331 NKLLAVVGSAVKGYTPVPLPPRLTPNEPCPPDTI----LRQEWMWNEVSKFFRDGDIILT 386
           N+L   + +    +         T N     D+     + QE++ + + ++   GD+++ 
Sbjct: 390 NRLQPAIQADKLSFNYQECST--TSNADSKIDSQSSNEITQEFLQDIMPQYLNPGDVLVC 447

Query: 387 ETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAA-----------EEIDPS 435
           ETG+  FG+    FP+N   +SQ  + SIG    A LG                EEI+  
Sbjct: 448 ETGSVQFGVRDYRFPSNVKYVSQGFYLSIGMALPASLGVGIGMQDYPMSHIPNPEEIEYE 507

Query: 436 KRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLIHGPNAGYNAIQPWRH 495
            ++ILF GDGS Q+T+QE+ST++  ++K  +F+ NN+GYTIER I GP   YN I PW  
Sbjct: 508 PKLILFEGDGSAQMTIQELSTMLHNNVKMEIFLWNNDGYTIERAIKGPTRSYNDIAPWNW 567

Query: 496 TKLLEAFG-----ANDYENVKITTTGEWQTLTQDK---QFNEPS-KIRMIEVMLPVMDAP 546
           TK+ EAFG      +   N   +T  E+ T  ++K   + N+P+ +I ++EV + V+D P
Sbjct: 568 TKMFEAFGDGLGSKHKTRNQVYSTREEFLTRLREKKDTKHNDPACQIELLEVKMGVLDFP 627

Query: 547 SNLIAQAKLTACINSKK 563
             L  +  ++A + +KK
Sbjct: 628 EQL--KCMVSAAMYNKK 642

>Kpol_1062.12 s1062 complement(31361..33253) [1893 bp, 630 aa] {ON}
           complement(31361..33253) [1893 nt, 631 aa]
          Length = 630

 Score =  333 bits (855), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 205/590 (34%), Positives = 303/590 (51%), Gaps = 47/590 (7%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIY------EVPGMRWAGNANELNAAYA 57
           L  G Y+F+RL     K+IFG+PGD+NL+LL+ +Y      +   + W G  NELNAAYA
Sbjct: 24  LRFGDYIFKRLNSCGTKSIFGVPGDYNLNLLELMYPNGTANKTSEINWIGCCNELNAAYA 83

Query: 58  ADGYAR-VKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHT 116
           ADGY+R    + CI+TT GVGELSA+NGI+GS+AEHV VLH+VG+PS          HH 
Sbjct: 84  ADGYSRYTNKLGCIVTTCGVGELSAMNGISGSFAEHVKVLHIVGIPSTEKFKTGGNFHHL 143

Query: 117 LGNG--------DFTVFHRM-SANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGL 167
           L N         ++ VF  M   ++S +T  + ++ TA  E D  IR  Y   +P Y+ +
Sbjct: 144 LPNFKESNLNKPNYKVFAEMVQGSVSCSTKFIENLDTACQEFDDLIRDIYKYSKPGYMFV 203

Query: 168 PANLVDLPV-PTHLLETPI-----DLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADAC 221
           P N   L V P +L ETP       +T+ P+  E               A  P I+AD  
Sbjct: 204 PENYFKLYVNPKNLYETPSITLQDCITMSPDKMEMADGLTDFIFSYLYHAEKPAIIADTL 263

Query: 222 AGRHDVKVETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADL 281
             R+      N+ I  T    F T MGK  +DE    + GVY G    E V+ A+ + DL
Sbjct: 264 TDRYSGSSLLNEFIQKTNIWNFSTLMGKSILDESTETYKGVYNGKDGCEKVQKAISTCDL 323

Query: 282 ILSVGALLSDFNTGSFS---YSYKTKNIVEFHSDYIKI------RNATFPGVQMKFVLNK 332
           IL  G   ++ N+G+++   Y  K   I+EFH  YI++          F GV+  ++L +
Sbjct: 324 ILHFGVEKNEVNSGTYTFEDYYSKVSFIIEFHPQYIRMIDMQSKSTQLFGGVEFTYILKR 383

Query: 333 LLAVVG-SAVKGYTPVPLPPRLTPNEPCPPDTILRQEWMWNEVSKFFRDGDIILTETGTA 391
           +L +V  S +    P         ++    +  + Q+ +   +  + + GD++L +TGT 
Sbjct: 384 MLKMVNPSNLHLNYPTSDESSTKTDQEAVANNQITQDHISTTMESYIKPGDVVLCDTGTF 443

Query: 392 AFGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEIDPSK------------RVI 439
            F +    F +    +SQ  + SIG+   + LG   A  +   S             R+I
Sbjct: 444 QFSLRDFKFSSQVKLVSQFFYLSIGYALPSALGVGIAMRDYPNSHIKDEQLKENTKPRLI 503

Query: 440 LFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLIHGPNAGYNAIQPWRHTKLL 499
           LF GDG+ Q+TVQE+ST++R+++   +F+ NN+GYTIER I GP   YN IQPW  T L 
Sbjct: 504 LFEGDGAAQMTVQELSTMLRYEVPMDIFLWNNDGYTIERAIQGPTRSYNDIQPWNWTYLF 563

Query: 500 EAFG---ANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVMLPVMDAP 546
           +AFG    N  +N K+ TT E   +  + +  + + I  +EV L +MD P
Sbjct: 564 KAFGDAKENFAKNHKVETTKELDNILTELRSKDQNNINFVEVTLGIMDMP 613

>NCAS0A11830 Chr1 (2347016..2348929) [1914 bp, 637 aa] {ON}
           Anc_5.456
          Length = 637

 Score =  333 bits (853), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 215/609 (35%), Positives = 316/609 (51%), Gaps = 52/609 (8%)

Query: 6   LGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYE----VPGMRWAGNANELNAAYAADGY 61
            G YL +R+     K+IFG+PGDFNLSLL+ +Y       G+RW G  NELNAAYAADGY
Sbjct: 30  FGEYLLQRILTAGTKSIFGVPGDFNLSLLEYLYTPSLISQGLRWIGTCNELNAAYAADGY 89

Query: 62  ARVKG-MACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP-SISSQAKQLL---LHH- 115
           +R    M+C+ITT+GVGELSA+NG+AG++AE V VLH+VGV  S+ S++       +HH 
Sbjct: 90  SRYSNKMSCLITTYGVGELSAMNGVAGAFAEDVKVLHIVGVTRSVDSRSDDYHTRNIHHL 149

Query: 116 --TLGNGDFT-----VFHRMSAN-ISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGL 167
              L + +F      V+  M  + ++ + A + +I TA  E+D+ I   Y   +P Y+ +
Sbjct: 150 VPKLKDSNFIGPNHRVYSEMVRDKLACSVAYLDNIETACDEVDKVIFDIYKYSKPGYIFV 209

Query: 168 PANLVDLPV-PTHLLETPIDLTLKPNDQEA----XXXXXXXXXXXXXXASNPVILADACA 222
           PA+  D+ V P++L+  P+ +TL+    E                   +  P I+ D   
Sbjct: 210 PADFSDMLVNPSNLVSNPV-ITLENAIPEVPSLELEEVTQLLLQCIYDSKTPAIIGDVLT 268

Query: 223 GRHDVKVETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLI 282
            R     E NKLI MT    F T MGK  IDE NP++ G+Y G     +V       DL+
Sbjct: 269 DRFGCAPELNKLIKMTSMWNFSTVMGKSVIDESNPKYMGLYNGNEGICSVTERFLQCDLV 328

Query: 283 LSVGALLSDFNTGSFSYSY-KTKNIVEFHSDYIKI------RNATFPGVQMKFVLNKLLA 335
           L  G  +++ N G ++Y Y +   IVE H +Y++           F GV    +L +LL 
Sbjct: 329 LHFGINVNEINNGHYTYKYNENAKIVELHPEYVRFFDFKINEEKLFKGVHFVPILKRLLE 388

Query: 336 VVGSAVKGYTPVPLPPRLTPNEPCPP-----DTILRQEWMWNEVSKFFRDGDIILTETGT 390
            +      +       R +  E C P     +  + Q  + N++  +F DGD+++ ETG+
Sbjct: 389 KLEPTNLNFNYPTNVARFSQEEICLPQESSSELKVTQTHLQNKIPSYFNDGDVVVCETGS 448

Query: 391 AAFGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEIDPSK------------RV 438
             F +   +FP+    ISQ  + SIG    A +G   A ++   S             R+
Sbjct: 449 FQFALRDFIFPSQLKYISQGFFLSIGMALPASMGVGIAMQDFPKSHLIANGKEHSYQPRL 508

Query: 439 ILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLIHGPNAGYNAIQPWRHTKL 498
           ILF GDG+ Q+TVQE++T++R  +   + +LNNNGYTIER I GP   YN I PW+ TKL
Sbjct: 509 ILFEGDGAAQMTVQELTTMLRNKIPIEIILLNNNGYTIERAIKGPTRSYNDIMPWKWTKL 568

Query: 499 LEAFGANDYE---NVKITTTGEWQTLTQDKQFNEPSK-IRMIEVMLPVMDAPSNLIAQAK 554
            EAFG  D +   N  + T  E   + +D ++ +    I ++EV L VMD P  L +   
Sbjct: 569 FEAFGDFDNKYTMNTLVETRSELDRILEDLKYKKRDNLIELLEVKLDVMDFPKQLQSMVD 628

Query: 555 LTACINSKK 563
             A   SKK
Sbjct: 629 AAAFKRSKK 637

>KLLA0F16962g Chr6 complement(1559454..1561190) [1737 bp, 578 aa]
           {ON} uniprot|O74722 Kluyveromyces lactis PDC Pyruvate
           decarboxylase
          Length = 578

 Score =  323 bits (827), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 187/559 (33%), Positives = 304/559 (54%), Gaps = 42/559 (7%)

Query: 2   PDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGY 61
           P + L  YLF RL+Q++ +T+FG+  +++ + L +     G++W    N+LN ++A D Y
Sbjct: 25  PLIPLPEYLFHRLFQLNCRTVFGV-ANYSTAKLYQAIAASGIQWIQTINQLNTSFAVDAY 83

Query: 62  ARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGD 121
            R  G++C +T+    EL  +NG  GS+ E+V +L VV V   S   ++L+       GD
Sbjct: 84  GRAIGVSCYVTSES-AELGHVNGFFGSFCEYVPILQVV-VLEQSHDLERLI-------GD 134

Query: 122 FTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHLL 181
            ++FH              D+   P+EID C+RT +  +RPVY+GL +      VP+  L
Sbjct: 135 VSIFH--------------DVVDDPSEIDSCVRTLFWGKRPVYMGLRSKDATKLVPSSSL 180

Query: 182 ETPI--DLTLKPN--DQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDM 237
              I   + +K      +               +S P+I+ DA   R++        +  
Sbjct: 181 NGNIADKMGIKNTFFQTDTIKRVIDKIIAEVYASSRPLIVVDALIDRYNYNSTIQNFLTE 240

Query: 238 TQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSF 297
           T  P   T M KG+IDE  P F G ++GT+S   VR  + +AD  L +G ++ +F     
Sbjct: 241 TGIPFVTTLMSKGSIDESLPNFVGTFLGTMSQPIVREYMNNADCTLILGCMIENFKNSYC 300

Query: 298 SYSYKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSA-VKGYTPVPLP---PRL 353
            ++YK+KN +   +D +KI N   P + +  +L +L+A + +  +    PV +P   PR+
Sbjct: 301 RFNYKSKNQILLWNDRVKIENNIIPDILLHELLPQLIASLDTTKIVNSRPVTIPNMIPRV 360

Query: 354 TPNEPCPPDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWG 413
            P     P T LRQE++W ++S + + GD+I++E+GT+A G+ Q  FP+NT  +SQ +W 
Sbjct: 361 EPQ----PVTFLRQEYLWFKMSTWLKQGDVIISESGTSAIGLLQQKFPDNTRLVSQAIWN 416

Query: 414 SIGFTGGAVLGASFAAEEIDP--SKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNN 471
           S G++ GA LG   A  ++      R+IL +GDGSLQ T QE+ST++    KPY+FV+NN
Sbjct: 417 SSGYSIGACLGILAAYRDMGTLDKHRIILMVGDGSLQFTFQELSTILTHGFKPYIFVINN 476

Query: 472 NGYTIERLIHGP----NAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQF 527
            GYT++R ++      NA Y  IQPW   KL   F + +Y   +  + GE  +L  DK+F
Sbjct: 477 QGYTVDRTLNREKTHLNATYFDIQPWELLKLPSLFYSQEYFKRRCMSVGELNSLLSDKEF 536

Query: 528 NEPSKIRMIEVMLPVMDAP 546
           N+  +++++E++LP MD P
Sbjct: 537 NKSDQLKIVELILPSMDVP 555

>Suva_2.554 Chr2 (984966..986873) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  324 bits (831), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 219/614 (35%), Positives = 311/614 (50%), Gaps = 57/614 (9%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIY----EVPGMRWAGNANELNAAYAAD 59
           +  G Y+F RL+ +  K++FG+PGDFNLSLL+ +Y    E  G++W G  NELNAAYAAD
Sbjct: 25  MPFGEYIFRRLFSIGTKSVFGVPGDFNLSLLEYLYAPSVESDGLQWVGTCNELNAAYAAD 84

Query: 60  GYARVKG-MACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP----SISSQAKQLLLH 114
           GY+R    + C+ITT+GVGELSALNGIAGS+AE+V VLH+VGV     S S+  K+  LH
Sbjct: 85  GYSRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAKSTDSRSNNFKERNLH 144

Query: 115 H---TLGNGDFT-----VFHRM-SANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYL 165
           H    L + +F      V+H M   N++ + A + DI TA  ++D  IR  Y   +P Y+
Sbjct: 145 HLVPRLHDSNFKGPNHKVYHDMIKDNVACSVAYLEDIETACDQVDAVIRDIYRYSKPGYV 204

Query: 166 GLPANLVDLPVP-THLLETP---IDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADAC 221
            +PA+  D+ V   +L+  P       +  + +                +  P IL D  
Sbjct: 205 FVPADFPDMSVRLDNLINVPHISQQDCITSSSETQLFNIIDKITTWMYSSRTPAILGDVL 264

Query: 222 AGRHDVKVETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADL 281
             R+ V    NKLI  ++   F T MGK  IDE NP + G+Y G    + V    ES DL
Sbjct: 265 TDRYGVSDILNKLIYASKIWNFTTVMGKSVIDESNPSYMGLYNGKEGLKQVYEHFESCDL 324

Query: 282 ILSVGALLSDFNTGSFSYSYK-TKNIVEFHSDYIKI------RNATFPGVQMKFVLNKLL 334
           IL  G  +++ N G +S++YK    I++FH +YI+           F GV    VL +L 
Sbjct: 325 ILHFGVDINEINNGHYSFTYKPNAKIIQFHPNYIRFVDTRYGEEQIFEGVNFVPVLQELY 384

Query: 335 AVVG---------SAVKGYTPVPLPPRLTPNEPCPPDTILRQEWMWNEVSKFFRDGDIIL 385
             +          S V  YT   +      N+     T + Q  +   + KF   GD+++
Sbjct: 385 QCIDVSKLSLQYDSRVTPYTNETMKLEDPTNDQS---TDITQIHLQKVIPKFLNPGDVVV 441

Query: 386 TETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEIDPSK--------- 436
            ETG+  F +    FP     ISQ  + SIG    A LG   A ++   +          
Sbjct: 442 CETGSFQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIAMQDHPNTHINGGNINEG 501

Query: 437 ---RVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLIHGPNAGYNAIQPW 493
              R+ILF GDG+ Q+T+QE+ST++++ +   + + NNNGYTIER I GP   YN I  W
Sbjct: 502 YKPRLILFEGDGAAQMTIQELSTILKFHIPIEIVIWNNNGYTIERAIMGPTRSYNDIMSW 561

Query: 494 RHTKLLEAFGAND--YENVKITTTGEWQTLTQDKQFNEPS--KIRMIEVMLPVMDAPSNL 549
           + TKL EAFG  D  Y N  I  T     L      N  +  +I ++EV L V+D P  L
Sbjct: 562 KWTKLFEAFGDFDGKYTNNTIIETTSKLALKLKDLKNSSTRDRIELLEVKLGVLDFPEQL 621

Query: 550 IAQAKLTACINSKK 563
               +  A   +KK
Sbjct: 622 RCMVEAAALKRNKK 635

>YDR380W Chr4 (1234218..1236125) [1908 bp, 635 aa] {ON}
           ARO10Phenylpyruvate decarboxylase, catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde,
           which is the first specific step in the Ehrlich pathway
          Length = 635

 Score =  323 bits (828), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 217/613 (35%), Positives = 313/613 (51%), Gaps = 59/613 (9%)

Query: 6   LGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIY----EVPGMRWAGNANELNAAYAADGY 61
            G Y+F+RL  +D K++FG+PGDFNLSLL+ +Y    E  G+RW G  NELNAAYAADGY
Sbjct: 27  FGEYIFKRLLSIDTKSVFGVPGDFNLSLLEYLYSPSVESAGLRWVGTCNELNAAYAADGY 86

Query: 62  ARVKG-MACIITTFGVGELSALNGIAGSYAEHVGVLHVVGV-PSISSQAKQLL---LHH- 115
           +R    + C+ITT+GVGELSALNGIAGS+AE+V VLH+VGV  SI S++       LHH 
Sbjct: 87  SRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAKSIDSRSSNFSDRNLHHL 146

Query: 116 --TLGNGDFT-----VFHRMSAN-ISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGL 167
              L + +F      V+H M  + ++ + A + DI TA  ++D  IR  Y   +P Y+ +
Sbjct: 147 VPQLHDSNFKGPNHKVYHDMVKDRVACSVAYLEDIETACDQVDNVIRDIYKYSKPGYIFV 206

Query: 168 PANLVDLPVPT-HLLETP----IDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACA 222
           PA+  D+ V   +L+  P     D  + P++ +               +  P IL D   
Sbjct: 207 PADFADMSVTCDNLVNVPRISQQDCIVYPSENQ-LSDIINKITSWIYSSKTPAILGDVLT 265

Query: 223 GRHDVKVETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLI 282
            R+ V    NKLI  T    F T MGK  IDE NP + G Y G    + V    E  DL+
Sbjct: 266 DRYGVSNFLNKLICKTGIWNFSTVMGKSVIDESNPTYMGQYNGKEGLKQVYEHFELCDLV 325

Query: 283 LSVGALLSDFNTGSFSYSYK-TKNIVEFHSDYIKI------RNATFPGVQMKFVLNKLLA 335
           L  G  +++ N G ++++YK    I++FH +YI++          F G+    +L +L  
Sbjct: 326 LHFGVDINEINNGHYTFTYKPNAKIIQFHPNYIRLVDTRQGNEQMFKGINFAPILKELYK 385

Query: 336 VVG---------SAVKGYTPVPLPPRLTPNEPCPPDTILRQEWMWNEVSKFFRDGDIILT 386
            +          S V  YT   +      N      +I+ Q  +   + KF   GD+++ 
Sbjct: 386 RIDVSKLSLQYDSNVTQYTNETMRLEDPTN---GQSSIITQVHLQKTMPKFLNPGDVVVC 442

Query: 387 ETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEI------------DP 434
           ETG+  F +    FP+    ISQ  + SIG    A LG   A ++             D 
Sbjct: 443 ETGSFQFSVRDFAFPSQLKYISQGFFLSIGMALPAALGVGIAMQDHSNAHINGGNVKEDY 502

Query: 435 SKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLIHGPNAGYNAIQPWR 494
             R+ILF GDG+ Q+T+QE+ST+++ ++   + + NNNGYTIER I GP   YN +  W+
Sbjct: 503 KPRLILFEGDGAAQMTIQELSTILKCNIPLEVIIWNNNGYTIERAIMGPTRSYNDVMSWK 562

Query: 495 HTKLLEAFGAND--YENVKITTTGEWQTLTQD--KQFNEPSKIRMIEVMLPVMDAPSNLI 550
            TKL EAFG  D  Y N  +        L  +  K  N+ S I ++EV L  +D P  L 
Sbjct: 563 WTKLFEAFGDFDGKYTNSTLIQCPSKLALKLEELKNSNKRSGIELLEVKLGELDFPEQLK 622

Query: 551 AQAKLTACINSKK 563
              +  A   +KK
Sbjct: 623 CMVEAAALKRNKK 635

>Skud_4.651 Chr4 (1157087..1158994) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  320 bits (820), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 217/616 (35%), Positives = 310/616 (50%), Gaps = 61/616 (9%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIY----EVPGMRWAGNANELNAAYAAD 59
           ++ G Y+F RL     K++FG+PGDFNLSLL+ +Y    E  G++W G  NELNAAYAAD
Sbjct: 25  ISFGEYIFRRLLSTGTKSVFGVPGDFNLSLLEYLYAPSVESAGLKWIGTCNELNAAYAAD 84

Query: 60  GYARVKG-MACIITTFGVGELSALNGIAGSYAEHVGVLHVVGV-PSISSQAKQLL---LH 114
           GY+R    + C++TTFGVGELSALNG+AGS+AE+V VLH+VGV  SI S++       +H
Sbjct: 85  GYSRYSNNIGCLVTTFGVGELSALNGVAGSFAENVKVLHIVGVAKSIDSRSDNFRDRNMH 144

Query: 115 H---TLGNGDFT-----VFHRMSAN-ISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYL 165
           H    L   +F      V+H M  + ++ + A + DI TA  ++D  IR  Y   +P Y+
Sbjct: 145 HLVPQLHGSNFKGPNHKVYHDMVKDRVACSVAYLEDIETACDQVDNVIRDIYKYSKPGYI 204

Query: 166 GLPANLVDLPVPT-HLLETP----IDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADA 220
            +PA+  D+ V   +L+  P     D    P+ Q                +  P IL D 
Sbjct: 205 FVPADFADMSVTCENLINVPHISQQDCITYPS-QIQLFDILDRITSWMYSSKTPAILGDV 263

Query: 221 CAGRHDVKVETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESAD 280
              R+ V    NKLI  T    F T MGK  IDE NP++ G Y G      V    ES D
Sbjct: 264 LTDRYGVSEILNKLIYATGIWNFSTVMGKSVIDEANPKYMGQYNGKEGLRQVYEHFESCD 323

Query: 281 LILSVGALLSDFNTGSFSYSYK-TKNIVEFHSDYIKI------RNATFPGVQMKFVLNKL 333
           L+L  G  +++ N G ++++YK    I++FH +YI+           F G+    VL +L
Sbjct: 324 LVLHFGVDINEINNGHYTFTYKPNAKIIQFHPNYIRFVDTKYGHEQMFEGINFAPVLMEL 383

Query: 334 LAVVG---------SAVKGYTPVPLPPRLTPNEPCPPDTILRQEWMWNEVSKFFRDGDII 384
              +          S V  YT   +      N+     T   Q  +   + KF   GD++
Sbjct: 384 YKGIDVSRLSLQYDSGVTSYTNETMQLEDPTNDQSNNIT---QVHLQKVMPKFLSPGDVV 440

Query: 385 LTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEIDPSK-------- 436
           + ETG+  F +    FP     ISQ  + SIG    A LG   A ++   +         
Sbjct: 441 VCETGSFQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIAMQDFPNAHISDENIGE 500

Query: 437 ----RVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLIHGPNAGYNAIQP 492
               R+ILF GDG+ Q+T+QE+ST+++  +   +F+ NNNGYTIER I GP   YN +  
Sbjct: 501 GYKPRLILFEGDGAAQMTIQELSTILKCHITIDIFIWNNNGYTIERAIMGPTRAYNDVMS 560

Query: 493 WRHTKLLEAFGANDYENVKITTTGEWQT-----LTQDKQFNEPSKIRMIEVMLPVMDAPS 547
           W+ TKLLEAFG  D ++   +T  E+ +     L + K  N    I ++EV L V+D P 
Sbjct: 561 WKWTKLLEAFGDFDRKHTN-STVIEYPSKLAMKLEELKSSNTRDGIELVEVKLGVLDFPE 619

Query: 548 NLIAQAKLTACINSKK 563
            L       A   +KK
Sbjct: 620 QLKCMVDAAALKRNKK 635

>Smik_4.649 Chr4 (1154670..1156577) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  318 bits (814), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 218/615 (35%), Positives = 317/615 (51%), Gaps = 63/615 (10%)

Query: 6   LGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIY----EVPGMRWAGNANELNAAYAADGY 61
            G Y+F RL  +  K++FG+PGDFNLSLL+ +Y    E  G+RW G  NELNAAYAADGY
Sbjct: 27  FGEYIFRRLLSIGTKSVFGVPGDFNLSLLEYLYSPNVESAGLRWVGTCNELNAAYAADGY 86

Query: 62  ARVKG-MACIITTFGVGELSALNGIAGSYAEHVGVLHVVGV-PSISSQA---KQLLLHH- 115
           +R    + C+ITT+GVGELSALNGIAGS+AE+V VLH+VGV  SI S++   K+  LHH 
Sbjct: 87  SRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAKSIDSRSNNFKERNLHHL 146

Query: 116 --TLGNGDFT-----VFHRMSAN-ISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGL 167
              + N +F      V+H M  + ++ + A + DI TA  ++D  IR  +   +P Y+ +
Sbjct: 147 VPQVHNSNFKGPNHKVYHDMVKDRVACSVAYLEDIETACVQVDNVIRDIFKYSKPGYIFV 206

Query: 168 PANLVDLPVPT-HLLETPI-----DLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADAC 221
           PA+  D+ V   +L++ P       +T  P  Q                +  P IL D  
Sbjct: 207 PADFADMSVAADNLVKVPHISQQDCITYPPEVQ--LLDIIDKITSWMYSSKTPAILGDVL 264

Query: 222 AGRHDVKVETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADL 281
             R+ V    N+LI  T+   F T MGK  IDE NP + G Y G    + V    ES DL
Sbjct: 265 TDRYGVSNILNELIYTTKIWNFSTVMGKSVIDESNPTYMGQYNGKEGLKQVYKHFESCDL 324

Query: 282 ILSVGALLSDFNTGSFSYSYK-TKNIVEFHSDYIKIRNAT------FPGVQMKFVLNKLL 334
           +L  G  +++ N G ++++YK    I++FH +YI+  +        F GV    VL +L 
Sbjct: 325 VLHFGVDINEINNGHYTFTYKPNAKIIQFHPEYIRFVDTKYGDEQMFEGVNFVPVLKELY 384

Query: 335 AVVG---------SAVKGYTPVPLP-PRLTPNEPCPPDTILRQEWMWNEVSKFFRDGDII 384
            ++          S V  YT   +    LT ++     +I+ Q  +   +  F   GD++
Sbjct: 385 KLIDVARLSLQYDSNVTSYTNETMQIEDLTDDQ----SSIITQAHLQKVMPGFLNPGDVV 440

Query: 385 LTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEI------------ 432
           + ETG+  F +    FP     ISQ  + SIG    A LG   A ++             
Sbjct: 441 VCETGSFQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIAMQDYSNAHINGSNVKE 500

Query: 433 DPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLIHGPNAGYNAIQP 492
           D   R+ILF GDG+ Q+T+QE+ST+++ ++   + + NNNGYTIER I GP   YN I  
Sbjct: 501 DYKPRLILFEGDGAAQMTIQELSTILKCNVPLEIIIWNNNGYTIERAIMGPTRSYNDIMS 560

Query: 493 WRHTKLLEAFGANDYENVKITT----TGEWQTLTQDKQFNEPSKIRMIEVMLPVMDAPSN 548
           W+ TKL EAFG  D ++   T     +     L + K     ++I ++EV L V+D P  
Sbjct: 561 WKWTKLFEAFGDFDGKHTSSTLIEFPSKLALKLKELKNSARRNQIELLEVKLGVLDFPEQ 620

Query: 549 LIAQAKLTACINSKK 563
           L    +  A   +KK
Sbjct: 621 LKCMVEAAALKRNKK 635

>KLTH0F15510g Chr6 complement(1265767..1267644) [1878 bp, 625 aa]
           {ON} similar to uniprot|Q06408 Saccharomyces cerevisiae
           YDR380W ARO10 Phenylpyruvate decarboxylase catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde
           which is the first specific step in the Ehrlich pathway
          Length = 625

 Score =  317 bits (811), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 213/609 (34%), Positives = 307/609 (50%), Gaps = 65/609 (10%)

Query: 6   LGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYE----VPGMRWAGNANELNAAYAADGY 61
           LG+Y+FER+     +TIFG+PGDFNLSLL+ IY     + G++W G  NELNAAYAADGY
Sbjct: 24  LGQYIFERIVSSGTRTIFGVPGDFNLSLLEHIYNPEVALKGIKWIGTCNELNAAYAADGY 83

Query: 62  AR-VKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGV-PSI----SSQAKQLLLHH 115
           +R    + C+ITT GVGELSALNGIAG++AE V +LH+VGV PS     S+Q+   + H 
Sbjct: 84  SRYTNKIGCLITTLGVGELSALNGIAGAFAEDVKILHIVGVAPSQFYEGSAQSSHNVHHL 143

Query: 116 TLGNGDFTVF---HRM-----SANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGL 167
                D  +    HR+        +S ++  + DI +A  +ID  I   Y   +P Y+ +
Sbjct: 144 VPAVFDSNIHAPNHRVYRDMVDKRVSCSSLFLDDISSACDQIDTVISDIYRYSKPGYIFI 203

Query: 168 PANLVDLPVPTHLLETPIDLTLKP-------NDQEAXXXXXXXXXXXXXXASNPVILADA 220
           PA+  D  V    LE    + L+        ND +               +S P I+AD 
Sbjct: 204 PADFTDKLVDARNLEKRPAILLRDVVSGFCINDHKCQELAEYILESMYS-SSRPAIIADI 262

Query: 221 CAGRHDVKVETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESAD 280
              R+D+     +L++ T    F + MGK  +DE N  F GVY G+ S + V    ++ D
Sbjct: 263 LCDRYDLTSSLRELVNKTHVWNFASSMGKSILDENNLGFRGVYNGSESQDQVLKDFQTCD 322

Query: 281 LILSVGALLSDFNTGSFSYSYKT-KNIVEFHSDYIKI------RNATFPGVQMKFVLNKL 333
            +L VG + ++ NTG +SY +    NIVE H  Y+        +N    G     VL+ +
Sbjct: 323 FLLHVGVVKNEMNTGHYSYKFSNHSNIVELHPSYVNFIDADTGKNRYVTGQYFFKVLDMM 382

Query: 334 LAVVGSAVK--GYTPVPLPPRLTPNEPC-PPDTILRQEWMWNEVSKFFRDGDIILTETGT 390
             ++       GY    +P R    E C PP + +   ++     KF   GD+ + +TG+
Sbjct: 383 TQMIDPTKLHLGYQE-SIPSR--TQEYCGPPHSSVTHSYLQTHFPKFLSSGDVFVVDTGS 439

Query: 391 AAFGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEIDPSK-------------- 436
             FG+    FP++   ISQ  + SIG      LG     ++  PS               
Sbjct: 440 FQFGVRDYRFPSDLKYISQSFYLSIGMALPCALGVGLGMQDY-PSNHIISSALVQRNYQP 498

Query: 437 RVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLIHGPNAGYNAIQPWRHT 496
           R+IL  GDG+ Q+T+QE+++ +R+ +   LF+ NN GYT+ER I GPN  YN I  W  T
Sbjct: 499 RLILCEGDGAAQMTIQELTSFLRYKVPIDLFIWNNGGYTVERAIKGPNRPYNDIMAWEWT 558

Query: 497 KLLEAFGANDYENV---KITTTGEWQTLTQDKQFNEPSK----IRMIEVMLPVMDAPSNL 549
           +LL  FG    EN    K+++  +   L   K F    K    +R++EVML VMD P  L
Sbjct: 559 ELLRVFGDPKLENSVSQKVSSADQMSELL--KTFRSSDKRSKLVRLVEVMLGVMDFPEQL 616

Query: 550 IAQAKLTAC 558
            A A   AC
Sbjct: 617 KAMA--IAC 623

>ZYRO0G04378g Chr7 complement(350070..351911) [1842 bp, 613 aa] {ON}
           similar to uniprot|Q06408 Saccharomyces cerevisiae
           YDR380W ARO10 Phenylpyruvate decarboxylase catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde
           which is the first specific step in the Ehrlich pathway
          Length = 613

 Score =  316 bits (810), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 216/608 (35%), Positives = 313/608 (51%), Gaps = 62/608 (10%)

Query: 6   LGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVP----GMRWAGNANELNAAYAADGY 61
            G YLF++L Q   K+IFG+PGD+NL LL+ +Y+      G RW    NELNAAYAADGY
Sbjct: 18  FGEYLFKKLVQSGSKSIFGVPGDYNLPLLEHLYDDSVKDIGCRWIACCNELNAAYAADGY 77

Query: 62  AR-VKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHH---TL 117
           +R    +A +ITT+GVGELSA+NG+AGS AE+V VLH+VGV  + S A +   HH    L
Sbjct: 78  SRYTNKLATLITTYGVGELSAINGVAGSSAENVKVLHIVGV--VKSDAPECNYHHLIPQL 135

Query: 118 GNGDFT------VFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANL 171
            + +F        +  +   ++ +   + DI TAP ++D+ I   Y   +P YL +PA+ 
Sbjct: 136 QHSNFIGPNRKICYDMVKDRVACSAEYLEDIETAPEKVDKVITEIYKHSKPGYLFVPADF 195

Query: 172 VDLPVPTHLLETPIDL--TLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKV 229
            D  V T  L   I+L  +++    E               +  P ILAD    R  +  
Sbjct: 196 ADKLVDTTCLNNEINLCNSIERTPSEKLDSIVDGVLQWIYQSQTPAILADGNVDRFGLIS 255

Query: 230 ETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALL 289
           + N+ I+ TQ   F T MGK  IDE NPR+ G+Y G    + VR+   S DLIL  G   
Sbjct: 256 QLNQFIERTQMVNFTTIMGKSIIDETNPRYQGLYAGKSCTDLVRSKFLSCDLILHFGVEK 315

Query: 290 SDFNTGSFSYSYKTK-NIVEFHSDYIKI-----------RNATFPGV----QMKFVLNKL 333
           ++ N  +  + Y  +  ++EFH  YI++            N  F  V      +  ++KL
Sbjct: 316 NEVNYCAQGFPYGPQAKVIEFHQSYIRLFDTLNGDEQLFENVNFVDVLTALHQRIDISKL 375

Query: 334 LAVVGSAV-KGYTPVPLPPRLTPNEPCPPDTILRQEWMWNEVSKFFRDGDIILTETGTAA 392
                 A+   Y P  L      N P    + + Q ++  +  +    GDI++++TG+  
Sbjct: 376 NLQYDKAIFTTYEPSQL------NLPEEDTSDVTQIYLQKKFPEILAPGDILVSDTGSFQ 429

Query: 393 FGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEE------IDPSK-------RVI 439
           FG+     P  +  ++Q  W SIG    A LG     ++       D SK       +++
Sbjct: 430 FGVRDYKLPTQSKFMAQSTWLSIGMGLPAALGVGIGMQDYPRIHICDQSKVPAGYKPKLV 489

Query: 440 LFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLIHGPNAGYNAIQPWRHTKLL 499
           L +GDG+ Q+TVQE++T++R+ +   +FV NNNGYTIER I G N+ YN I PWR TKL 
Sbjct: 490 LGVGDGAAQMTVQELTTMLRYHVDINVFVWNNNGYTIERAIMGENSDYNDIMPWRWTKLF 549

Query: 500 EAFGAND--YENVKITTTGEWQTLTQD-KQFNEPSK-IRMIEVMLPVMDAPSNLIAQAKL 555
           EAFG  D  Y N  +  T   Q L Q  +  N+  K I ++EV L VMD P+ L  Q  L
Sbjct: 550 EAFGDFDGKYSNSSLVKTR--QELDQKIEDINKGGKGIELVEVKLGVMDYPAQL--QMML 605

Query: 556 TACINSKK 563
           +   N+KK
Sbjct: 606 SNMKNAKK 613

>KAFR0E03730 Chr5 complement(746616..748523) [1908 bp, 635 aa] {ON}
           Anc_5.456 YDR380W
          Length = 635

 Score =  315 bits (807), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 204/599 (34%), Positives = 312/599 (52%), Gaps = 55/599 (9%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVP----GMRWAGNANELNAAYAAD 59
           +  G Y+F+R+     K++FG+PGDFNL LL+ +Y+      G+RW G  NELNAAYAAD
Sbjct: 25  IRFGEYIFQRILSCGTKSVFGVPGDFNLPLLEYLYDDSIINQGLRWIGTCNELNAAYAAD 84

Query: 60  GYARV-KGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP-SISSQA---KQLLLH 114
           GY+R  +G+ C+ITT+GVGELSA+NGIAG++AE+V +LH+VGV  SI SQ    KQ  LH
Sbjct: 85  GYSRYSQGIGCLITTYGVGELSAMNGIAGAFAENVKLLHIVGVARSIDSQHDDFKQRNLH 144

Query: 115 H---TLGNGDFT-----VFHRMSAN-ISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYL 165
           H    L + +F+     +++ M  + IS +T  + +I TA  ++D+ I   Y   +P Y+
Sbjct: 145 HLVPQLNDSNFSGPNHKIYYEMVKDRISCSTEYLENIDTACDQVDKVIMDIYRYSKPGYI 204

Query: 166 GLPANLVDLPVPT-HLLETPI----DLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADA 220
            +P + V++ V T +LL+ P     D  L+ +                  + +P I+ D 
Sbjct: 205 FVPCDFVNMMVDTKNLLQRPKITFQDCILQDDKLNQIDQITNLILDQIYSSKSPAIIGDV 264

Query: 221 CAGRHDVKVETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESAD 280
              R+      N+ I +T+   F T  GK  I+E+NP + G+Y G    E V +     D
Sbjct: 265 LTDRYHGNKLLNEFITLTKIWNFTTFNGKSIINEQNPYYMGLYNGNEGAETVIDRFLKCD 324

Query: 281 LILSVGALLSDFNTGSFSYSYKTK-NIVEFHSDYIKIRNA------TFPGVQMKFVLNKL 333
           LI++VG  +++ N G +++SY+    ++E H  YI++ +        F G+    VL ++
Sbjct: 325 LIINVGIDINEINHGHYTFSYRQNAKLIEMHPTYIRLYDTGSHEETLFKGINFIHVLKRM 384

Query: 334 LAVVGSAVKGYTPVPLPPRLTPN------EPCPPDTILRQEWMWNEVSKFFRDGDIILTE 387
           L  +      +   P   +  P          P    + Q ++   V  +  DGD+++ E
Sbjct: 385 LIKIDIKRFDFDYDPSVTKFDPTIELKFPSADPDSNKITQNFLAQNVPDYLNDGDVLVVE 444

Query: 388 TGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEIDPSK----------- 436
           TG   F     L P+    I+Q  + SIG    A LG   A ++                
Sbjct: 445 TGAFQFATRDFLLPDQLKYITQGFYLSIGTALPAALGVGIAMQDYPRCHLYGKIPETYNP 504

Query: 437 RVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLIHGPNAGYNAIQPWRHT 496
           R+IL  GDG+ Q+TVQE+S+ IR+++   + +LNN+GYTIER I GP   YN I  W  T
Sbjct: 505 RLILMEGDGAAQMTVQELSSFIRYNIPIEIILLNNDGYTIERAILGPTRSYNDIMAWNWT 564

Query: 497 KLLEAFGANDYEN---VKITTTGEWQTLTQDKQFN---EPSKIRMIEVMLPVMDAPSNL 549
           K+ EA G  D++N   V  T     + L + KQ     E +KI  IEV+L V+D P  L
Sbjct: 565 KIFEALG--DFDNKATVNTTIKSPSKLLNKFKQLKNETERNKIEFIEVILGVLDYPEQL 621

>ACR211W Chr3 (716693..718582) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR380W (ARO10)
          Length = 629

 Score =  308 bits (788), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 206/602 (34%), Positives = 312/602 (51%), Gaps = 53/602 (8%)

Query: 1   MP-DLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYE----VPGMRWAGNANELNAA 55
           MP ++ LG Y+F RL     KT+FG+PGDFN+ LL+ +Y       G++W G  NELNAA
Sbjct: 26  MPAEMPLGEYMFRRLMSAGTKTVFGVPGDFNMGLLEHMYGEAVCAEGLQWIGTCNELNAA 85

Query: 56  YAADGYAR-VKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLL-- 112
           YAADGY+R    + C++TT GVGELSALNG+AG++AEHV VLH+VGV   ++Q    L  
Sbjct: 86  YAADGYSRYCNKIGCVVTTLGVGELSALNGVAGAFAEHVKVLHIVGVSMRAAQTHPELHG 145

Query: 113 -LHH---TLGNGDFT-----VFHRM-SANISETTAMVTDIGTAPAEIDRCIRTTYVTQRP 162
            +HH    L N +F      V+  M S  +S     + D+ TA  +ID  IR  +   +P
Sbjct: 146 NVHHLVPRLRNSNFKAPNHKVYSEMVSGRVSCCCEFLEDLETACDQIDHVIREIWRHGKP 205

Query: 163 VYLGLPANLVDLPV--------PTHLLETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNP 214
            YL +PA++ ++ V        PT +LE+ +   L+  +  A              +S P
Sbjct: 206 GYLFVPADMPNMKVSSRNLVQAPTIMLESAV---LERTNLAACDRIGIEILQHLYQSSTP 262

Query: 215 VILADACAGRHDVKVETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRN 274
            IL D    R  +  +  +L+++T    F T MGK  +DE  P + GVY G  S E  RN
Sbjct: 263 AILCDGLCDRFGLTGDVRRLVELTGMWNFSTIMGKSILDETQPHYKGVYYGAGSKE--RN 320

Query: 275 AV-ESADLILSVGALLSDFNTGSFSYSYKTKN-IVEFHSDYIKI-RNAT---FPGVQMKF 328
           A+ +  DLIL +G +  + NT  +++ +  ++ I+E H +Y+ + RN          +  
Sbjct: 321 ALLQECDLILYLGPVKDEVNTWKYTFQFNPQSMIIELHPEYVSLTRNGEQTILNSGHLLP 380

Query: 329 VLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCPPDTILRQEWMWNEVSKFFRDGDIILTET 388
           VL  +LA +  A   +       R+        D  + Q  + + + +    GD+++ +T
Sbjct: 381 VLRSILAHLNVANLSFNYPTAKKRVPREHQYAADEPITQGMLQHMIPECLNPGDVMVVDT 440

Query: 389 GTAAFGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEE-----IDP-------SK 436
           GT  F +    FP +   ISQ  + SIG    A LG + A  E     + P       + 
Sbjct: 441 GTFQFSVFDMKFPTDLKCISQSFYLSIGMALPAALGVACAMREFPRLHLGPKLANEGYTP 500

Query: 437 RVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLIHGPNAGYNAIQPWRHT 496
           R++L  GDG+ Q+T+QE+ST IR++L   + + NN+GYT+ER+I GP   YN I  W  T
Sbjct: 501 RLVLCEGDGAAQMTIQELSTFIRYELPVEVLLWNNDGYTVERVIKGPTRSYNDIMSWDWT 560

Query: 497 KLLEAFGANDYENVKITTTGEWQTLTQD----KQFNEPSKIRMIEVMLPVMDAPSNLIAQ 552
           KLL  FG  D    +     ++ +L +     K   + SKIR++EV+L  MD  + L   
Sbjct: 561 KLLRVFGDFDGTRSESVRVKDFNSLIEHLSSWKSDKKRSKIRLMEVILDKMDISATLKEL 620

Query: 553 AK 554
           AK
Sbjct: 621 AK 622

>KLLA0E02707g Chr5 (251220..253115) [1896 bp, 631 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380W ARO10
           Phenylpyruvate decarboxylase catalyzes decarboxylation
           of phenylpyruvate to phenylacetaldehyde which is the
           first specific step in the Ehrlich pathway
          Length = 631

 Score =  305 bits (781), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 198/595 (33%), Positives = 306/595 (51%), Gaps = 48/595 (8%)

Query: 3   DLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYE----VPGMRWAGNANELNAAYAA 58
           ++  G Y+FERL     K+IFG+PGDFNL LL+ +Y+      G++W G  NELN AYAA
Sbjct: 31  NIPFGHYVFERLLNSGAKSIFGVPGDFNLPLLEYLYDEDLVANGLQWIGTCNELNGAYAA 90

Query: 59  DGYAR-VKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGV-PSISSQAKQLL---L 113
           DGY+R    + C+ITT+GVGELSALNG+AG++AE V VLH++GV PS   + +Q     +
Sbjct: 91  DGYSRYTNKLGCVITTYGVGELSALNGVAGAFAEDVKVLHIIGVSPSRFRENEQFRSHNV 150

Query: 114 HHTLGNGDF-------TVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLG 166
           HH +   D          F  +   +  ++A + DI TA   +D+ I       +P Y+ 
Sbjct: 151 HHLVPAIDSQQPPNHQVYFDMVKDRVCCSSAFLDDINTAADRLDQVIVDICKNSKPGYVF 210

Query: 167 LPANLVDLPVPT-HLLETPI---DLTLKP-NDQEAXXXXXXXXXXXXXXASNPVILADAC 221
           +P +  D  V   +L++ PI   D  ++   D+ A              ++ P + +D  
Sbjct: 211 IPVDFADKLVSNKNLIQNPIIDMDTVIESYKDENATKIAGDRLLQWIYESNAPSVFSDLL 270

Query: 222 AGRHDVKVETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADL 281
             R +++ E  + I+      + T MGK T+DERNP++ G+Y G  + + ++  V+S+DL
Sbjct: 271 VDRFNLRKELRQFIETADVWNYNTAMGKSTLDERNPKYLGLYKGAETGKEMQATVDSSDL 330

Query: 282 ILSVGALLSDFNTGSFSYSY-KTKNIVEFHSD---YIKIRNATFPGVQMKFVLNKLLAVV 337
           IL  G   ++ N G +S+ + +   I+E  ++   +I I++     V+    ++ L  V 
Sbjct: 331 ILHFGPAKNEINCGYYSFHFNENARIIELSNNIIQFIDIKDKNASTVEEANFVSVLKYVN 390

Query: 338 GSAVKGYTPVPLPPRLTPNEPCPPDT--ILRQEWMWNEVSKFFRDGDIILTETGTAAFGI 395
            +  K       PP    N  C  D    + Q+ +   +  +F DGD+++ ETG+  FG+
Sbjct: 391 DNLDKSKLSFSYPPVPKSNHSCEYDNNDSITQKSLKEIIPNYFNDGDVLIVETGSFQFGV 450

Query: 396 NQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEIDPSK-------------RVILFI 442
               F      I+Q  + SIG    A LG      +   S              R+IL  
Sbjct: 451 PNMQFAREMKYITQSFYLSIGMALPAALGVGCGMRDYPRSHIVDQALVPKDYIPRLILCE 510

Query: 443 GDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLIHGPNAGYNAIQPWRHTKLLEAF 502
           GDG+ Q+T+QE ++ IR+ +   + V NNNGYT+ER I+GP   YN I P++ T LL  F
Sbjct: 511 GDGAAQMTIQEFASYIRYKIPMEILVWNNNGYTVERAINGPTRSYNDIAPFKWTALLNVF 570

Query: 503 GANDYEN-----VKITTTGEW-QTLTQDKQFNEPSKIRMIEVMLPVMDAPSNLIA 551
           G  D+EN     V +    E  Q L + K   E + I++ EVMLPVMD P  L A
Sbjct: 571 G--DFENKFNESVTVEKNDELVQLLNKWKSCKERANIKLAEVMLPVMDIPQELNA 623

>TPHA0J02680 Chr10 (593893..595839) [1947 bp, 648 aa] {ON} Anc_5.456
           YDR380W
          Length = 648

 Score =  302 bits (773), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 206/624 (33%), Positives = 308/624 (49%), Gaps = 73/624 (11%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIY-------EVPGMRWAGNANELNAAY 56
           +TL  Y+F RL      ++FG+PGDFNL LL+ +Y       EV  + W G  NELNAAY
Sbjct: 17  ITLAEYIFRRLRSSGTYSLFGVPGDFNLPLLESLYHKTADGKEVELLNWIGCCNELNAAY 76

Query: 57  AADGYAR-VKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISS-QAKQLLLH 114
           AADGY+R    + C++TTFGVGE+SALNGI G+  E+V VL++VG+P      + Q  +H
Sbjct: 77  AADGYSRYTNKIGCLVTTFGVGEISALNGIVGAAVENVKVLNIVGIPPTHILNSSQYNIH 136

Query: 115 HTLGN--------GDFTVFHRMSAN-ISETTAMV--TDIGTAPA-----EIDRCIRTTYV 158
           H++ N         ++  +  M  N I+     +  +DI    +     +ID+ I+  ++
Sbjct: 137 HSIPNLKNSNSGVPNYKTYCDMVLNNITNNVEFLELSDIKNQNSNQVCNKIDQLIKNIFI 196

Query: 159 TQRPVYLGLPANLVDLPVP----THLLETPIDLTLKPN----DQEAXXXXXXXXXXXXXX 210
           + +P YL +P+N+ ++ V     T L +  +D  LK       +                
Sbjct: 197 SSKPGYLFVPSNMTNMMVSSANLTLLPQINLDWALKSTRSNLSETIENDIIEEISQLLYK 256

Query: 211 ASNPVILADACAGRHDVKVETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNE 270
           +  P IL D    R D +++ N+LI       F T +GK  IDE N RF G Y G  S+ 
Sbjct: 257 SKKPCILCDVFIDRFDCRIQVNQLISKLNIWNFSTMLGKSIIDEDNDRFMGTYNGVTSDS 316

Query: 271 NVRNAVESADLILSVGALLSDFNTGSFSYSYKTKN-IVEFHSDYIKIR------NATFPG 323
            V++  ES DLIL +G   ++ NTG +S+SY     I+E   DYIKI       +     
Sbjct: 317 YVKDNFESCDLILHLGIETNEMNTGCYSFSYLPDAVIIEVGKDYIKISKHDGKISKIIND 376

Query: 324 VQMKFVLNKLLAVVGSAVKGYT-------------PVPLPPRLTPNEPCPPDTILRQEWM 370
           + ++ V+ KLL  +  +   Y+              +     L  N        + Q+ +
Sbjct: 377 IMLRDVIQKLLHFIDDSKCTYSFDNNVESFPTYKNKLISKKSLENNVESKAQQTVTQDDL 436

Query: 371 WNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFA-- 428
             E+   F  GD+++ ETG+  F I   +FP  T  I+Q  + SIG    A LG      
Sbjct: 437 QVEIQTLFDKGDVVVVETGSFQFAIPDMIFPKETKLINQGFYLSIGMALPASLGVGIGMR 496

Query: 429 ----------AEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIER 478
                     +E+  P K++ILF GDG+ Q+T+QE+S+L+R+ +   +F+ NNNGYT+ER
Sbjct: 497 DYPNCHINDNSEDATP-KKLILFEGDGAAQMTIQELSSLLRYRIPIDIFIWNNNGYTVER 555

Query: 479 LIHGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTL----TQDKQFNEPSKIR 534
           +  G    YN I PW+   LL+ FG ++    K TT    Q L     + K  N    I 
Sbjct: 556 IFEGEKRSYNDIMPWKWVNLLKVFGDHEKTFSKSTTISTVQELRCKIDELKNANPQKIIE 615

Query: 535 MIEVMLPVMDAPSNL---IAQAKL 555
           +IEV L  MD P NL   + Q KL
Sbjct: 616 LIEVKLGEMDIPKNLKHIVEQMKL 639

>KNAG0C04790 Chr3 complement(932051..933964) [1914 bp, 637 aa] {ON}
           Anc_5.456 YDR380W
          Length = 637

 Score =  298 bits (763), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 204/602 (33%), Positives = 305/602 (50%), Gaps = 66/602 (10%)

Query: 6   LGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEV----PGMRWAGNANELNAAYAADGY 61
           LG+YLF+R+     K+IFG+PGDFNL LL+ +YE      G+RW G  NELNAAYAADG+
Sbjct: 30  LGKYLFQRVLSAGTKSIFGVPGDFNLPLLEHLYERDLVEQGLRWIGTCNELNAAYAADGF 89

Query: 62  ARVKG-MACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           +R    + C+ITT+GVGELSALNG+AG++AE+V +LH+VGV   S++ +   +HH + N 
Sbjct: 90  SRYSNKIGCLITTYGVGELSALNGVAGAFAENVKMLHIVGVAKSSAKHENKNIHHLIPNL 149

Query: 121 DFTVFHR---------MSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANL 171
             + F R         +   +  +   + +I  A  +ID+ IR  Y   +P Y+ +P + 
Sbjct: 150 HDSNFKRPNHKVYYEMVKDRVCCSAEYLENIDQACDQIDKVIRDIYRYSKPGYIFIPVDF 209

Query: 172 V-DLPVPTHLLETP-IDL--TLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDV 227
           V +L   T+LL TP IDL  +L   D+                + NP ++ D    R+D 
Sbjct: 210 VNELVETTNLLVTPVIDLESSLARPDEVTVIEVAQMIADWIYQSGNPGLVGDVLTDRYDA 269

Query: 228 KVETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGA 287
               N  I +T+   F T  GK  IDE NP + G+Y G      V +     DL+L+ G 
Sbjct: 270 TKMLNDFIQLTKMWNFTTVNGKSIIDESNPWYMGLYNGDEGVSTVIDRFHKCDLVLNFGL 329

Query: 288 LLSDFNTGSFSYSYK-TKNIVEFHSDYIKIRNAT------FPGVQMKFVLNKLLAVVGS- 339
            +++ N G +++ YK    IVE H  Y++  +        F G+   FVL +L+  +   
Sbjct: 330 DINEINHGHYTFKYKPNSKIVELHPTYVRFLDTEYGTERLFKGLNFVFVLKELINRINPK 389

Query: 340 --------AVKGYTPVPLPPRLTPNEPCPPDTILRQEWMWNEVSKFFRD----GDIILTE 387
                   +V+ +    +      N+     TI +     N++SK   D    GDI++ E
Sbjct: 390 ECMFSYDLSVRKFCSEEIKTPEDGNDDAEASTITQ-----NKLSKMIPDYLNPGDIVVCE 444

Query: 388 TGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGAVLGA-------------SFAAEEIDP 434
           TG+  F +   + P     +SQ  + SIG    A +G              +F A + + 
Sbjct: 445 TGSFQFAMRDIVLPPQVKYMSQGFFLSIGTALPAAVGVGIALQDYPNQHINNFGAVDHNY 504

Query: 435 SKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLIHGPNAGYNAIQPWR 494
             R+IL  GDG+ Q+TVQE++++IR+ +   + + NNNGYT+ER I GP   YN I PW 
Sbjct: 505 KPRLILLEGDGAAQMTVQELTSMIRFQIPIEIMLWNNNGYTVERAILGPTRSYNDIMPWD 564

Query: 495 HTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSK-------IRMIEVMLPVMDAPS 547
            TKL  AFG  D+E  K T +   +T ++        K       I M+EV L VMD P 
Sbjct: 565 WTKLFAAFG--DFEG-KYTRSTAIETTSKLLLKLNQLKNEGNRDIIEMVEVKLGVMDYPH 621

Query: 548 NL 549
            L
Sbjct: 622 QL 623

>TBLA0A02670 Chr1 complement(648495..650417) [1923 bp, 640 aa] {ON}
           Anc_5.456 YDR380W
          Length = 640

 Score =  297 bits (761), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 203/605 (33%), Positives = 306/605 (50%), Gaps = 59/605 (9%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIY---------EVPGMRWAGNANELNA 54
           +T G Y+F+RL  +  K++FG+PGDFNL LL+ +Y         E   +RW G  NELN+
Sbjct: 23  ITFGHYIFQRLLSLGTKSVFGVPGDFNLPLLEYLYDDFQSPDTKEKTSIRWVGGCNELNS 82

Query: 55  AYAADGYAR-VKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSI----SSQAK 109
           AY+ADGY+R    ++C+ITTFGVGELSA+NG++GS+AE++ VLH+VGVPS     S   K
Sbjct: 83  AYSADGYSRYTNKISCLITTFGVGELSAINGVSGSFAENIKVLHIVGVPSTKITESPVQK 142

Query: 110 QLLLHHTLGNGD--------FTVFHRMSAN-ISETTAMVTDIGTAPAEIDRCIRTTYVTQ 160
              LHH + + D          V+H M  + IS +T +++DI  A   +D+ I   Y   
Sbjct: 143 NWNLHHLVPSMDCPNFNPPNHNVYHDMIKDKISCSTHILSDITKAADMVDQVILDIYKYS 202

Query: 161 RPVYLGLPANLVDLPVPT-HLLETP---IDLTLKPNDQEAXXXXXXXXXXXXX------X 210
           RP YL +P+N  D+ V T +L++ P   +D  L  N  ++                    
Sbjct: 203 RPGYLFVPSNFPDMLVSTKNLIDRPTITMDDALALNSIDSNFSLSHMKDLTRRILKILYK 262

Query: 211 ASNPVILADACAGRHDVKVETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNE 270
           +  P ++ D    R+  K   N+ I+ T+   FVTP+ K TIDE N  + G+Y G  SN 
Sbjct: 263 SETPAVVCDMLVDRYGGKKLINEFINRTKIRNFVTPLSKSTIDETNENYVGLYNGKQSNA 322

Query: 271 NVRNAVESADLILSVGALLSDFNTGSFSYSY-KTKNIVEFHSDYIKI--------RNATF 321
            V    E++DL+L  G   ++ NTG +S+SY     +++ +  Y+++            +
Sbjct: 323 KVIEHFENSDLVLHYGVFSNEVNTGVYSHSYGPNTTLIQLNPTYLRVVEYENGHHSELIY 382

Query: 322 PGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCPPDTILRQEWMWNEVSKFFRDG 381
             V    +L +LL  +  +   +   PL  R+        D  + Q  +       F  G
Sbjct: 383 RDVNFLHILKQLLKDIDLSKLNFKYQPLATRVKQETIENSDGKITQASLGQAFPSTFNPG 442

Query: 382 DIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEI------DPS 435
           DI++ +TG   F I   +F +    I+Q  + SIG      LG   A ++       D S
Sbjct: 443 DILVADTGAFQFSIRDFVFHSQMKYITQGFYLSIGMALPCALGVGVAMQDYPLEHVYDKS 502

Query: 436 K-------RVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLIHGPNAGYN 488
           K       R+IL  GDG+ Q+TVQE+ST+IR  +   +++ NN+GYTIER I GP   YN
Sbjct: 503 KLPKNYTPRLILCEGDGAAQMTVQELSTMIREKISIEIYLWNNDGYTIERAIMGPTRSYN 562

Query: 489 AIQPWRHTKLLEAFGAND---YENVKITTTGEWQTLTQD-KQFNEPSKIRMIEVMLPVMD 544
            I  W  T LL +FG  +     +V I T  +     +D K+ +    I  +EVML  +D
Sbjct: 563 DIAAWNWTTLLNSFGDINGKLTNSVTIETQSDLVAKLKDLKEGDNNKCIEFMEVMLGKVD 622

Query: 545 APSNL 549
            P  L
Sbjct: 623 YPPQL 627

>Kpol_440.4 s440 (9465..11375) [1911 bp, 636 aa] {ON} (9465..11375)
           [1911 nt, 637 aa]
          Length = 636

 Score =  296 bits (757), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 201/606 (33%), Positives = 307/606 (50%), Gaps = 64/606 (10%)

Query: 2   PDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPG---MRWAGNANELNAAYAA 58
           P + LG YL  RL  +  K+ FG+PGDFNL LL+ +Y   G   + W G  NELNA+YAA
Sbjct: 15  PKIPLGEYLVRRLLSIGSKSAFGVPGDFNLPLLEFLYNKDGDEIINWIGCCNELNASYAA 74

Query: 59  DGYAR-VKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGV-PSISSQAKQLL---L 113
           DGY+R    + C+ITT+GVGELSA+NGI GSYAE++ +LH+VGV P+  S+ + L    L
Sbjct: 75  DGYSRYTNKIGCLITTYGVGELSAINGITGSYAENIKILHIVGVAPTFISEDENLKYKNL 134

Query: 114 HH--------TLGNGDFTVFHRMSAN-ISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVY 164
           HH         + + +F ++++M  + IS  +  +TDI T+  +ID  I   +   +P Y
Sbjct: 135 HHLIPDKEFPNINSPNFKIYYQMVKDKISCASEYLTDIETSCDKIDDVIVQIFKHSKPGY 194

Query: 165 LGLPANLVDLPVPT-HLLETP-IDLT--LKPNDQEAXXXXXXXXXXXXXXASNPVILADA 220
           + +P++  +  V + +L+  P I+L+  L     E               + +P I+ D 
Sbjct: 195 IFIPSDFSNKLVSSKNLINVPSINLSDCLNKTPMEKIDNLTNEIIDLIGNSQSPAIIGDV 254

Query: 221 CAGRHDVKVETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESAD 280
              R       N  I MT+F  F T MGK  IDE    + G Y+G      V N +   D
Sbjct: 255 LTDRFGCTKLLNDFIQMTKFWNFSTMMGKSVIDESGQAYMGTYIGLGGLTTVYNKILKCD 314

Query: 281 LILSVGALLSDFNTGSFSYSY-KTKNIVEFHSDYIKIRNAT---------FPGVQMKFVL 330
           + L  G  +++ N+G++S+ + K   I+E + +Y+KI             +P V M  +L
Sbjct: 315 IFLIFGLEMNEMNSGNYSFKFPKGSQIIEINPNYLKITKCHDTENQIVDFYPNVSMTHIL 374

Query: 331 NKLLAVVG---------SAVKGY--TPVPLPPRLTPNEPCPPDTILRQEWMWNEVSKFFR 379
             L+A V           +VK Y  + + LP +    E       + Q  +  E+  F  
Sbjct: 375 EGLIAKVNIHDANTNYDKSVKSYDTSELVLPLQQEDEEK------ITQVHLQRELPNFLN 428

Query: 380 DGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEI------- 432
            GD+++ ETG+  F +    FP+N   ISQ  + SIG    A LG   A ++        
Sbjct: 429 PGDVLVCETGSFQFAVQDFKFPSNLKYISQGFYLSIGMALPAALGVGIAMKDYPKFHLND 488

Query: 433 -----DPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLIHGPNAGY 487
                + + R+IL  GDG+ Q+TVQE++T++R  +   +F+ NNNGYT+ER I GP   Y
Sbjct: 489 HSLARNYTPRLILLEGDGAAQMTVQELTTMLRHKIPMEIFLWNNNGYTVERAIEGPFRSY 548

Query: 488 NAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQD----KQFNEPSKIRMIEVMLPVM 543
           N I PW  TKLL   G  + E  +  T  +   L++     K+  + + I++IEV L   
Sbjct: 549 NDIMPWNWTKLLNVLGDPNNEFNRCVTIDKKSQLSEKFKELKEGKDNNCIQLIEVQLDTH 608

Query: 544 DAPSNL 549
           D P  L
Sbjct: 609 DIPRQL 614

>TDEL0D02450 Chr4 complement(477063..479090) [2028 bp, 675 aa] {ON}
           Anc_5.456 YDR380W
          Length = 675

 Score =  294 bits (753), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 208/608 (34%), Positives = 309/608 (50%), Gaps = 70/608 (11%)

Query: 6   LGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVP-------GMRWAGNANELNAAYAA 58
            G Y+F+RL  V VK+IFG+PGD+N+ LL+ +Y+          + W G  NELNAAYAA
Sbjct: 64  FGLYVFKRLLSVGVKSIFGVPGDYNMRLLEHMYDESLVDTAGDKLEWVGCCNELNAAYAA 123

Query: 59  DGYARVKG-MACIITTFGVGELSALNGIAGSYAEHVGVLHVVG-----VPSISSQAKQLL 112
           DGY+R    + C+ITT+GVGEL A++G+AG++AE V VLH+VG     V  +  + +   
Sbjct: 124 DGYSRYSNEIGCVITTYGVGELGAISGLAGAFAESVKVLHIVGIVDYEVNDLGPEMRSHN 183

Query: 113 LHHTLGN--------GDFTVFHRMSAN-ISETTAMVTDIGTAPAEIDRCIRTTYVTQRPV 163
           LHH L           D+ V+  M  + ++ +   + D+ TA  ++D+ I   Y   +P 
Sbjct: 184 LHHLLPRLNDSNFVGPDYRVYAEMVKDKVACSVEYLDDLETACDKVDKVIEDIYKYSKPG 243

Query: 164 YLGLPANLVDLPVPT-HLLETPIDLTLK------PNDQEAXXXXXXXXXXXXXXASNPVI 216
           YL +P + VD  V T +L+E P  +TL+      P D EA              AS P +
Sbjct: 244 YLFVPRSFVDELVSTKNLIEKPT-ITLRECIEKSPVD-EAKIVTEKILRLLNQSAS-PAV 300

Query: 217 LADACAGRHDVKVETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAV 276
           + D    R+ ++VE N  I+      F T  GK  IDE +P + G Y G  S   V   +
Sbjct: 301 IGDMFTDRYGLRVELNDFINKANIVGFSTVQGKSIIDESSPLYMGAYNGMTSAPTVSEKL 360

Query: 277 ESADLILSVGALLSDFNTGSFSYSYKTK-NIVEFHSDYIKIRNAT------FPGVQMKFV 329
            + DL+L  G   ++ N G++++ +K+   IVE H  YI+  + T      + GV    +
Sbjct: 361 LACDLVLHFGIEKNEVNYGNYNFPHKSDAKIVELHPQYIRFYDNTTKKEEIYKGVSFVDI 420

Query: 330 LN---------KLLAVVGSAVKGYT--PVPLPPRLTPNEPCPPDTILRQEWMWNEVSKFF 378
           L+         +L     S  K YT   + L  R   N+     T   Q  +   +  + 
Sbjct: 421 LDLLNQSPELSELSFQYNSKFKAYTIEELNLDERDFGNDETSDIT---QGTLQKSMPNYL 477

Query: 379 RDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEI------ 432
             GD+++++TGT  F I     P+    I+Q  + SIG    A LG   A  +       
Sbjct: 478 NPGDVLISDTGTFQFAIRDFSLPSQVKYITQGFYLSIGMALPAALGVGIAMRDYPMHHVW 537

Query: 433 DPSK-------RVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLIHGPNA 485
           D  K       +VILF GDG+ Q+TVQE+ST+IR  +   +F+ NNNGYTIER+I GP  
Sbjct: 538 DVEKIPFGYEPKVILFEGDGAAQMTVQELSTMIRHQVPIEIFLWNNNGYTIERVIEGPTR 597

Query: 486 GYNAIQPWRHTKLLEAFGANDYENVKIT---TTGEWQTLTQDKQFNEPSK-IRMIEVMLP 541
            YN IQPW+ TKLLEAFG  D ++ + T   T  + +    + ++ +  + I  +EV L 
Sbjct: 598 PYNDIQPWKWTKLLEAFGDFDGKHSRATVLETRSQLENKLSELKYKDHRRGIDFMEVKLA 657

Query: 542 VMDAPSNL 549
            MD PS L
Sbjct: 658 TMDVPSQL 665

>TPHA0E01600 Chr5 complement(325811..327766) [1956 bp, 651 aa] {ON}
           Anc_5.456 YDR380W
          Length = 651

 Score =  291 bits (744), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 199/593 (33%), Positives = 293/593 (49%), Gaps = 54/593 (9%)

Query: 6   LGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPG------MRWAGNANELNAAYAAD 59
            G+Y+F RL     K++FG+PGD+NL+LL+++Y+         ++W G  NELNAAYAAD
Sbjct: 40  FGKYIFRRLQSCGTKSVFGVPGDYNLNLLEQMYDEEDSITPNEIQWIGCCNELNAAYAAD 99

Query: 60  GYAR-VKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLG 118
           GY+R    + C+ITT+GVGELSA+NGIAG++ E+V +LH+VGV S          HH + 
Sbjct: 100 GYSRYTNKIGCLITTYGVGELSAINGIAGAFTENVKLLHIVGVVSQDKMKSGRNFHHLIP 159

Query: 119 NGD--------FTVFHRMSAN-ISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPA 169
           N +        + +   M  N IS +T  + +I TA  + D  +R  +   +P +L +P 
Sbjct: 160 NKENANLQAPNYQICKDMIDNKISCSTKFLDNIATACDDFDDLLRDIFKNSKPGFLFIPE 219

Query: 170 NLVDLPVPTHLLETPIDLTLK------PNDQEAXXXXXXXXXXXXXXASNPVILADACAG 223
              +L V    L     +TL+      P   ++              +  P I+ D    
Sbjct: 220 EFSNLMVSDANLFLVPKITLEDSIIPSPISYDSIDRLTQITKDLIYQSKRPAIIGDILVD 279

Query: 224 RHDVKVETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLIL 283
           R       N+LI  T    F T MGK  I+E N  + G++ G    + V + +   DLIL
Sbjct: 280 RFGGTTILNELIQNTGIWNFSTIMGKSIINEANENYIGLFSGDDGKQEVNDKIRQCDLIL 339

Query: 284 SVGALLSDFNTGSFS---YSYKTKNIVEFHSDYIKIRNATFPGVQMKFVLN-----KLLA 335
             G   ++ N+G ++   Y  K   I+EFHS+YIKI++ +   V +   LN     K L 
Sbjct: 340 HFGIDTNEVNSGVYTLENYYPKNAKIIEFHSNYIKIKDNSTSRVDLYKNLNFIHVLKRLN 399

Query: 336 VVGSAVKGYTPVPLPPRLTPNEPCPPD----TILRQEWMWNEVSKFFRDGDIILTETGTA 391
            +    K     P   +    E C  D     ++ Q+++ + + K    GDI+L +TGT 
Sbjct: 400 KILDTSKLLFDYPYISKNIQTE-CSDDEKSNKVITQDYIKDAILKLLNPGDILLCDTGTF 458

Query: 392 AFGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEE------------IDPSKRVI 439
            F +     P     ISQ  + SIG    A LG     ++            I    ++I
Sbjct: 459 QFSVRDYQLPPQVKYISQSFYLSIGMALPASLGVGIGMKDYPNIHIKPDDSIIKTQPKLI 518

Query: 440 LFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLIHGPNAGYNAIQPWRHTKLL 499
           L  GDG+ Q+T+QEISTLIR+ +   +F+ NN+GYTIER I GP   YN IQPW  T L+
Sbjct: 519 LCEGDGAAQMTIQEISTLIRYKIPISIFLWNNDGYTIERAIRGPTRDYNDIQPWNWTMLI 578

Query: 500 EAFGANDYENVKITTTGEWQT----LTQDKQ--FNEPSKIRMIEVMLPVMDAP 546
           ++F  N    +K     E Q     LT+ KQ  FNE S +  IEV L  +D P
Sbjct: 579 KSFETNIKSFIKTYKVTEQQEFKNLLTKIKQNNFNEDS-LNFIEVQLGRLDVP 630

>TBLA0A06420 Chr1 complement(1577160..1579076) [1917 bp, 638 aa]
           {ON} Anc_5.456 YDR380W
          Length = 638

 Score =  282 bits (721), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 190/607 (31%), Positives = 306/607 (50%), Gaps = 60/607 (9%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIY----EVPGMRWAGNANELNAAYAAD 59
           L LG YL+ +L Q+  KTIFG+PGDFNLSLL+ +Y    +  G++W G  NELNAAYAAD
Sbjct: 26  LPLGEYLYLKLAQIGTKTIFGVPGDFNLSLLELLYTQKVKDSGLKWVGCCNELNAAYAAD 85

Query: 60  GYARVKG-MACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLG 118
           GY+R    + C++TT+GVGELSALNGIAG++AE++ +LHVVGVP          +HH + 
Sbjct: 86  GYSRYTNRVGCVVTTYGVGELSALNGIAGAFAENIKLLHVVGVPPTKYNTLNHNIHHLVP 145

Query: 119 NGDFT--------VFHRM-SANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPA 169
              ++        V+  M +  +    A +TD+  A  +I+  I+  +    P Y+ +P 
Sbjct: 146 RLKYSNLLAPNKEVYMEMVNEKVCCFYANITDLNQARWQIEIAIKHIFQYNLPAYIFIPT 205

Query: 170 NLVDLPVPT----HL-------LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILA 218
           +  D  +P     HL       +E  +++ L P+ +                +  P I+ 
Sbjct: 206 DFQDALIPISVNEHLSREDIMPIEEIVEIPLLPSLE--MVSVCDYILSLLYSSKTPCIIG 263

Query: 219 DACAGRHDVKVETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVES 278
           D    R  V  + N LI  T+   F T M KG ++E NP + GVY G LS +++   ++ 
Sbjct: 264 DILVERFGVTKQINDLIHKTKLWNFSTFMSKGVLNESNPYYQGVYFGKLSQDHIVKKIQM 323

Query: 279 ADLILSVGALLSDFNTGSFSYSYKTKNI-VEFHSDYIKIRN------ATFPGVQMKFVLN 331
            DLI+  G + ++ NTG +S++YK  ++ ++ H DY++I          + G++ +  ++
Sbjct: 324 CDLIIHFGVVENEINTGYYSFNYKPDSVLIQIHPDYVRITQFQHNIRTDYKGIEFRTFVD 383

Query: 332 KLLAVV--GSAVKGYTPVPLPPR---LTPNEPCPPDTILRQEWMWNEVSKFFRDGDIILT 386
            +   V   S    Y  +  P     L P E    D  +  +++   + ++   GD+++ 
Sbjct: 384 MVTKGVQPNSINTTYNRLFSPSSHAYLFPLEQ-EEDGPISHDYLETIIPRYINPGDVVVC 442

Query: 387 ETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEE---IDPSK------- 436
           ETG+  F +  +   ++   I+Q  + SIG    A LG   A  +   +  SK       
Sbjct: 443 ETGSIQFTMVNTRLSSDVEYITQGFYLSIGMAIPASLGIGMAMRDYPNLHLSKKSSHSNV 502

Query: 437 ------RVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLIHGPNAGYNAI 490
                 R+IL  GDG+ Q+TVQEI+ +I++ +   + +LNN GYTIER I G +  +N I
Sbjct: 503 PPNYKPRLILLEGDGAAQMTVQEITNIIKYKIPIEILLLNNQGYTIERAIKGADKEFNDI 562

Query: 491 QPWRHTKLLEAFGANDYENVK----ITTTGEWQTLTQDKQFNEPSKIRMIEVMLPVMDAP 546
             W   +LL   G N  E        +TT  ++ L Q K +        +EV+L  ++ P
Sbjct: 563 CEWNWPQLLNGLGGNLDETKNKYKFFSTTELYEKLKQLKDYPGKETFSFVEVILNKLNIP 622

Query: 547 SNLIAQA 553
           + LI  A
Sbjct: 623 TTLIKMA 629

>SAKL0D00220g Chr4 complement(18466..20199) [1734 bp, 577 aa] {ON}
           uniprot|Q6XAE8 Saccharomyces kluyveri Pyruvate
           decarboxylase-like protein
          Length = 577

 Score =  271 bits (694), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 185/573 (32%), Positives = 284/573 (49%), Gaps = 33/573 (5%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIY--EVPGMRWAGNANELNAAYAA 58
           M  + LG YLF RL QV  KT+FG+PGDFNL+LL+ +Y  +   ++W GNANELNA YAA
Sbjct: 1   MSTMQLGTYLFYRLSQV-TKTVFGVPGDFNLNLLEHVYNFDESQIKWCGNANELNAGYAA 59

Query: 59  DGYARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLL---HH 115
           DGY+R+    C ITT+GVGELSALN ++G++AE+  VLH+VG  S+ ++     L   HH
Sbjct: 60  DGYSRINKFGCFITTYGVGELSALNAVSGAFAENAPVLHIVGTSSMLAKRGACPLNQIHH 119

Query: 116 ------TLGNGDFTVFHRMSANISETTAMVTD--IGTAPAEIDRCIRTTYVTQRPVYLGL 167
                 T    D  V+ +++   S  T  ++D  +     +ID  I + +   +P YL +
Sbjct: 120 LIPPKKTYEAPDHKVYEKLAEPFSIHTESLSDENLEKIQDQIDSVIESIFCHMKPGYLFI 179

Query: 168 PANLVDLPVPTHL-LETPIDLTLKPN-DQEAXXXXXXXXXXXXXXASNPVILADACAGRH 225
           P+NL D  +P  L  +   D   K   D  A              + NP  + D    R 
Sbjct: 180 PSNLPDAEIPVDLNKQLNFDFITKLRVDPHATSEMVSLTLKRIYSSRNPGFIVDQFM-RF 238

Query: 226 DVKVETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSV 285
           D++ + N  ++   F  + T   +G  DE  P F GV+   LS       ++  D IL +
Sbjct: 239 DLE-KLNLFLEKFNFYCYNTTTARGFADESLPNFHGVFNNELSTNGTLEILDQNDFILHL 297

Query: 286 GALLSDFNTGSF----SYSYKTKNIVEFHSDYIKI--RNATFPGVQMKFVLNKLLAVVGS 339
           G   ++ N  S+    S     K+++    DY ++        G+       +LL  + S
Sbjct: 298 G---TNINEVSYFVGGSTPLDKKDVIFIGKDYAQVGTNGHIITGINCHVFFEELLQRMNS 354

Query: 340 AVKGYTPVPLPPRLTPNEPCPPD--TILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQ 397
                        L  N     D    + Q  +   VS   R+ D+I+ E  +  F +  
Sbjct: 355 KTMPKVKTRKSTALYNNGYTVDDDSKTVTQANLSQVVSAQLRENDVIINEMCSFMFEMPN 414

Query: 398 SLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTL 457
             +      + Q  +GSIG+   A LGAS A ++   S RVILF GDGS Q+T+QE+++ 
Sbjct: 415 IKYSKGCQFVGQPFYGSIGYALPATLGASLAIKDYKKSGRVILFQGDGSAQMTLQELASY 474

Query: 458 IRWDLKPYLFVLNNNGYTIERLIHGPNAGYN-AIQPWRHTKLLEAFGANDYE---NVKIT 513
           IR+++ P +F+LNN+GY++ER+I GP   YN  I  W    +L  FG  + +   + K+ 
Sbjct: 475 IRFEIDPIIFMLNNSGYSVERVIKGPTRSYNDIIVDWDWCNILSVFGDRNGDRSTSYKVE 534

Query: 514 TTGEWQTLTQDKQFNEPSKIRMIEVMLPVMDAP 546
             GE + +   +      KI+M+E++L  MD P
Sbjct: 535 KLGELKNVLTKRLDYSDGKIKMVEIILDRMDVP 567

>KLTH0D00418g Chr4 complement(37778..39463) [1686 bp, 561 aa] {ON}
           similar to uniprot|P16467 Saccharomyces cerevisiae
           YLR134W PDC5 Minor isoform of pyruvate decarboxylase
          Length = 561

 Score =  251 bits (642), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 169/568 (29%), Positives = 267/568 (47%), Gaps = 25/568 (4%)

Query: 5   TLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARV 64
           T+G YL  RL Q  +K  F +PGD+NL LLDK+ E P +      NELN ++AA+GYAR 
Sbjct: 3   TVGNYLATRLVQAGIKNHFTVPGDYNLVLLDKLQEHPELEEVNCCNELNCSFAAEGYART 62

Query: 65  KGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTV 124
           KG+A ++ TF VG  SA NGI  +Y E++ V+ + G P+ +  +   LLHHT+G  ++  
Sbjct: 63  KGIAAVVVTFSVGAFSAFNGIGSAYGENLPVILISGSPNTNDSSDHRLLHHTIGTHNYDY 122

Query: 125 FHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDL----PVPTHL 180
            + M+  I+     +     AP+ ID  IR     ++P Y+ +P N+       P P   
Sbjct: 123 QYEMAKQITCAAVQIKYPEDAPSLIDYAIRECLAKKKPCYIEVPTNMASAICAPPGPISS 182

Query: 181 LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQF 240
           L   +     P  ++                  P +LA       D +    +L +  + 
Sbjct: 183 LVNSV-----PTPKDVLSQAVNASVDFINSHLKPTLLAGPKLKCADAQKAFLRLAEALKC 237

Query: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300
              V P  K    E +P+F GVY G +S +     +E +DL +  G + +D++T  ++  
Sbjct: 238 AVAVQPAAKSMFPEDHPQFAGVYWGQVSTKKADAILEWSDLTICAGCIFTDYSTTGWTAL 297

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKG---YTPVPLPPRLTPNE 357
             + + +E  +D ++    +F  + +   LN L   V    K    Y  +   P L    
Sbjct: 298 QPSSHRLEADADNVRFPGHSFDQIGLANFLNVLAERVSENDKSLIEYNRLRQSPPLIKAA 357

Query: 358 PCPPDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGF 417
             P   I R+E M  ++ +       +  ETG + F   Q   P   +   ++ WG IG+
Sbjct: 358 D-PKAAITRKE-MARQIQQLITPKTTLFAETGDSWFNGVQMDLPKGALFEVEMQWGHIGW 415

Query: 418 TGGAVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIE 477
           +  A LG +  A    P +R+I  +GDGS Q+T QE+S ++R      +F++NN GYTIE
Sbjct: 416 SVPASLGYAVGA----PDRRIITMVGDGSFQMTAQEVSLMVRLRKPIIIFLINNYGYTIE 471

Query: 478 RLIH-GPNAGYNAIQPWRHTKLLEAFGAND--YENVKITTTGEWQTLTQDKQFNEPSKIR 534
             IH GP   YN I+ W +  L+E F AN+   +  K  T GE     +  Q N  S   
Sbjct: 472 VEIHDGP---YNNIKNWNYAALMEVFNANEGSGKGFKARTGGELADAIEKAQANV-SGPT 527

Query: 535 MIEVMLPVMDAPSNLIAQAKLTACINSK 562
           +IE+ +   D  + LI      A  N++
Sbjct: 528 LIEIQINRDDCTNELITWGHFVALANAR 555

>TDEL0C07020 Chr3 complement(1283600..1285282) [1683 bp, 560 aa]
           {ON} 
          Length = 560

 Score =  250 bits (639), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 166/567 (29%), Positives = 270/567 (47%), Gaps = 23/567 (4%)

Query: 5   TLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARV 64
           T+G YL  RL +V ++  F +PGD+NL+LLDK+   P +     +NELN ++AA+GYAR 
Sbjct: 4   TVGSYLATRLSEVGIENHFVVPGDYNLALLDKLQAHPKLEEVNCSNELNCSFAAEGYARS 63

Query: 65  KGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTV 124
           KG+A ++ TF VG  SA NGI  +Y E++ V+ + G P+ +      LLHHT+G  +F  
Sbjct: 64  KGVAAVVVTFSVGAFSAFNGIGSAYGENLPVILIAGSPNTNDSIDHNLLHHTIGTHNFDY 123

Query: 125 FHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHLLETP 184
              M+  I+     +     AP+ ID  IR     ++P Y+ +P N   +   +  L  P
Sbjct: 124 EFEMAKKITCAAVQIKHAKDAPSLIDFAIRECLAKKKPCYIEVPTN---MSTQSCALPGP 180

Query: 185 ID--LTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQFPA 242
           I+  L   P++ +                  P +LA         +    +L +      
Sbjct: 181 IEGVLYQSPSEPKTLTAAVDAANKLIGSRLKPTLLAGPKLKSAGAEKAFLRLAEALGCAV 240

Query: 243 FVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYSYK 302
            V P  K    E +P++ GVY G +S +     ++ +DL +  G + +D++T  ++    
Sbjct: 241 AVLPAAKSLFPEDHPQYAGVYWGNVSTKKADAILQWSDLTICAGCVFTDYSTTGWTSLQP 300

Query: 303 TKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVG----SAVKGYTPVPLPPRLTPNEP 358
             + +E  SD +K  +  +  +++   L+ L   V     S V+     P+PP +   EP
Sbjct: 301 ATHRIEVDSDNVKFPDHYYGHIKLADFLDALAKKVSKNDKSVVEYQRLRPVPPAIKAAEP 360

Query: 359 CPPDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFT 418
                I RQE M  ++         +  ETG + F   Q   P       ++ WG IG++
Sbjct: 361 SA--AITRQE-MARQIQGIINSKTTLFAETGDSWFNGVQMDLPKGAKFEVEMQWGHIGWS 417

Query: 419 GGAVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIER 478
             A  G S  A    P + ++  +GDGS Q+TVQE++ +IR      +F++NN GYTIE 
Sbjct: 418 VPACFGYSVGA----PDREIVTMVGDGSFQMTVQEVAQMIRLKQPILIFLINNYGYTIEV 473

Query: 479 LIH-GPNAGYNAIQPWRHTKLLEAFGAND--YENVKITTTGEWQTLTQDKQFNEPSKIRM 535
            IH GP   YN I+ W +  L+EAF AND   +  ++ T  E     +  + N      +
Sbjct: 474 EIHDGP---YNNIKNWNYAALMEAFNANDGHGKGFQVKTGAELSEAIKKAKSNTRGPT-L 529

Query: 536 IEVMLPVMDAPSNLIAQAKLTACINSK 562
           IE+ +   D  + LI+     A  N++
Sbjct: 530 IEIQINRDDCTNELISWGHYVALANAR 556

>TDEL0F00150 Chr6 (12055..13737) [1683 bp, 560 aa] {ON} 
          Length = 560

 Score =  249 bits (637), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 166/567 (29%), Positives = 270/567 (47%), Gaps = 23/567 (4%)

Query: 5   TLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARV 64
           T+G YL  RL +V ++  F +PGD+NL+LLDK+   P +     +NELN ++AA+GYAR 
Sbjct: 4   TVGSYLATRLSEVGIENHFVVPGDYNLALLDKLQAHPKLEEVNCSNELNCSFAAEGYARS 63

Query: 65  KGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTV 124
           KG+A ++ TF VG  SA NGI  +Y E++ V+ + G P+ +      LLHHT+G  +F  
Sbjct: 64  KGVAAVVVTFSVGAFSAFNGIGSAYGENLPVILIAGSPNTNDSIDHNLLHHTIGTHNFDY 123

Query: 125 FHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHLLETP 184
              M+  I+     +     AP+ ID  IR     ++P Y+ +P N   +   +  L  P
Sbjct: 124 EFEMAKKITCAAVQIKHAKDAPSLIDFAIRECLAKKKPCYIEVPTN---MSTQSCALPGP 180

Query: 185 ID--LTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQFPA 242
           I+  L   P++ +                  P +LA         +    +L +      
Sbjct: 181 IEGVLYQSPSEPKTLTAAVDAANKLIGSRLKPTLLAGPKLKSAGAEKAFLRLAEALGCAV 240

Query: 243 FVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYSYK 302
            V P  K    E +P++ GVY G +S +     ++ +DL +  G + +D++T  ++    
Sbjct: 241 AVLPAAKSLFPEDHPQYAGVYWGNVSTKKADAILQWSDLTICAGCVFTDYSTTGWTSLQP 300

Query: 303 TKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVG----SAVKGYTPVPLPPRLTPNEP 358
             + +E  SD +K  +  +  +++   L+ L   V     S V+     P+PP +   EP
Sbjct: 301 ATHRIEVDSDNVKFPDHYYGHIKLADFLDALAKKVSKNDKSVVEYQRLRPVPPAIKAAEP 360

Query: 359 CPPDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFT 418
                I RQE M  ++         +  ETG + F   Q   P       ++ WG IG++
Sbjct: 361 SA--AITRQE-MARQIQGIINSKTTLFAETGDSWFNGVQMDLPKGAKFEVEMQWGHIGWS 417

Query: 419 GGAVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIER 478
             A  G S  A    P + ++  +GDGS Q+TVQE++ +IR      +F++NN GYTIE 
Sbjct: 418 VPACFGYSVGA----PDREIVTMVGDGSFQMTVQEVAQMIRLKQPILIFLINNYGYTIEV 473

Query: 479 LIH-GPNAGYNAIQPWRHTKLLEAFGAND--YENVKITTTGEWQTLTQDKQFNEPSKIRM 535
            IH GP   YN I+ W +  L+EAF AND   +  ++ T  E     +  + N      +
Sbjct: 474 EIHDGP---YNNIKNWNYAALMEAFNANDGHGKGFQVKTGAELAEAIKKAKSNTRGPT-L 529

Query: 536 IEVMLPVMDAPSNLIAQAKLTACINSK 562
           IE+ +   D  + LI+     A  N++
Sbjct: 530 IEIQINRDDCTNELISWGHYVALANAR 556

>NDAI0A04450 Chr1 complement(1006559..1008244) [1686 bp, 561 aa]
           {ON} Anc_5.456
          Length = 561

 Score =  241 bits (615), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 176/560 (31%), Positives = 276/560 (49%), Gaps = 59/560 (10%)

Query: 58  ADGYARVKG-MACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP-SISSQAKQLL--- 112
           ADG++R    + C+ITT+GVGELSALNGIAG+++E+V VLH+VGV  S+ S+++      
Sbjct: 3   ADGFSRYSNKIGCLITTYGVGELSALNGIAGAFSENVKVLHIVGVARSVHSRSQDYNNQN 62

Query: 113 LHH---TLGNGDFT-----VFHRMSAN-ISETTAMVTDIGTAPAEIDRCIRTTYVTQRPV 163
           LHH    L + +F      V+  M  + ++ +   + DI TA  E+D+ I   Y   +P 
Sbjct: 63  LHHLVPRLHDSNFVGPNHKVYLEMIKDRVACSVTYLEDINTACDEVDKVIMDIYRYSKPG 122

Query: 164 YLGLPANLVDLPV-PTHLLETPIDLTLKPNDQEA----XXXXXXXXXXXXXXASNPVILA 218
           Y+ +P +  D+ V P++L + P ++TL+     A                  +  P I+ 
Sbjct: 123 YVFVPVDFSDMLVDPSNLFKRP-EITLENCVSYAPSPVVDELVRMVLQYIYESKCPSIIG 181

Query: 219 DACAGRHDVKVETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVES 278
           D    R       N LI +T    F T MGK  IDE N  + G+Y G  S E V      
Sbjct: 182 DVLCDRFGASSMVNNLIQLTSMWNFATVMGKSIIDESNVMYMGLYNGNESIETVTERFLQ 241

Query: 279 ADLILSVGALLSDFNTGSFSYSYKTK-NIVEFHSDYIKIRNAT------FPGVQMKFVLN 331
           +DL+L  G  + + N G ++ +YK    ++EFHS+YI+  +A+      F GV    VL 
Sbjct: 242 SDLVLHFGIQVHEINNGHYTINYKEDAKVIEFHSEYIRFFDASTGNEKVFKGVNFVQVLE 301

Query: 332 KLLAVVGSAVKGYTPVPLPPRLTPNE---PCPPDTILR--QEWMWNEVSKFFRDGDIILT 386
           +L+  +      +       +   +E   P  P  I +  Q ++   V  +   GD+++ 
Sbjct: 302 RLIQTINVNKLNFEYPSNIEKFATDEVNLPTEPTEITKVTQNYLQKSVPHYLNPGDVLVC 361

Query: 387 ETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEI-------------- 432
           ETG+  F I   + P+    I+Q  + SIG    A  G   A ++               
Sbjct: 362 ETGSFQFAIRDFVLPSQLKYITQGFFLSIGMALPAAFGVGIAMQDYPRCHISKDHPSHVE 421

Query: 433 ---DPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLIHGPNAGYNA 489
              D   R+IL  GDG+ Q+T+QE+++++R+ +   + +LNNNGYTIER I GP   YN 
Sbjct: 422 IPDDYEPRLILIEGDGAAQMTIQELTSMVRFQVPIEIMILNNNGYTIERAIRGPTRSYND 481

Query: 490 IQPWRHTKLLEAFGANDYE-----NVKITTTGEW-QTLTQDKQFNEPSKIRMIEVMLPVM 543
           +  W  TKLLEAFG  D++     + KI T  +    L Q K   + + I ++E+ L  M
Sbjct: 482 VMSWDWTKLLEAFG--DFKKQRTVSAKIETRSKLAMKLKQLKNKGKLNLIELVEIKLDTM 539

Query: 544 DAPSNLIAQAKLTACINSKK 563
           D P  L  Q+ + A   ++K
Sbjct: 540 DFPKQL--QSMVDAAAFTRK 557

>Skud_7.383 Chr7
           complement(638760..638846,638850..638882,638886..638903,
           638917..639036) [258 bp, 86 aa] {ON} YGR087C (REAL)
          Length = 86

 Score = 83.2 bits (204), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 57/92 (61%), Gaps = 6/92 (6%)

Query: 386 TETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEIDPSKRVILFIGDG 445
           TETG +    NQ++   +   ISQVLW  I F  GA L    +AE+IDP  R ILF GD 
Sbjct: 1   TETGASTLASNQAILLKDAHDISQVLWRPIRFANGATL----SAEDIDPG-RAILFSGDR 55

Query: 446 SLQLTVQEISTLIRWDLKPYLFVLNNNGYTIE 477
            L LTVQE+ T IRW LKPYLFV NN+   +E
Sbjct: 56  PL-LTVQEMPTTIRWRLKPYLFVPNNDKRHVE 86

>YMR108W Chr13 (484084..486147) [2064 bp, 687 aa] {ON}
           ILV2Acetolactate synthase, catalyses the first common
           step in isoleucine and valine biosynthesis and is the
           target of several classes of inhibitors, localizes to
           the mitochondria; expression of the gene is under
           general amino acid control
          Length = 687

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 115/508 (22%), Positives = 195/508 (38%), Gaps = 62/508 (12%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           LT G+   E + + +V T+FG PG   L + D I+      +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 64  VKGM-ACIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMVTDIGTAPAEIDRCIR-TTYVTQRPVYLGLP----ANLVDLPV 176
                 +S + ++   MV  +   P  I+      T     PV + LP    A ++  P+
Sbjct: 209 ------ISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPKDVTAAILRNPI 262

Query: 177 PTH--LLETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRH-DVKVETNK 233
           PT   L    ++        E               A  PV+   A    H D      +
Sbjct: 263 PTKTTLPSNALNQLTSRAQDEFVMQSINKAADLINLAKKPVLYVGAGILNHADGPRLLKE 322

Query: 234 LIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFN 293
           L D  Q P   T  G G+ D+ +P+   + +G         AV++ADLI++VGA   D  
Sbjct: 323 LSDRAQIPVTTTLQGLGSFDQEDPKSLDM-LGMHGCATANLAVQNADLIIAVGARFDDRV 381

Query: 294 TGSFS-------------------YSYKTKNIVEFHSDYIKIRN--ATFPGVQMKFVL-- 330
           TG+ S                   +    KNI +     I +     T  G  M  +   
Sbjct: 382 TGNISKFAPEARRAAAEGRGGIIHFEVSPKNINKVVQTQIAVEGDATTNLGKMMSKIFPV 441

Query: 331 ---NKLLAVVGSAVKGYTPVPLPPRLTPNEPCPPDTILRQEWMWNEVSKFFRD-GDIILT 386
              ++  A +    K Y    +    TP     P T++++      +SK   D G  ++ 
Sbjct: 442 KERSEWFAQINKWKKEYPYAYM--EETPGSKIKPQTVIKK------LSKVANDTGRHVIV 493

Query: 387 ETGTAA---FGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEIDPSKRVILFIG 443
            TG      +      + N    I+    G++G+   A +GA  A     P   VI   G
Sbjct: 494 TTGVGQHQMWAAQHWTWRNPHTFITSGGLGTMGYGLPAAIGAQVA----KPESLVIDIDG 549

Query: 444 DGSLQLTVQEISTLIRWDLKPYLFVLNN 471
           D S  +T+ E+S+ ++      + +LNN
Sbjct: 550 DASFNMTLTELSSAVQAGTPVKILILNN 577

>Smik_13.297 Chr13 (467578..469641) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 112/510 (21%), Positives = 196/510 (38%), Gaps = 66/510 (12%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           LT G+   E + + +V T+FG PG   L + D I+      +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 64  VKGM-ACIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTTAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMVTDIGTAPAEIDRCIR-TTYVTQRPVYLGLP----ANLVDLPV 176
                 +S + ++   MV  +   P  I+      T     PV + LP    A ++  P+
Sbjct: 209 ------ISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPKDVTAAILRNPI 262

Query: 177 PTH--LLETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRH-DVKVETNK 233
           PT   L    ++        E               A  PV+   A    H D      +
Sbjct: 263 PTKTTLPSNALNQLTSHTQDEFVMQSINKAADLINLAKKPVLYVGAGILNHIDGPRLLKE 322

Query: 234 LIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFN 293
           L    Q P   T  G G+ D+ +P+   + +G         A+++ADLI++VGA   D  
Sbjct: 323 LSGRAQIPVTTTLQGLGSFDQEDPKSLDM-LGMHGCATANLAIQNADLIIAVGARFDDRV 381

Query: 294 TGSFS-------------------YSYKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLL 334
           TG+ S                   +    KNI +     I +       ++   +++K+ 
Sbjct: 382 TGNISKFAPEARRAAAEGRGGIIHFEVSPKNINKVVQTQIAVEGDATTNIEK--MMSKIF 439

Query: 335 AV---------VGSAVKGYTPVPLPPRLTPNEPCPPDTILRQEWMWNEVSKFFRD-GDII 384
            V         +    K Y    +  + TP     P T++++      +SK   D G  +
Sbjct: 440 PVKERSEWFDQINKWKKKYPYAFM--KETPGSKIKPQTVIKK------LSKIANDTGRHV 491

Query: 385 LTETGTAA---FGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEIDPSKRVILF 441
           +  TG      +      + N    I+    G++G+   A +GA  A     P   VI  
Sbjct: 492 IVTTGVGQHQMWAAQHWTWKNPRTFITSGGLGTMGYGLPAAIGAQVA----KPESLVIDI 547

Query: 442 IGDGSLQLTVQEISTLIRWDLKPYLFVLNN 471
            GD S  +T+ E+S+ ++      + VLNN
Sbjct: 548 DGDASFNMTLTELSSAVQAGTPVKILVLNN 577

>Kwal_26.7582 s26 (427437..429476) [2040 bp, 679 aa] {ON} YMR108W
           (ILV2) - acetolactate synthase [contig 54] FULL
          Length = 679

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 126/528 (23%), Positives = 203/528 (38%), Gaps = 100/528 (18%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           L+ G+   E + +  V T+FG PG   L++ D IY      +    +E  A + A+GYAR
Sbjct: 84  LSGGQIFHEMMRRHKVDTVFGYPGGAILAVYDAIYNSKYFNFVLPKHEQGAGHMAEGYAR 143

Query: 64  VKGM-ACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +A + A+ V ++   G  + SS          +G   F
Sbjct: 144 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVATSS----------IGTDAF 193

Query: 123 TVFH--RMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLP--VPT 178
                  +S + ++   MV  +   P  I+       V+ RP  +     LVDLP  V +
Sbjct: 194 QEADVIGISRSCTKWNVMVKTVEELPRRINEAFEIA-VSGRPGPV-----LVDLPKDVTS 247

Query: 179 HLLETPIDLT-----------LKPNDQEAXXXXXXXXXXXXXXASNPVI-LADACAGRHD 226
            +L+TPI +             K   QE               A  P++ +     GR D
Sbjct: 248 AILKTPIPVNSTLPFDALSKLTKATAQEFTKANIQKVADLINIAKKPLLYVGGGIFGRED 307

Query: 227 VKVETNKLIDMTQFPAFVTPMGKGTIDERNPR---FGGVYVGTLSNENVRNAVESADLIL 283
                 +L D  Q P   T  G G  D+ +P+     G++    +N +V+N    ADLI+
Sbjct: 308 GPKLLRQLADRAQIPVTTTIQGLGAFDQEDPKSLDMLGMHGSAFANLSVQN----ADLII 363

Query: 284 SVGALLSD---FNTGSFSYSYKTK------NIVEFHSDYIKIRNATFPGVQMKFVLNKLL 334
           ++GA   D    N   F+   +         IV F    I  +N       +  V+   +
Sbjct: 364 ALGARFDDRVTLNVSKFAPEARQAALENRGGIVHFE---ISPKN-------INKVVEAQV 413

Query: 335 AVVGSAVKGYTPVPLPPRLTPNEPCPPDTILRQEWM-----WNEV--SKFFRD--GDIIL 385
           AV G          L P +   E        R+EW+     W +     + R+  G +I 
Sbjct: 414 AVEGDVTDNLE--LLLPMVNKVEE-------RKEWLGQIDAWKKEYPYDYQRETKGSLIK 464

Query: 386 TETGTA-----AFGINQSLFPNNTIGISQVLW----------------GSIGFTGGAVLG 424
            +T  A     A G  + +     +G  Q +W                G +G T G  L 
Sbjct: 465 PQTVIARLSEIASGTGREVIVTTGVGQHQ-MWAAQHWTWRHPRSFITSGGLG-TMGYGLP 522

Query: 425 ASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNN 472
           A+  A+   P   VI   GD S  +T+ E+S+ ++      + VLNN 
Sbjct: 523 AAIGAQVAKPDALVIDIDGDASFNMTLMELSSAVQAGAPVKILVLNNE 570

>NCAS0A04320 Chr1 complement(873722..875791) [2070 bp, 689 aa] {ON}
           Anc_2.441 YMR108W
          Length = 689

 Score = 70.1 bits (170), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 112/512 (21%), Positives = 194/512 (37%), Gaps = 70/512 (13%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           LT G+   E + + +V TIFG PG   L + D I++    ++    NE  A + A+GYAR
Sbjct: 94  LTGGQIFHEMILRNNVDTIFGYPGGAILPVYDAIHDSKSFQFILPKNEQGAGHMAEGYAR 153

Query: 64  VKGM-ACIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G    + +  +A + A+ V ++   G VP+ +           LG   
Sbjct: 154 ASGKPGVVLVTSGPAATNVITPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVLG--- 210

Query: 122 FTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTY---VTQR--PVYLGLPANLV---- 172
                 +S + ++   MV  +   P    RCI   +   ++ R  PV + LP ++     
Sbjct: 211 ------ISRSCTKWNVMVRTVDDMP----RCINEAFEIAMSGRPGPVLVDLPKDVTAAIL 260

Query: 173 --DLPVPTHLLETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADA-CAGRHDVKV 229
              +PV + L  + +    K    E               A  PV+   A      D   
Sbjct: 261 RNPIPVKSTLPSSALSQITKLAHDEFTMENIERAAALINIAKKPVLYVGAGILNNVDGPR 320

Query: 230 ETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALL 289
              +L D  Q P   T  G G  D+ +P+   + +G         AV++ADL++++G   
Sbjct: 321 IIKELSDRAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNADLVIALGTRF 379

Query: 290 SDFNTGSFS-------------------YSYKTKNIVEFHSDYIKIRNATFPGVQMKFV- 329
            D  TG+ +                   +    KNI +     + +       V+     
Sbjct: 380 DDRVTGNITKFAPEARRAAMEGRGGIIHFEISPKNISKVVETQVAVEGDATANVEKMLTK 439

Query: 330 ------LNKLLAVVGSAVKGYTPVPLPPRLTPNEPCPPDTILRQEWMWNEVSKFFRD-GD 382
                  N+   ++    K Y    +  R TP     P T++       ++SK   D G 
Sbjct: 440 IFPVRERNEWFGMINKWKKQYPYDYM--RETPTSKIKPQTVI------TKLSKLANDSGR 491

Query: 383 IILTETGTAAFGI---NQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEIDPSKRVI 439
            ++  TG     +       + N    IS    G++G+   A +GA  A     P   VI
Sbjct: 492 PVIVTTGVGQHQMWTAQHWTWKNPRSFISSGGLGTMGYGLPAAIGAQVA----KPEALVI 547

Query: 440 LFIGDGSLQLTVQEISTLIRWDLKPYLFVLNN 471
              GD S  +++ E+S+ ++      + +LNN
Sbjct: 548 DIDGDASFNMSLTELSSAVQAGTPVKVLILNN 579

>KAFR0A00570 Chr1 complement(101898..103946) [2049 bp, 682 aa] {ON}
           Anc_2.441 YMR108W
          Length = 682

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 112/509 (22%), Positives = 202/509 (39%), Gaps = 64/509 (12%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           LT G+   E + + +V T+FG PG   L + D IY+    ++    +E  A + A+GYAR
Sbjct: 87  LTGGQIFNEMMARHNVDTVFGYPGGAILPVYDAIYQSKNFKFVLPKHEQGAGHMAEGYAR 146

Query: 64  VKGMACII-TTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G   I+  T G G  + +  +A + A+ + ++   G VP+ +           +G   
Sbjct: 147 ASGKPGIVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTTAIGTDAFQEADVVG--- 203

Query: 122 FTVFHRMSANISETTAMVTDIGTAPAEIDRCIR-TTYVTQRPVYLGLPANLV------DL 174
                 +S + ++   M+ ++   P  I+      T     PV + LP ++        +
Sbjct: 204 ------ISRSCTKWNVMIKNVAELPVRINEAFEIATSGRPGPVLVDLPKDVTAAILRDAI 257

Query: 175 PVPTHLLETPI-DLTLKPNDQEAXXXXXXXXXXXXXXASNPVI-LADACAGRHDVKVETN 232
           PV + L    +  LT K  D E               A NPV+ +     G  D      
Sbjct: 258 PVGSSLPSNALSQLTNKAQD-EFVLDNINKAADLINLAKNPVLYVGGGILGNEDGPKLLK 316

Query: 233 KLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDF 292
           +L +  Q P   + +G G  D+ +P+   + +G         A+++ADLI+++G    D 
Sbjct: 317 QLSERAQIPVTTSLLGLGAFDQEDPKSLDM-LGMHGCATANLAMQNADLIIAIGTRFDDR 375

Query: 293 NTGSFS-------------------YSYKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKL 333
            TG+ +                   +    KNI +     I +       +Q   +L K+
Sbjct: 376 VTGNIAKFAPEARRAALENRGGIIHFEISPKNINKVVEAQIAVEGDATANLQS--ILPKI 433

Query: 334 LAVVG-----SAVKGY-TPVPLP-PRLTPNEPCPPDTILRQEWMWNEVSKFFR-DGDIIL 385
             V       + +K + T  P    + TPN    P T++      +++SK     G  ++
Sbjct: 434 FPVKERTEWFAKIKEWKTKYPYSYMKETPNSKLKPQTVI------SKLSKIANATGKEVI 487

Query: 386 TETGTAA---FGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEIDPSKRVILFI 442
             TG      +      + +    I+    G++G+   A +GA  A     P   VI   
Sbjct: 488 VTTGVGQHQMWAAQHWTWKHPRTFITSGGLGTMGYGLPAAIGAQVA----KPDALVIDID 543

Query: 443 GDGSLQLTVQEISTLIRWDLKPYLFVLNN 471
           GD S  +T+ E+S+ ++      + +LNN
Sbjct: 544 GDASFNMTLTELSSAVQAGAPVKILLLNN 572

>CAGL0K03465g Chr11 (320030..322063) [2034 bp, 677 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108w Acetolactate synthase
          Length = 677

 Score = 66.6 bits (161), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 117/518 (22%), Positives = 205/518 (39%), Gaps = 82/518 (15%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           LT G+   E + + +V T+FG PG   L + D I+     ++    +E  A + A+GYAR
Sbjct: 82  LTGGQIFNEMMARNNVDTVFGYPGGAILPVYDAIHNSDKFKFVLPKHEQGAGHMAEGYAR 141

Query: 64  VKGM-ACIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ + ++   G VP+ +           +G   
Sbjct: 142 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTTAIGTDAFQEADIVG--- 198

Query: 122 FTVFHRMSANISETTAMVTDIGTAPAEIDRCIR-TTYVTQRPVYLGLPANL------VDL 174
                 +S + ++   MV ++   P  I+   +  T     PV + LP ++        +
Sbjct: 199 ------ISRSCTKWNVMVKNVAELPLRINEAFQIATSGRPGPVLVDLPKDVTAAILRTPI 252

Query: 175 PVPTHLLETPI-DLTLKPNDQEAXXXXXXXXXXXXXXASNPVI-LADACAGRHDVKVETN 232
           PV + L  T +  LT    DQ                A NPV+ +        D      
Sbjct: 253 PVKSTLPSTALQQLTAGVQDQ-FVIENIKKSADLINIAKNPVLYVGGGILNNVDGPRLVK 311

Query: 233 KLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDF 292
           +L +  Q P   T  G G  D+ +P+   + +G         AV+++DLI++VGA   D 
Sbjct: 312 ELSERAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNSDLIIAVGARFDDR 370

Query: 293 NTGSFSYSYKTKNIVEFHSDYIKIRNATFPGV--------QMKFVLNKLLAVVGSAVKGY 344
            TG         NI +F  +  K       G+         +  V+   +AV G A    
Sbjct: 371 VTG---------NITKFAPEARKAALEGRGGIIHFEITPKNINKVVEAQVAVEGDAASNL 421

Query: 345 TPVPLPPRLTPNEPCPPDTILRQEWMWNEVSKFFRD----------GDIILTETGTA--- 391
           +   L P + P +  P       EW + +++K+ ++          G  I  +T  A   
Sbjct: 422 S--KLIPLVFPVKERP-------EW-FEKINKWKKEFPYSYSLETPGSRIKPQTAIAKLS 471

Query: 392 --AFGINQSLFPNNTIGISQVLW----------------GSIGFTGGAVLGASFAAEEID 433
             A   ++ +     +G  Q +W                G +G T G  L ++  A+   
Sbjct: 472 KIANATSKEVIVTTGVGQHQ-MWAAQHWTWKNPRTFITSGGLG-TMGYGLPSAIGAQVAK 529

Query: 434 PSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNN 471
           P   VI   GD S  +++QE+S+ ++ +    + VLNN
Sbjct: 530 PDALVIDIDGDASFNMSLQELSSAVQANAPVKILVLNN 567

>SAKL0E03740g Chr5 (302160..304199) [2040 bp, 679 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 679

 Score = 66.6 bits (161), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 116/514 (22%), Positives = 197/514 (38%), Gaps = 74/514 (14%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           LT G+   E + +  V T+FG PG   L + D IY      +    +E  A + A+GYAR
Sbjct: 84  LTGGQIFHEMMQRHKVDTVFGYPGGAILPVYDAIYNSNAFNFVLPKHEQGAGHMAEGYAR 143

Query: 64  VKGM-ACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +A + A+  GV  VV    +S+ A        +G   F
Sbjct: 144 ASGKPGVVLVTSGPGATNVVTPMADALAD--GVPMVVFTGQVSTTA--------IGTDAF 193

Query: 123 TVFH--RMSANISETTAMVTDIGTAPAEIDRCIR-TTYVTQRPVYLGLP----ANLVDLP 175
                  +S + ++   MV  I   P  I+      T     PV + LP    A ++  P
Sbjct: 194 QEADVVGISRSCTKWNVMVKSIEELPRRINEAFEIATSGRPGPVLVDLPKDVTAAVLRNP 253

Query: 176 VPTHLLETPIDLTLKPNDQ---EAXXXXXXXXXXXXXXASNPVI-LADACAGRHDVKVET 231
           +PT     P D  L+   +   E               A  P++ +     G  +     
Sbjct: 254 IPTKST-LPSDALLQITKRAVDEFTMNSIAKASDLINVAKKPLLYVGGGILGHENGPKFL 312

Query: 232 NKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSD 291
            +L +  Q P   T  G G  D+ +P+   + +G   +     AV++ADLI+++GA   D
Sbjct: 313 KELSERAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGSAAANTAVQNADLIIALGARFDD 371

Query: 292 FNTGSFS-YSYKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLP 350
             T + S ++ + +     H   I +     P   +  V+   +AV G   +      L 
Sbjct: 372 RVTCNISKFAPEARKAALEHRGGI-VHFEISPK-NINKVVEAQVAVEGDVTRNLE--KLI 427

Query: 351 PRLTPNEPCPPDTILRQEWM-----WNEVSKFFRDGD---------IILTETGTAAFGIN 396
           P +TP +        R+EW      W E   +    +          ++ E    A    
Sbjct: 428 PLVTPVKE-------RKEWFDQINEWREKYPYEYQKETEGSKIKPQTVIAELSKMANATG 480

Query: 397 QSLFPNNTIGISQVLW-------------------GSIGFTGGAVLGASFAAEEIDPSKR 437
           +++     +G  Q +W                   G++GF   A +GA  A     P   
Sbjct: 481 KNVIVTTGVGQHQ-MWAAQHWTWKNPRTFITSGGLGTMGFGLPAAIGAQVA----KPDAI 535

Query: 438 VILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNN 471
           V+   GD S  +T+ E+S+ ++      + +LNN
Sbjct: 536 VVDIDGDASFNMTLMELSSAVQARAPVKILLLNN 569

>NCAS0G03960 Chr7 (733213..734946) [1734 bp, 577 aa] {ON} Anc_1.450
           YEL020C
          Length = 577

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 130/576 (22%), Positives = 223/576 (38%), Gaps = 72/576 (12%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           LT   Y    L Q ++ T+FG+ G   + L DK+ E  G+R+    NE  A+YAA GY  
Sbjct: 10  LTATEYFVSLLKQYEIDTVFGIVGIPIVELADKMIE-HGIRFISCRNEQAASYAASGYGY 68

Query: 64  VKGM-ACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
           + G  A ++   G G + AL GI  S +    ++ + G  S +S+  Q+        G F
Sbjct: 69  LTGKPAVLLVVGGPGLIHALAGIYNSMSNKWPLIVIAG--SSNSETDQV--------GGF 118

Query: 123 TVFHRMSA--NISETTAMVTDIGTAPAEIDRCIRTTYVTQRPV---YLGLPANLVD--LP 175
               ++S      + T  +  I    A  +      +  Q P+   Y+  P NL++    
Sbjct: 119 QDLDQVSLLNKYVKYTVKLNSINIPTALFNAY---NFAIQSPMGVTYIDFPGNLIEGNYK 175

Query: 176 VPTHLLETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLI 235
           V       P+ +  +                    +SN V++     G  +   + NK I
Sbjct: 176 VQAQPATNPVSIPRRVRCSPDPNTVNEVAKLIIENSSNNVLVI-LGKGAVEFHKDINKFI 234

Query: 236 DMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRN-AVESADLILSVGALLSDFNT 294
           +    P   TPM KG + + +          L+  + R+ A++ A+++L +GA L+    
Sbjct: 235 NTFNLPFLPTPMAKGILPDSH---------NLNVSSARSKALKDANIVLVLGARLNWILH 285

Query: 295 GSFSYSYKTKNI-VEFHSD--YIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPL-- 349
              S  +  K I ++  +D   + + N T   + +   L  L   V S    ++ + L  
Sbjct: 286 FGESPKWNAKAIFIQCDNDPSNLGVNNGTNTNLSL---LGDLGLTVNSLSDAFSQITLNW 342

Query: 350 -----------------PPRLTPNEP--CPPDTILRQEWMWNEVSKFFRDGDIILTETGT 390
                              +L   E        +L    ++  + K   +   +L   G 
Sbjct: 343 KYEKGISDEMRGIILKNQFKLQEKEQRLIKDKDLLNYNVVYGALRKLMDESKTVLVTEGA 402

Query: 391 AAFGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAA--EEIDPSKR---VILFIGDG 445
            +  I +  FP++     Q L      T G  LG   AA   E+   KR   VIL  GD 
Sbjct: 403 NSMDIARISFPSSV--PKQRLDAGTNATMGIGLGYGIAACLNELRNGKRGKDVILIQGDS 460

Query: 446 SLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLIHGPNAGYNAI---QPWRHTKLLEAF 502
           +   +  EI T +R+ L   + V+NN+G     L + P+    +    Q  R+  +    
Sbjct: 461 AFGFSGMEIETAVRFKLGLIIVVMNNSGIYHGVLNYKPDMTMPSTSLSQKCRYDTVAIGL 520

Query: 503 GANDY--ENVKITTTGEWQTLTQDKQFNEPSKIRMI 536
           GAN Y   N++       ++L   +   E S I +I
Sbjct: 521 GANGYLVNNIQELKQAFTKSLDDSRSKGETSVINVI 556

>ZYRO0E03454g Chr5 complement(270926..272575) [1650 bp, 549 aa] {ON}
           similar to uniprot|P39994 Saccharomyces cerevisiae
           YEL020C Hypothetical ORF
          Length = 549

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 111/494 (22%), Positives = 185/494 (37%), Gaps = 50/494 (10%)

Query: 9   YLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARVKGM- 67
           Y    L    V T+FG+ G   + L D + E  G+++    NE +A+YAA  Y  + G  
Sbjct: 6   YFTRVLQNYGVDTVFGIVGIPIVELADTMIE-HGIKFIACRNEQSASYAASAYGYLTGKP 64

Query: 68  ACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTVFHR 127
             ++   G G + AL GI  S +    +L + G    SS+A+          G F    +
Sbjct: 65  GVLLVVGGPGIIHALAGIYNSMSNKWPLLVLAG----SSEAQH--------RGGFQELDQ 112

Query: 128 MSANISETTAMVTDIGTAPAEI---DRCIRTTYVTQRPVYLGLPANLVDLPVPTHLLETP 184
           +S  +         + ++  ++   D      Y T    YL +P NL+   V    L  P
Sbjct: 113 VSL-LKPYVKFSGQLNSSNIDVLTYDALRLVQYTTAGATYLDIPGNLIGSTVKKDSLP-P 170

Query: 185 IDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQFPAFV 244
           +     P                     N  +L     G      E  + +D  Q P   
Sbjct: 171 VKNIYVPKSSPDPSAVQEVTDLIRKNPEN--VLVVVGKGAVHASQEIRQFVDRFQLPFLP 228

Query: 245 TPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYSYKTK 304
           TPMGKG + + +P         +S+   R A++ A ++L +GA L+     + +  +   
Sbjct: 229 TPMGKGVVPDSHPL-------NVSSARSR-ALQEAKVVLVLGARLNWILHFASAPKWNPD 280

Query: 305 NI-VEFHSDYIKIRNATFPGVQMKFVLNKLLAV--VGSAVKGYTPVPLPPRLTPNEPCPP 361
            + ++  SD   + +  F    +    +  L V  + +++  Y    L P L  N     
Sbjct: 281 ALFIQVDSDTTTLGHNNFKSQHLSLWGDIGLTVRLITASLGDYHSQGLSPSLQSNIARNA 340

Query: 362 DTILRQEWM-------WNEVSKFFR----DGDIILTETGTAAFGINQSLFPNNTIGISQV 410
             +  QE         +N V    R    D   I+   G       +  FP +     Q 
Sbjct: 341 AKLKSQESQQVSSRLNYNVVYAHLRPLINDESTIIVSEGANTMDKARVSFPTDY--PLQR 398

Query: 411 LWGSIGFTGGAVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLN 470
           L      T G  +G + AA+  +P K V++  GD +   +  +I T  R  L   + V+N
Sbjct: 399 LDAGTNATMGVGMGYALAAKVSNPDKTVLVIQGDSAFGFSAMDIETATRSGLALIVIVMN 458

Query: 471 NNGYTIERLIHGPN 484
           N G     + HG N
Sbjct: 459 NGG-----IYHGQN 467

>KLTH0D04532g Chr4 (417085..419121) [2037 bp, 678 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 678

 Score = 63.9 bits (154), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 72/303 (23%), Positives = 125/303 (41%), Gaps = 30/303 (9%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           L+ G+   E + +  V T+FG PG   L++ D IY      +    +E  A + A+GYAR
Sbjct: 83  LSGGQIFHEMMRRHKVNTVFGYPGGAILAVYDAIYNSEHFNFVLPKHEQGAGHMAEGYAR 142

Query: 64  VKGM-ACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
           V G    ++ T G G  + +  +A + A+ V ++   G  + SS          +G   F
Sbjct: 143 VSGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVATSS----------IGTDAF 192

Query: 123 TVFH--RMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQR--PVYLGLPANLVD----- 173
                  +S + ++   MV ++   P  I+       V+ R  PV + LP ++       
Sbjct: 193 QEADVIGISRSCTKWNVMVKNVEELPRRINEAFEIA-VSGRPGPVLVDLPKDVTSAILRT 251

Query: 174 -LPVPTHLLETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVI-LADACAGRHDVKVET 231
            +PV + L    +    K   +E               A  P+I +     G+       
Sbjct: 252 PIPVKSTLPSNALSKITKSAAKEFTLANLQRAADLINIAKKPLIYVGGGIFGKEQGPKLL 311

Query: 232 NKLIDMTQFPAFVTPMGKGTIDERNPR---FGGVYVGTLSNENVRNAVESADLILSVGAL 288
            +L +  Q P   T  G G  D+ +P+     G++    +N +V+N    ADLI+++GA 
Sbjct: 312 RELAERAQIPVSTTIQGLGAFDQEDPKSLDMLGMHGSAFANLSVQN----ADLIIALGAR 367

Query: 289 LSD 291
             D
Sbjct: 368 FDD 370

>Kpol_297.12 s297 complement(20788..22803) [2016 bp, 671 aa] {ON}
           complement(20788..22803) [2016 nt, 672 aa]
          Length = 671

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/305 (22%), Positives = 125/305 (40%), Gaps = 20/305 (6%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           LT G    E + + +V T+FG PG   L + D IY     ++    +E  A + A+GY+R
Sbjct: 76  LTGGEIFHEMMIRNNVDTVFGYPGGAILPVYDAIYNSDKFKFVLPRHEQGAGHMAEGYSR 135

Query: 64  VKGM-ACIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ + ++   G VP+ +           +G   
Sbjct: 136 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVIG--- 192

Query: 122 FTVFHRMSANISETTAMVTDIGTAPAEIDRCIR-TTYVTQRPVYLGLPANLV------DL 174
                 +S + ++   MV  +   P  I+      T     PV + LP ++        +
Sbjct: 193 ------ISRSCTKWNVMVKSVEELPRRINEAFEIATSGRPGPVLVDLPKDVTAAILRNPI 246

Query: 175 PVPTHLLETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVE-TNK 233
           PV + L    ++  +K    E               A  PV+        H+       +
Sbjct: 247 PVNSTLPSNALNQLVKNAHNEFTEESLSKAASLINIAKRPVLYVGGGILNHEEGPRLLRE 306

Query: 234 LIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFN 293
           L +  Q P   + +G G  D+ +P+   + +G   +     A+++ADLI++VGA   D  
Sbjct: 307 LSERAQIPVTTSLLGLGAFDQEDPKSLDM-LGMHGHAPANLAIQNADLIIAVGARFDDRV 365

Query: 294 TGSFS 298
           TG+ +
Sbjct: 366 TGNIA 370

>Suva_13.287 Chr13 (465217..467280) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 111/506 (21%), Positives = 189/506 (37%), Gaps = 58/506 (11%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           LT G+   E + + +V T+FG PG   L + D I+      +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRHNVDTVFGYPGGAILPVYDAIHNSDKFTFVLPRHEQGAGHMAEGYAR 151

Query: 64  VKGM-ACIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMVTDIGTAPAEIDRCIR-TTYVTQRPVYLGLP----ANLVDLPV 176
                 +S + ++   MV  +   P  I+      T     PV + LP    A ++  P+
Sbjct: 209 ------ISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPKDVTAAILRNPI 262

Query: 177 PTH--LLETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRH-DVKVETNK 233
           PT   L    ++        E               A  PV+   A    H D      +
Sbjct: 263 PTKTTLPSNALNQLTSRTQDEFVLQNINKAADLINLAKKPVLYVGAGILNHADGPRLLKE 322

Query: 234 LIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFN 293
           L D  Q P   T  G G  D+ +P+   + +G         AV++ADL+++VGA   D  
Sbjct: 323 LSDRAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNADLLIAVGARFDDRV 381

Query: 294 T-------------------GSFSYSYKTKNIVEFHSDYIKIR-------NATFPGVQMK 327
           T                   G   +    KNI +     I +        +   P +   
Sbjct: 382 TLNIAKFAPEARRAAAEGRGGIIHFEVSPKNINKVVETQIAVEGDATGNLDKMMPKI--- 438

Query: 328 FVLNKLLAVVGSAVKGYTPVPLPPRL-TPNEPCPPDTILRQEWMWNEVSKFFRD-GDIIL 385
           F + +     G   +     P    + TP     P T++       ++SK   D G  ++
Sbjct: 439 FPVKERSEWFGQINEWKKKYPYAYMMETPGSKIKPQTVI------TKLSKIANDTGRHVI 492

Query: 386 TETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEIDPSKRVILFIGDG 445
             TG     +  +         + +  G +G T G  L A+  A+   P   VI   GD 
Sbjct: 493 VTTGVGQHQMWAAQHWTWKTPRTFITSGGLG-TMGYGLPAAIGAQVAKPDSLVIDIDGDA 551

Query: 446 SLQLTVQEISTLIRWDLKPYLFVLNN 471
           S  +T+ E+S+ ++      + VLNN
Sbjct: 552 SFNMTLTELSSAVQAGTPVKILVLNN 577

>NDAI0H02380 Chr8 (578157..580214) [2058 bp, 685 aa] {ON} Anc_2.441
          Length = 685

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 111/515 (21%), Positives = 197/515 (38%), Gaps = 78/515 (15%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           L+ G+   E + + +V T+FG PG   L + D IY     ++    +E  A + A+GYAR
Sbjct: 92  LSGGQIFNEMMKRQNVDTVFGYPGGAILPVYDAIYNSDAFKFVLPKHEQGAGHMAEGYAR 151

Query: 64  VKG-MACIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKTGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQR-PVYLGLP----ANLVDLPV 176
                 +S + ++   MV  +   P  I+         +  PV + LP    A ++  P+
Sbjct: 209 ------ISRSCTKWNVMVRSVAELPLRINEAFEIANSGRPGPVLVDLPKDVTAAILRNPI 262

Query: 177 PTHLLETPIDLTLKPNDQEA-XXXXXXXXXXXXXXASNPVI-LADACAGRHDVKVETNKL 234
           P      PI   LK   +EA               A  PV+ + +      D      +L
Sbjct: 263 PIKST-LPITSQLKSVAEEAYTMESINRAADLINLAKRPVLYVGNGIMNNPDGPRLLKEL 321

Query: 235 IDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNT 294
            D  Q P   T  G G  D+ +P+   + +G         A+++ADL++++GA   D  T
Sbjct: 322 SDRAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAMQNADLVIALGARFDDRVT 380

Query: 295 GSFSYSYKTKNIVEFHSDYIKIRNATFPGV--------QMKFVLNKLLAVVGSAVKGYTP 346
           G         NI +F  +  +       G+         +  V+   +AV G A    + 
Sbjct: 381 G---------NIAKFAPEARRAALEERGGIIHFEISPKNINKVVEAQVAVEGDAASNVSK 431

Query: 347 VPLPPRLTPNEPCPPDTILRQEWM-----W---------NEVSKFFRDGDIILTETGTAA 392
           + LP      E        R++W      W          E ++       ++++    A
Sbjct: 432 L-LPLVFPVKE--------RKDWFKQINQWKKEYPYSYMKETAESKIKPQTVISKLSKIA 482

Query: 393 FGINQSLFPNNTIGISQVLW----------------GSIGFTGGAVLGASFAAEEIDPSK 436
            G  + +     +G  Q +W                G +G T G  L A+  A+   P  
Sbjct: 483 NGTGKPVVVTTGVGQHQ-MWAAQHWTWKHPRSFITSGGLG-TMGYGLPAAIGAQVARPDA 540

Query: 437 RVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNN 471
            VI   GD S  +T+ E+S+ ++  +   + +LNN
Sbjct: 541 IVIDIDGDASFNMTLTELSSAVQAGVPIKILLLNN 575

>TBLA0I01400 Chr9 (303028..305160) [2133 bp, 710 aa] {ON} Anc_2.441
           YMR108W
          Length = 710

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 109/512 (21%), Positives = 196/512 (38%), Gaps = 63/512 (12%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M  +T G    E + + +V T+FG PG   L + D IY     ++    +E  A + A+G
Sbjct: 111 MIGMTGGEIFNEMMRRKNVDTVFGYPGGAILPVYDAIYNSENFKFVLPRHEQGAGHMAEG 170

Query: 61  YARVKGM-ACIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLG 118
           YAR  G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G
Sbjct: 171 YARASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVIG 230

Query: 119 NGDFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQR-PVYLGLPANLVD--LP 175
                    +S + ++   MV  +   P  I+         +  PV + LP ++    L 
Sbjct: 231 ---------ISRSCTKWNVMVKSVDELPKRINEAFEIAMSGRPGPVLIDLPKDVTAAVLK 281

Query: 176 VPTHLLETPIDLTLKPN-----DQEAXXXXXXXXXXXXXXASNPVILADA-CAGRHDVKV 229
            P  +L   +  T   N      ++               A  PVI A A      +   
Sbjct: 282 NPIPVLNNSLPYTAISNINQIIQRKFLSENIQETAKLINMAKKPVIYAGAGILSNLNGPT 341

Query: 230 ETNKLIDMTQFPAFVTPMGKGTIDERNPR---FGGVYVGTLSNENVRNAVESADLILSVG 286
              +L + +Q P   T    G  D+++P+     G++   ++N     A+++ADLI+++G
Sbjct: 342 LLKELSERSQIPVTTTLQALGAFDQQDPKSLDMLGMHGSAVANL----AIQNADLIIALG 397

Query: 287 ALLSDFNTGSFS-------------------YSYKTKNIVEFHSDYIKIRNATFPGVQMK 327
               D  TG+ S                   +    KNI +     I +       +++ 
Sbjct: 398 GRFDDRVTGNISKFAPEARKAALEKRGGIVHFEISPKNINKVVETQIALEGDVTENLEIL 457

Query: 328 FVLNK-------LLAVVGSAVKGYTPVPLPPRLTPNEPCPPDTILRQEWMWNEVSKFFRD 380
             L K         A +    K Y    +  R TP     P T++ +    ++++     
Sbjct: 458 LPLIKSVDERPEWFAQINQWKKAYPYEYM--RETPGSKIKPQTVISR---LSDIANSTGK 512

Query: 381 GDIILTETGTAAFGINQS-LFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEIDPSKRVI 439
             I+ T  G       Q   + N    I+    G++G+   A +GA  A     P   VI
Sbjct: 513 KVIVTTGVGQHQMWTAQHWTWRNPRTFITSGGLGTMGYGLPAAIGAQVAF----PEALVI 568

Query: 440 LFIGDGSLQLTVQEISTLIRWDLKPYLFVLNN 471
              GD S  +T+ E+S+ ++ +    + +LNN
Sbjct: 569 DIDGDASFNMTLTELSSAVQANTPIKIMLLNN 600

>TDEL0B05520 Chr2 complement(980893..982560) [1668 bp, 555 aa] {ON}
           Anc_1.450 YEL020C
          Length = 555

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 113/527 (21%), Positives = 203/527 (38%), Gaps = 49/527 (9%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           L +  Y  + L Q  V T+FG+ G   + L D +    G+++    NE +A+YAA  Y  
Sbjct: 3   LPIPEYFTQLLQQYGVDTVFGIVGIPIVELADTMIG-KGIKFIACRNEQSASYAASAYGY 61

Query: 64  VKGM-ACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
           + G    ++   G G + AL GI  S +    ++ + G    SS+       H  G  + 
Sbjct: 62  LTGKPGVLLVVGGPGLIHALAGIYNSMSNRWPLIVIAG----SSEDL-----HKGGFQEL 112

Query: 123 TVFHRMSANISETTAMVTDIGTAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLPVPT--H 179
                +S ++  T  + TD           +R TT  T    Y+  P +L+   +    +
Sbjct: 113 DQVSLLSDHLKFTGKLTTDPDVIELVTYNAMRLTTTGTPGVTYIDFPGSLISESIERSPY 172

Query: 180 LLETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQ 239
            +++   +   P+ +                  N  IL     G  +   E  KLI+   
Sbjct: 173 PVQSISRIQYMPDTESLQRVVKLLSSD-----QNKRILVVIGKGAVNASNEVRKLINDYN 227

Query: 240 FPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRN-AVESADLILSVGALLS-------- 290
            P   TPM KG + + +P         L+  + R+ A++ A+++L +GA L+        
Sbjct: 228 LPFLSTPMAKGVVPDSHP---------LNASSARSKALKEAEIVLVLGARLNWILHFGAP 278

Query: 291 ---DFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKL----LAVVGSAVKG 343
              D NT         +++ + +   +        G+ +K ++ KL     A  G + + 
Sbjct: 279 PKWDANTIFIQVDCDPESLGQNNQRGVGYSLCGDIGLTVKSLIEKLKLERWAYQGLSREL 338

Query: 344 YTPVPL-PPRLTPNEPCPPDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPN 402
            + + L   +L   E       L    ++  +  F  D   I+   G       +  FP 
Sbjct: 339 RSAIKLNHEKLAKKEQIVHHGRLNYNKVYQCLRTFIDDSRTIIVSEGANTMDQARISFPT 398

Query: 403 NTIGISQVLWGSIGFTGGAVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDL 462
           +       L      T G  LG + AA+   P K ++L  GD +   +  EI T +R  L
Sbjct: 399 DYP--KHRLDAGTNATMGIGLGYAIAAKIARPDKSIVLLQGDSAFGFSAMEIETAVRNRL 456

Query: 463 KPYLFVLNNNG--YTIERLIHGPNAGYNAIQPWRHTKLLEAFGANDY 507
              + V+NN+G  + + + + G        Q  R+  + +  GA  Y
Sbjct: 457 GLVIIVMNNSGIYHGVGQKVEGSLPSTALSQDCRYDLVGQGLGAVGY 503

>NCAS0F01500 Chr6 (299388..301442) [2055 bp, 684 aa] {ON} Anc_2.441
           YMR108W
          Length = 684

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 113/523 (21%), Positives = 198/523 (37%), Gaps = 92/523 (17%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           L+ G+   E + + +V T+FG PG   L + D IY      +    +E  A + A+GYAR
Sbjct: 89  LSGGQIFNEMMKRQNVDTVFGYPGGAILPVYDAIYNSEAFNFVLPKHEQGAGHMAEGYAR 148

Query: 64  VKGM-ACIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ + ++   G VP+ +           +G   
Sbjct: 149 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 205

Query: 122 FTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLP--VPTH 179
                 +S + ++   MV  +   P  I+       ++ RP  +     LVDLP  V   
Sbjct: 206 ------ISRSCTKWNVMVKSVAELPLRINEAFEIA-MSGRPGPV-----LVDLPKDVTAA 253

Query: 180 LLETPIDLT----------LKPNDQEA-XXXXXXXXXXXXXXASNPVI-LADACAGRHDV 227
           +L  PI +           +K   QE                A  PV+ + +      D 
Sbjct: 254 ILREPIPIKSTLPSGTLTQIKSIAQEDFLADSINRAADLINLAKKPVLYVGNGIFNNEDG 313

Query: 228 KVETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGA 287
                +L +  Q P   T  G G  D+ +P+   + +G         A+++ADLI++VGA
Sbjct: 314 PRLLKELSERAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAMQNADLIIAVGA 372

Query: 288 LLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGV--------QMKFVLNKLLAVVGS 339
              D  TG         NI +F  +  +  N    G+         +  V+   +AV G 
Sbjct: 373 RFDDRVTG---------NIAKFAPEARRAANEGRGGIIHFEISPKNINKVVEAQVAVEGD 423

Query: 340 AVKGYTPVPLPPRLTPNEPCPPDTILRQEWMWNEVSKFFRD---------------GDII 384
           A      + LP      E        R EW + E++++ +D                  +
Sbjct: 424 AAANIDKM-LPAIFPIKE--------RTEW-FKEINQWKKDYPYDYMKEVPGGKLKPQTV 473

Query: 385 LTETGTAAFGINQSLFPNNTIGISQVLW----------------GSIGFTGGAVLGASFA 428
           +++    A    + +     +G  Q +W                G +G T G  L ++  
Sbjct: 474 ISKLSKVANATGRPVIVTTGVGQHQ-MWTAQHWTWKHPRSFITSGGLG-TMGYGLPSAIG 531

Query: 429 AEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNN 471
           A+   P   VI   GD S  +T+ E+S+ ++      + +LNN
Sbjct: 532 AQVAHPEALVIDIDGDASFNMTLTELSSAVQAGTPVKIMILNN 574

>TDEL0A02160 Chr1 complement(389068..391116) [2049 bp, 682 aa] {ON}
           Anc_2.441 YMR108W
          Length = 682

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 119/519 (22%), Positives = 206/519 (39%), Gaps = 82/519 (15%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           LT G+   E + + +V T+FG PG   L + D I++     +    +E  A + A+GYAR
Sbjct: 87  LTGGQIFHEMMIRHNVDTVFGYPGGAILPVYDAIHDSKSFNFVLPRHEQGAGHMAEGYAR 146

Query: 64  VKGM-ACIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G   
Sbjct: 147 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVVG--- 203

Query: 122 FTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQR--PVYLGLP----ANLVDLP 175
                 +S + ++   MV  I   P  I+       V+ R  PV + LP    A ++  P
Sbjct: 204 ------ISRSCTKWNVMVRSIEELPLRINEAFEIA-VSGRPGPVLVDLPKDVTAAILKNP 256

Query: 176 VPTHLL---ETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADAC-----AGRHDV 227
           +PT       +   LT +  D E+              A  PV+   A      AG   +
Sbjct: 257 IPTKTTLPSNSLAQLTKRAMD-ESTNENIVRTADLLNKAKTPVLYVGAGILNNPAGPKLL 315

Query: 228 KVETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGA 287
           K    +L +  Q P   T    G  D+++P+   + +G         A+++ADLIL+VG+
Sbjct: 316 K----ELSERAQIPVTTTIQALGAFDQQDPKSLDM-LGMHGCATANMAIQNADLILAVGS 370

Query: 288 LLSD---FNTGSFSYSYKTK------NIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVG 338
              D    N   F+   +         IV F    I  +N       +  V+   +AV G
Sbjct: 371 RFDDRVTLNISKFAPEARRAALENRGGIVHFE---ICPKN-------ISKVVETQVAVEG 420

Query: 339 SA---VKGYTPVPLP----------------------PRLTPNEPCPPDTILRQEWMWNE 373
            A   ++   P+ +P                       + TP     P T++ +  + + 
Sbjct: 421 DAASNIEKLLPLVVPVKERTEWFAQIEEWKEKYPYAYQKETPGSKIKPQTVISK--LSDL 478

Query: 374 VSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEID 433
            +K   D ++I+T TG     +  + +       S +  G +G T G  L A+  A+   
Sbjct: 479 ANK--SDKEVIVT-TGVGQHQMWAAQYWTWKSPRSFITSGGLG-TMGYGLPAAIGAQVAK 534

Query: 434 PSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNN 472
           P   VI   GD S  +T+ E+S+ ++      + +LNN 
Sbjct: 535 PDALVIDIDGDASFNMTLMELSSAVQAKTPVKILLLNNE 573

>KNAG0E02360 Chr5 complement(470361..472442) [2082 bp, 693 aa] {ON}
           Anc_2.441 YMR108W
          Length = 693

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 112/512 (21%), Positives = 195/512 (38%), Gaps = 69/512 (13%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           LT G+   E + + +V T+FG PG   L + D IY     ++    +E  A + A+GYAR
Sbjct: 97  LTGGQIFNEMMSRHNVDTVFGYPGGAILPVYDAIYGSENFKFVLPKHEQGAGHMAEGYAR 156

Query: 64  VKGM-ACIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G   
Sbjct: 157 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPTNAIGTDAFQEADVVG--- 213

Query: 122 FTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQ-RPVYLGLP----ANLVDLPV 176
                 +S + ++   MV ++   P  I+         +  PV + LP    A ++   +
Sbjct: 214 ------ISRSCTKWNVMVKNVAELPKRINEAFEIAMSGRPGPVLVDLPKDVTAAVLREAI 267

Query: 177 PTHLL-----------ETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVI-LADACAGR 224
           PT               T  D  L P   +A              A  PV+ + +     
Sbjct: 268 PTESTLPSLNGGATTGATVFDEFLAPAINKA--------ADLINLAKKPVLYVGNGILNN 319

Query: 225 HDVKVETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILS 284
            D      +L D  Q P   T  G G  D+ +P+   + +G         A+++ADLI++
Sbjct: 320 EDGPRLLKELSDRAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLAIQNADLIIA 378

Query: 285 VGALLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGY 344
           VGA   D  TG+ +       I    +    I     P   +  V+   +AV G A +  
Sbjct: 379 VGARFDDRVTGNITKFAPEAKIAAQENRGGIIHFEVSPK-NINKVVEAQVAVEGDATENI 437

Query: 345 TPVPLPPRLTPNEPCPPDTILRQEWMWNEVSKFFRD--GDIILTETGTAAFGINQSLFPN 402
               + P++ P +         ++W       + ++  G  I+ +T  A      +    
Sbjct: 438 --ATMLPKVFPVKHRAEWFKQIEQWKQKFPYAYMKETPGSKIMPQTVIAKLSKLANASGR 495

Query: 403 N---TIGISQ-VLW-------------------GSIGFTGGAVLGASFAAEEIDPSKRVI 439
           +   T G+ Q  +W                   G++GF   A +GA  A     P   VI
Sbjct: 496 DVVVTTGVGQHQMWAAQHWTWKKPRTFVTSGGLGTMGFGLPAAIGAQVA----KPDAMVI 551

Query: 440 LFIGDGSLQLTVQEISTLIRWDLKPYLFVLNN 471
              GD S  +T+ E+S+ ++      + +LNN
Sbjct: 552 DIDGDASFNMTLTELSSAVQAGTPVKILLLNN 583

>Skud_13.267 Chr13 (459466..461529) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 60.5 bits (145), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 109/509 (21%), Positives = 189/509 (37%), Gaps = 64/509 (12%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           LT G+   E + + +V T+FG PG   L + D I+      +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 64  VKGM-ACIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMVTDIGTAPAEIDRCIR-TTYVTQRPVYLGLP----ANLVDLPV 176
                 +S + ++   MV  +   P  I+      T     PV + LP    A ++  P+
Sbjct: 209 ------ISRSCTKWNVMVKTVEELPLRINEAFEIATSGRPGPVLVDLPKDVTAAILRNPI 262

Query: 177 PTH--LLETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADA-CAGRHDVKVETNK 233
           PT   L    ++        E               A  PV+   A      D      +
Sbjct: 263 PTKTTLPSNALNQLTSHAQDEFVMQSISKAADLINLAKKPVLYVGAGILNNADGPRLLKE 322

Query: 234 LIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFN 293
           L +  Q P   T  G G+ D+ +P+   + +G         AV++ADL+++VGA   D  
Sbjct: 323 LSERAQIPVTTTLQGLGSFDQEDPKSLDM-LGMHGCVTANLAVQNADLLIAVGARFDDRV 381

Query: 294 T-------------------GSFSYSYKTKNI-------VEFHSDYIKIRNATFPGVQMK 327
           T                   G   +    KNI       +    D     +   P +   
Sbjct: 382 TCNIAKFAPEARRAAAEGRGGIVHFEVVPKNINKVVETQIAVEGDATSNLDKMMPKI--- 438

Query: 328 FVLNKLLAVVGSAVKGYTPVPLPPRL-TPNEPCPPDTILRQEWMWNEVSKFFRD-GDIIL 385
           F + +     G   K     P    + TP     P T++       ++SK   D G  ++
Sbjct: 439 FPVKERSEWFGQINKWKKEFPYAYMMETPGSKIKPQTVI------TKLSKIANDTGRHVI 492

Query: 386 TETGTAA---FGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEIDPSKRVILFI 442
             TG      +      + N    I+    G++G+   + +GA  A     P   VI   
Sbjct: 493 VTTGVGQHQMWAAQHWTWKNPRTFITSGGLGTMGYGLPSAIGAQVA----KPESLVIDID 548

Query: 443 GDGSLQLTVQEISTLIRWDLKPYLFVLNN 471
           GD S  +T+ E+S+ ++      + +LNN
Sbjct: 549 GDASFNMTLTELSSAVQAGTPVKILILNN 577

>ZYRO0G19954g Chr7 (1653353..1655455) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 700

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 113/520 (21%), Positives = 197/520 (37%), Gaps = 86/520 (16%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           LT G+   E + + DV T+FG PG   L + D I+E     +    +E  A + A+GYAR
Sbjct: 104 LTGGQIFHEMMRRHDVDTVFGYPGGAILPVYDAIHESDAFNFILPRHEQGAGHMAEGYAR 163

Query: 64  VKGM-ACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +  + A+ V ++   G  + S+          +G   F
Sbjct: 164 ATGRPGVVLVTSGPGATNVVTPMTDALADGVPLIVFTGQVATSA----------IGTDAF 213

Query: 123 TVFH--RMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQ-RPVYLGLP----ANLVDLP 175
                  +S + ++   MV ++   P  I+         +  PV + LP    A ++  P
Sbjct: 214 QEADVVGISRSCTKWNVMVKNVEELPKRINEAFEIAMSGRPGPVLVDLPKDVTAAVLRNP 273

Query: 176 VPTHLL---ETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADA-CAGRHDVKVET 231
           +PT      ++   LT +  D E               A  P++   A      D     
Sbjct: 274 IPTKSTLPSDSLAQLTKRAQD-EFTSNNVKRAADLVNVAKKPILYVGAGIFNNPDGPRLL 332

Query: 232 NKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSD 291
            +L +  Q P   T  G G  D+ + +   + +G         A+++ADLIL+VGA   D
Sbjct: 333 KELSERAQIPVTTTLQGLGAFDQEDTKSLDM-LGMHGCATANLAIQNADLILAVGARFDD 391

Query: 292 FNTGSFSYSYKTKNIVEFHSDYIKIRNATFPG----VQMKFVLNKLLAVVGS--AVKGYT 345
                      T NI +F  +    R A   G    V  +     +  VV +  AV G  
Sbjct: 392 ---------RVTCNISKFAPE---ARRAALEGRGGIVHFEMTPKNISKVVETQVAVHGDA 439

Query: 346 PVPLPPRLTPNEPCPPDTILRQEWMWNEVSKFFRD---------------GDIILTETGT 390
              +   +    P       RQEW +N++S++ ++                  ++++   
Sbjct: 440 ATNIQKLI----PLVFGVKERQEW-FNQISQWKKEYPLDYMHETPGSKIKPQTVISKLSD 494

Query: 391 AAFGINQSLFPNNTIGISQVLW-------------------GSIGFTGGAVLGASFAAEE 431
            A    + +     +G  Q +W                   G++G+   A +GA  A   
Sbjct: 495 IANATGKEVIVTTGVGQHQ-MWAAQHWTWKTPRSFITSGGLGTMGYGLPAAIGAQIA--- 550

Query: 432 IDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNN 471
             P+  V    GD S  +T+ E+S+ ++      + VLNN
Sbjct: 551 -KPNALVFDIDGDASFNMTLTELSSAVQAKTPIKILVLNN 589

>TPHA0G02440 Chr7 complement(498107..500182) [2076 bp, 691 aa] {ON}
           Anc_2.441 YMR108W
          Length = 691

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 126/527 (23%), Positives = 203/527 (38%), Gaps = 98/527 (18%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           LT G    E + + +V T+FG PG   L + D IY      +    +E  A + A+GYAR
Sbjct: 94  LTGGEIFHEMMKRHNVDTVFGYPGGAILPVYDAIYNSKDFNFVLPRHEQGAGHMAEGYAR 153

Query: 64  VKG-MACIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  IA + A+ V ++   G VP+ +           +G   
Sbjct: 154 ASGKCGVVLVTSGPGATNVITPIADALADGVPMVVFTGQVPTAAIGTDAFQEADVIG--- 210

Query: 122 FTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTY---VTQRPVYLGLPANLVDLP--V 176
                 +S + ++   MV  I   P    +CI   +    + RP  +     LVDLP  V
Sbjct: 211 ------ISRSCTKWNVMVKRIEDLP----KCINEAFEIATSGRPGPV-----LVDLPKDV 255

Query: 177 PTHLLETPIDLT----------LKPNDQ-EAXXXXXXXXXXXXXXASNPVI-----LADA 220
              +L+TPI +           L  N Q +               A  P++     + + 
Sbjct: 256 QASILKTPIPIKTTIPSNALRHLTRNVQTQFSEVAIKRAAELINIAKKPILYVGGGILNN 315

Query: 221 CAGRHDVKVETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESAD 280
             G   +K    +L D  Q P   T    G  D+ +P+   + +G   +     A+++AD
Sbjct: 316 PEGPRLIK----ELSDRAQIPVTTTLQALGAFDQEDPKSLDM-LGMHGHAPANLAMQNAD 370

Query: 281 LILSVGALLSD---FNTGSFSYSYKTKNIVE----FHSDYIKIRNATFPGVQMKFVLNKL 333
           LI++VGA   D    N   F+   +   +       H D I  +N       +  V+   
Sbjct: 371 LIIAVGARFDDRVTLNISKFAPEARRAALENRGGIIHFD-ISAKN-------INKVVETQ 422

Query: 334 LAVVGSAVKGYTPVPLPPRLTPNEPCPPDTILRQEWM-----WNEVSKFFRD----GDII 384
           + + G A    T + LP   + +E        R+EWM     W E   +       G  I
Sbjct: 423 VPIEGDAGANLTKL-LPSIFSVSE------AERKEWMETIKTWKEKHPYTYQKESPGSKI 475

Query: 385 LTETGTAAFG--INQSLFP-NNTIGISQ-VLW----------------GSIGFTGGAVLG 424
             +T  A      N+S  P   T G+ Q  +W                G +G T G  L 
Sbjct: 476 KPQTVIAKLSEIANKSGKPIVVTAGVGQHQMWAAQHWTWKKPRTFISSGGLG-TMGYGLP 534

Query: 425 ASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNN 471
           A+  A+   P   VI   GD S  +T+ E+S+ ++      + +LNN
Sbjct: 535 AAIGAQVARPDAIVIDIDGDASFNMTLTELSSAVQAGTPIKILLLNN 581

>KNAG0A06250 Chr1 complement(948840..950882) [2043 bp, 680 aa] {ON}
           Anc_2.441 YMR108W
          Length = 680

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 109/516 (21%), Positives = 197/516 (38%), Gaps = 77/516 (14%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + +V T+FG PG   L + D I+E    ++    +E  A + A+GYAR
Sbjct: 84  MTGGQIFHEMMIRNNVDTVFGYPGGAILPVYDAIHESSAFKFVLPKHEQGAGHMAEGYAR 143

Query: 64  VKGM-ACIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ + ++   G VP+ +           LG   
Sbjct: 144 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVLG--- 200

Query: 122 FTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQ-RPVYLGLPANLV------DL 174
                 +S + ++   MV ++   P  I+         +  PV + LP ++        +
Sbjct: 201 ------ISRSCTKWNIMVKNVAEMPKRINEAFDIAMSGRPGPVLVDLPKDVTAAILRNPI 254

Query: 175 PVPTHLLETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVI-LADACAGRHDVKVETNK 233
           PV + L  + +   +                     A  PV+ +        +       
Sbjct: 255 PVESTLPTSTLKNLVGDMHDAFTKERIEKAAKLINIAKKPVLYVGGGILNNPEGPKLLKT 314

Query: 234 LIDMTQFPAFVTPMGKGTIDERNPR---FGGVYVGTLSNENVRNAVESADLILSVGALLS 290
           L D  Q P   T  G G  D+ +P+     G++   ++N +++N    ADLI+++G    
Sbjct: 315 LSDRAQIPVTTTIQGLGAFDQEDPKSLDMLGMHGSAVANLSIQN----ADLIIAIGTRFD 370

Query: 291 DFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFV----LNKLLAVVGSAVKGYTP 346
           D  TG         N+V+F  +  K       G+    +    +NK++  V  AV+G   
Sbjct: 371 DRVTG---------NLVKFAPEAKKAALENRGGIIHFDISAKNINKIVK-VDVAVEGDAG 420

Query: 347 VPLPPRLTPNEPCPPDTILRQEWM-----WN-----EVSKFFRDGDIILTETGTAAF--- 393
             L   L    P  P    R+EW+     W      +  K   D  I  T     ++   
Sbjct: 421 ANLKELL----PLIPAVREREEWLTKIDEWKLKHSYDYMKDTPDSKIKPTNCDIQSYTKL 476

Query: 394 --GINQSLFPNNTIGISQVLW----------------GSIGFTGGAVLGASFAAEEIDPS 435
                + +     +G  Q +W                G +G T G  L ++  A+   P 
Sbjct: 477 ANASGREVIVTTGVGQHQ-MWAAQYWTWKHPRTFITSGGLG-TMGYGLPSAIGAQVAKPD 534

Query: 436 KRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNN 471
             VI   GD S  +++ E+S+ ++      + +LNN
Sbjct: 535 ALVIDIDGDASFNMSLTELSSAVQAGTPVKILLLNN 570

>NDAI0E02050 Chr5 complement(414418..416490) [2073 bp, 690 aa] {ON}
           Anc_2.441
          Length = 690

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 109/506 (21%), Positives = 190/506 (37%), Gaps = 58/506 (11%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           LT G+   E + + +V T+FG PG   L + D I++     +    NE  A + A+GYAR
Sbjct: 95  LTGGQIFHEMILRNNVDTVFGYPGGAILPVYDAIHDSSAFNFVLPKNEQGAGHMAEGYAR 154

Query: 64  VKGM-ACIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G    + +  +A + A+ V ++   G VP+ +           LG   
Sbjct: 155 ASGKPGVVLVTSGPAATNVITPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVLG--- 211

Query: 122 FTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQR--PVYLGLPANLV------D 173
                 +S + ++   MV  +   P  I+       +++R  PV + LP ++        
Sbjct: 212 ------ISRSCTKWNVMVRSVEEMPRRINEAFEIA-MSRRPGPVLVDLPKDVTAAILRNP 264

Query: 174 LPVPTHLLETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNK 233
           +PV T L    +    K    E               A  PV+     AG  +       
Sbjct: 265 IPVKTTLPSGALSQLTKLAHDEFILENIKKAADLINIAKKPVLY--VGAGILNNMEGPRI 322

Query: 234 LIDMTQ---FPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLS 290
           L D++Q    P   T  G G  D+ +P      +G         AV+++DLI++VG    
Sbjct: 323 LKDLSQRAKIPVTTTIQGLGAFDQEDP-LSLDMLGMHGCATANLAVQNSDLIIAVGTRFD 381

Query: 291 DFNTGSFS-------------------YSYKTKNIVEFHSDYIKIRNATFPGVQ----MK 327
           D  TG+ S                   +    KNI +     + +       ++    M 
Sbjct: 382 DRVTGNISKFAPEARRAALEGNGGIIHFEISPKNINKVVEAQVAVEGDAAANIEKMLSMI 441

Query: 328 FVLNKLLAVVGSAVKGYTPVPLP-PRLTPNEPCPPDTILRQEWMWNEVSKFFRD-GDIIL 385
           F +      + +  +     P    R TP     P T++       ++SK     G  ++
Sbjct: 442 FPVRARSEWLNTIKQWKKEFPYDYMRETPESKLKPQTVI------TKLSKLANSTGKPVI 495

Query: 386 TETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEIDPSKRVILFIGDG 445
             TG     +  + +       S +  G +G T G  L A+  A+   P   VI   GD 
Sbjct: 496 VTTGVGQHQMWTAQYWTWKNPRSFITSGGLG-TMGYGLPAAIGAQVAKPEALVIDIDGDA 554

Query: 446 SLQLTVQEISTLIRWDLKPYLFVLNN 471
           S  +++ E+S+ ++      + +LNN
Sbjct: 555 SFNMSLTELSSAVQAGTAVKVLILNN 580

>Ecym_6107 Chr6 complement(201133..203202) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AEL305C
          Length = 689

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 116/513 (22%), Positives = 197/513 (38%), Gaps = 72/513 (14%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           LT G    E + +  V TIFG PG   L + D IY     ++    +E  A + A+GYA+
Sbjct: 94  LTGGEIFHEMMRRHKVDTIFGFPGGAILPVFDAIYSSDVFKFVLPKHEQGAGHMAEGYAK 153

Query: 64  VKGM-ACIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP  +           +G   
Sbjct: 154 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPRSAIGTDAFQEADVVG--- 210

Query: 122 FTVFHRMSANISETTAMVTDIGTAPAEIDRCIR-TTYVTQRPVYLGLP----ANLVDLPV 176
                 +S + ++   MV  +   P  I+      T     PV + LP    A+++  P+
Sbjct: 211 ------ISRSCTKWNVMVNSVEELPRRINEAFEIATSGRPGPVLVDLPKDVTASVLKSPI 264

Query: 177 P---THLLETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNK 233
           P   T    T  +LT    DQ                A  P++   A    +++  +  K
Sbjct: 265 PMTSTLPSNTLEELTRHVVDQHT-VKTIANAAKLINMAKKPLLYVGAGILNNELGPKVLK 323

Query: 234 -LIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDF 292
            L +  Q P   T  G G  D+ +P+   + +G   +     A+++AD+I+++GA   D 
Sbjct: 324 ELAERAQIPVTTTLHGLGAFDQDDPKSLDM-LGMHGSAAANIAIQNADVIVALGARFDDR 382

Query: 293 NTGSFSYSYKTKNIVEFHSDYIKIRNATFPGV--------QMKFVLNKLLAVVGSAVKGY 344
            TG         N+ +F  +  K       G+         +  V++  +AV G      
Sbjct: 383 VTG---------NVAKFAPEARKAAAEGRGGIVHLEISPKNINKVIDAQVAVEGDVTANL 433

Query: 345 T-------PVPLPP------------------RLTPNEPCPPDTILRQEWMWNEVSKFFR 379
                   PV   P                  + TP+    P T++ +    +E+S    
Sbjct: 434 AKILPLIDPVETRPEWLGQIYKWKEQYPYAYQKETPDSGIKPQTVIAR---LSEISNSTG 490

Query: 380 DGDIILTETGTAAFGINQSL-FPNNTIGISQVLWGSIGFTGGAVLGASFAAEEIDPSKRV 438
              I+ T  G       Q   +      I+    G++GF   A +GA  A     P+  V
Sbjct: 491 KDVIVTTGVGQHQMWAAQHWQWKKPWSFITSGGLGTMGFGLPAAIGAQVA----RPNALV 546

Query: 439 ILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNN 471
           I   GD SL +T+ E+ST ++      + +LNN
Sbjct: 547 IDIDGDASLNMTITELSTTVQAGTPVKILLLNN 579

>TPHA0B03940 Chr2 (928983..930710) [1728 bp, 575 aa] {ON} Anc_1.450
           YEL020C
          Length = 575

 Score = 57.0 bits (136), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 116/529 (21%), Positives = 213/529 (40%), Gaps = 99/529 (18%)

Query: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60
           M  +++  Y+   L + D+ T+FG+ G   +  L + +   G+++    NE +A+YAA  
Sbjct: 1   MSGISVPDYISTVLKKYDIDTVFGIVG-IPIVELAESFITNGIKFISFRNEQSASYAASL 59

Query: 61  YARVKGM-ACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAK-----QLLLH 114
           Y  +      ++T  G G + AL GI  S   +  ++ + G   I SQ K     Q L H
Sbjct: 60  YGYLNNKPGVLLTVGGPGLIHALAGIYNSIENNWPLIVITG--GIESQQKYKNGFQELNH 117

Query: 115 HTLGNGDFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPV-YLGLPANLVD 173
             L N        +S   +E   ++         +   +R + ++ + V +L +P +L+ 
Sbjct: 118 IALLNSYMKFTGELS---TENIDLL---------VYESMRNSMLSPKGVSFLEIPGDLIH 165

Query: 174 LPVPTHLLET-----PI---DLTLKPNDQEAXXXXXXXXXXXXXXASNPVILAD------ 219
             V  ++ ++     PI    LT  PND                   N +++        
Sbjct: 166 KSVGKNIGDSLAKHKPILVDALTFIPNDDILLETAKFLYDAMRKRDQNMLVIVGKGAIGA 225

Query: 220 ACAGRHDVKVETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRN-AVES 278
           + A RH         I+    P   TPM KG I++ N          L+  + R+ A++ 
Sbjct: 226 SSALRH--------FINCFNLPFLPTPMAKGIIEDSNE---------LNVSSGRSMALKD 268

Query: 279 ADLILSVGALLS--------------------DFNTGSFSYS----YKTKNIVEFHSDYI 314
           AD+IL  GA L+                    D NT +   +     +   I +  S   
Sbjct: 269 ADVILVFGAKLNWILHYGDTPKFKDNVKFIQVDNNTKTIGLNNQRGLQNSLIGDIESTVK 328

Query: 315 KI----------RNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCPPDTI 364
           K+          +  T+ G+  K +  K+L+   +A+K        PR+ PN        
Sbjct: 329 KLTMMINHLQNGQMITYKGLS-KAIKEKILS---NAIKLNEKENATPRVVPNANS----- 379

Query: 365 LRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGAVLG 424
           L    ++  +   F+D + IL   G     + +  FP +     ++  G++  T G  LG
Sbjct: 380 LNYNVVFGRLKTLFKDEETILVTEGANTMDVARISFPTD-FPQHRIDCGTLA-TMGIGLG 437

Query: 425 ASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNG 473
            + + +   P+K V+L  GD +   +  E+ T +R++L   + ++NN+G
Sbjct: 438 YAISTKLSKPNKSVVLIQGDSAFGFSGLELETSVRFNLGLIVVIMNNSG 486

>AEL305C Chr5 complement(69381..71387) [2007 bp, 668 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR108W
           (ILV2)
          Length = 668

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 113/510 (22%), Positives = 189/510 (37%), Gaps = 70/510 (13%)

Query: 7   GRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARVKG 66
           G    E + + +V T+FG PG   L + D IY      +    +E  A + A+GYAR  G
Sbjct: 76  GEIFHEMMRRHNVDTVFGYPGGAILPVYDAIYNSDAFNFVLPKHEQGAGHMAEGYARASG 135

Query: 67  M-ACIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGDFTV 124
               ++ T G G  + +  +A + A+ V ++   G VP  +           +G      
Sbjct: 136 KPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPKAAIGTDAFQEADVVG------ 189

Query: 125 FHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLP--VPTHLLE 182
              +S + ++   MV  +   P  I+        + RP  +     LVDLP  V   +L 
Sbjct: 190 ---ISRSCTKWNVMVNHVEELPRRINEAFEIA-TSGRPGPV-----LVDLPKDVTAAILR 240

Query: 183 TPIDL-------TLKPNDQEAX----XXXXXXXXXXXXXASNPVILADACAGRHDVKVE- 230
           +PI L       TL    ++A                  A  PV+   A         E 
Sbjct: 241 SPIPLASALPSTTLAQLTRQAADIDGVRSLADASRLINMAQKPVLYVGAGILNSTRGPEF 300

Query: 231 TNKLIDMTQFPAFVTPMGKGTIDERNPR---FGGVYVGTLSNENVRNAVESADLILSVGA 287
             +L +  Q P   T    G  D+ + +     G++    +N  V+NA    DLI+++GA
Sbjct: 301 LRELAEKAQIPVTTTLQALGAFDQEDSKSVDMLGMHGSAAANLTVQNA----DLIIALGA 356

Query: 288 LLSDFNTGSFS-------------------YSYKTKNIVEFHSDYIKIRNATFPGVQMKF 328
              D  TG+ +                   +    KNI +     + +       ++   
Sbjct: 357 RFDDRVTGNIAKFAPEAQRAAREQRGGIVHFEISPKNINKVVDAQVAVEGDVTANLEKLL 416

Query: 329 VLNKLLAV----VGSAVKGYTPVPLP-PRLTPNEPCPPDTILRQEWMWNEVSKFFRDGDI 383
            L K +A     +G      +  P    R TP     P T++ +    +E++       I
Sbjct: 417 PLIKPVAERKEWLGQIASWKSEYPYDYSRETPGSRIKPQTVITR---LSEIANATGKEVI 473

Query: 384 ILTETGTAAFGINQS-LFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEIDPSKRVILFI 442
           + T  G       Q   +      I+    G++GF   A +GA  A     P   VI   
Sbjct: 474 VTTGVGQHQMWAAQHWTWKKPRTFITSGGLGTMGFGLPAAIGAQVA----KPDAIVIDID 529

Query: 443 GDGSLQLTVQEISTLIRWDLKPYLFVLNNN 472
           GD SL +T+ E+S+ ++      + +LNN 
Sbjct: 530 GDASLNMTLMEMSSAVQAGAPVKILLLNNE 559

>Ecym_1360 Chr1 (739963..741597) [1635 bp, 544 aa] {ON} similar to
           Ashbya gossypii AEL055C
          Length = 544

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 102/491 (20%), Positives = 183/491 (37%), Gaps = 71/491 (14%)

Query: 14  LYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARVKGM-ACIIT 72
           L Q  V+ +FG+ G   + + +   E  G+R+ G  NE + +YAA  Y  + G    ++ 
Sbjct: 11  LKQYGVEVVFGIVGIPIVEVAESFVE-HGIRFIGCRNEQSCSYAASAYGYLTGKPGVLLV 69

Query: 73  TFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTVFHRMSANI 132
             G G + AL G+  S+     +L + G    SS+ +       L     +V  R     
Sbjct: 70  VGGPGVIHALAGVYNSFVNKWPLLVLAG----SSENEYYEGFQELD--QLSVMSRWCKFY 123

Query: 133 SETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHLLETPIDLTLK-- 190
                   + G     +   ++T+ +     Y+ +P  L++    +   E P  + +   
Sbjct: 124 GRI-----NTGNLSHLVYTAMKTSMLQNAVTYIDIPGGLIEEKAKSSD-ELPKKMEIAHI 177

Query: 191 ---PNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQFPAFVTPM 247
              P+ Q                 S   IL     G  +   E    ++  Q P   TPM
Sbjct: 178 RCGPDIQRVKEVATIMQ-------SGKKILVVVGRGSANYPAEVRAFLEKYQLPFLPTPM 230

Query: 248 GKGTIDERNPRFGGVYVGTLSNENVRN-AVESADLILSVGALLS---------------- 290
            KG + + +          L+    R+ A++SA+++L +GA L+                
Sbjct: 231 AKGIVPDTHE---------LNVNGARSLALKSAEVVLILGARLNWILHFGLEPKWSDDAC 281

Query: 291 ----DFNTGSFSYSYKTKNIVEFHSD---YIKIRNATFPGV-QMKFVLNKLLAVVGSAVK 342
               D +  +   +         HSD   +I+  +   P   +   V  K+L+ + S  K
Sbjct: 282 FIQVDRDLSALGTNNPRGVNFSVHSDIGLFIEACDNVLPKTWKNDGVDEKILSKIHSNGK 341

Query: 343 GYTPVPLPPRLTPNEPCPPDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPN 402
                     +   E  P  + LR   ++ ++ +F  D   I+   G     I +  FP 
Sbjct: 342 A---------MKEKEIIPEGSALRYHGVYAKLREFIDDKSTIMVLEGANTMDIARVSFPT 392

Query: 403 NTIGISQVLWGSIGFTGGAVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDL 462
           +       L      T G  +G + AA+  +PSK V+   GD +   +  E+ T+ R  L
Sbjct: 393 SYQ--KHRLDAGTSATMGVGIGYAMAAKVANPSKFVVALEGDSAFGFSAMELETIARNKL 450

Query: 463 KPYLFVLNNNG 473
              + V+NN G
Sbjct: 451 GIVVVVMNNGG 461

>KLLA0B12584g Chr2 complement(1100489..1102564) [2076 bp, 691 aa]
           {ON} highly similar to uniprot|P07342 Saccharomyces
           cerevisiae YMR108W ILV2 Acetolactate synthase catalyses
           the first common step in isoleucine and valine
           biosynthesis and is the target of several classes of
           inhibitors localizes to the mitochondria expression of
           the gene is under general amino acid control
          Length = 691

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 121/510 (23%), Positives = 194/510 (38%), Gaps = 66/510 (12%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           +T G    E + + +V T+FG PG   L + D IY      +    +E  A + A+GYAR
Sbjct: 96  MTGGEIFHEMMQRHNVDTVFGYPGGAILPVYDAIYNSDKFTFVLPKHEQGAGHMAEGYAR 155

Query: 64  VKGM-ACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +A + A+  GV  VV    +++ A        +G   F
Sbjct: 156 ASGKPGVVLVTSGPGATNVVTPMADALAD--GVPLVVFTGQVATSA--------IGTDAF 205

Query: 123 TVFH--RMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLP--VPT 178
                  +S + ++   MV  I   P  I+        + RP  +     LVDLP  V  
Sbjct: 206 QEADVVGISRSCTKWNVMVKTIEELPRRINEAFEIA-TSGRPGPV-----LVDLPKDVTA 259

Query: 179 HLLETPIDL-TLKPND----------QEAXXXXXXXXXXXXXXASNPVILADA-CAGRHD 226
            +L  PI + ++ P+D           E               A  P++   A   G   
Sbjct: 260 AVLRNPIPMKSILPSDTLNQLTQRVVDEFTLENISRAADLINRAKKPLLYVGAGILGSEM 319

Query: 227 VKVETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVG 286
                 +L D  Q P   T  G G  ++ + +   + VG   N     A+++ADLI+++G
Sbjct: 320 GPQYLKQLSDRAQIPVTTTLQGLGAFNQEDHKSLDM-VGMHGNAAANLAIQNADLIIALG 378

Query: 287 ALLSD---FNTGSFSYSY------KTKNIVEFHSDYIKIRNATFPGVQMK----FVLNKL 333
           A   D    N   F+         K   IV F      I       V ++      L KL
Sbjct: 379 ARFDDRVTLNISKFAPEARKAALEKRGGIVHFEISPKNINKVVEAEVAVEGDVTRNLEKL 438

Query: 334 LAVVGS----------AVKGYTPVPLP-PRLTPNEPCPPDTILRQEWMWNEVSKFFRDGD 382
           L +V S            K     P    + TP     P T++ +  + + V K  R   
Sbjct: 439 LPLVESVPERPEWSAQVAKWKQEYPYAYQKETPGSKIKPQTVISK--LSDLVLKSGRPA- 495

Query: 383 IILTETGTAAFGINQS-LFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEIDPSKRVILF 441
           I+ T  G       Q   + +    I+    G++G+   A +GA  A     P   VI  
Sbjct: 496 IVTTGVGQHQMWAAQHWTWKSPRSFITSGGLGTMGYGLPAAIGAQVAR----PDAIVIDI 551

Query: 442 IGDGSLQLTVQEISTLIRWDLKPYLFVLNN 471
            GD S  +T+ E+S+ ++      + +LNN
Sbjct: 552 DGDASFNMTLMELSSAVQARTPVKVLLLNN 581

>Skud_5.76 Chr5 complement(117925..119607) [1683 bp, 560 aa] {ON}
           YEL020C (REAL)
          Length = 560

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 114/508 (22%), Positives = 203/508 (39%), Gaps = 64/508 (12%)

Query: 8   RYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARVKGM 67
           ++  + L +  + T+FG+ G   + L D +    G+++    NE  A+YAA GY  V   
Sbjct: 7   QHFAQLLQRYGIDTVFGIVGIPIVQLADTMV-ANGIKFIPCRNEQAASYAASGYGYVNDK 65

Query: 68  -ACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAK---QLLLHHTLGNGDFT 123
              ++   G G + +L GI  S      +L + G  S S   K   Q L   +L      
Sbjct: 66  PGVLLIVGGPGLIHSLAGIYNSMNNRWPLLVIAGSSSQSDIHKGGFQELDQISL----LY 121

Query: 124 VFHRMSANIS-ETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTH--- 179
            F + +  ++ +   MVT        ++ CI+ T       Y+ +PA+ ++   P     
Sbjct: 122 PFLKFTGKLTPDNVDMVTQ-----KALNHCIQGTAGVS---YIDVPADFIESEKPLEGND 173

Query: 180 --LLETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVIL--ADACAGRHDVKVETNKLI 235
               E P+ LT K    +                +N +I+    A    H+++    +LI
Sbjct: 174 YIANELPMILTPKKCGPDPSQIKEIVQLILHHRDNNILIVIGKGAVKNSHEIR----RLI 229

Query: 236 DMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRN-AVESADLILSVGALLSDFNT 294
           +    P   TPM KG + + +P         L+  + R+ A+++AD++L +GA L+    
Sbjct: 230 NKFNLPFLPTPMAKGIVPDSSP---------LNVSSARSQALKTADVVLVLGARLNWILH 280

Query: 295 GSFSYSYKTKNI-VEFHSDYIKI-RNATFPGVQMKF---VLNKLLAVVGSAVK-----GY 344
              S  +  ++I ++F S+   +  N   PG  +     V   + A++G   +      Y
Sbjct: 281 FGTSPKWNAESIFLQFDSNPETLGDNNASPGADLSVWGDVGLSVTALMGELERQSPRWKY 340

Query: 345 TPVPLPPR----LTPNEPCPPDTILRQEWMWNEVSKFFR----DGDIILTETGTAAFGIN 396
           + V    R    L        + +   +  +++V    R    D   IL   G     I 
Sbjct: 341 SGVNQAMREKIQLNQTRLLEKEKVGGAQLNYHQVYGTLRPLIDDYRTILVTEGANTMDIA 400

Query: 397 QSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEIST 456
           +  FP +     + L      T G  LG + A++       V+L  GD +   +  EI T
Sbjct: 401 RVSFPTDV--PRRRLDAGTNATMGIGLGYALASKASHLELDVVLIQGDSAFGFSAMEIET 458

Query: 457 LIRWDLKPYLFVLNNNGYTIERLIHGPN 484
            +R  L   + V+NN+G     + HG N
Sbjct: 459 AVRCQLALIIVVMNNSG-----IYHGEN 481

>TPHA0G02885 Chr7 complement(616977..619043) [2067 bp, 688 aa] {ON}
          Length = 688

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 68/302 (22%), Positives = 120/302 (39%), Gaps = 28/302 (9%)

Query: 4   LTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYAR 63
           LT G    E + + +V T+FG PG   L + D IY      +    +E  A + A+GYAR
Sbjct: 91  LTGGEIFHEMMKRHNVDTVFGYPGGAILPVYDAIYNSKDFNFVLPRHEQGAGHMAEGYAR 150

Query: 64  VKG-MACIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G   
Sbjct: 151 ASGKCGVVLVTSGPGATNVITPMADALADGVPMVVFTGQVPTAAIGTDAFQEADVIG--- 207

Query: 122 FTVFHRMSANISETTAMVTDIGTAPAEIDRCIR-TTYVTQRPVYLGLP----ANLVDLPV 176
                 +S + ++   MV  +   P  I+      T     PV + LP    A+++  P+
Sbjct: 208 ------ISRSCTKWNVMVKRVEDLPKCINEAFEIATSGRPGPVLVDLPKDVQASILRAPI 261

Query: 177 P--THLLETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVI-----LADACAGRHDVKV 229
           P  T +    +    +    +               A  P++     + +   G   +K 
Sbjct: 262 PIKTTIPSNALKQLTRSAYTQFSEAGIKRAAELINIAKKPILYVGGGILNNPEGPRLIK- 320

Query: 230 ETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALL 289
              +L D  Q P   T    G  D+ +P+   + +G         A+++ADLI++VGA  
Sbjct: 321 ---ELSDRAQIPVTTTLQALGAFDQDDPKSLDM-LGMHGYAPANLAIQNADLIIAVGARF 376

Query: 290 SD 291
            D
Sbjct: 377 DD 378

>YEL020C Chr5 complement(118617..120299) [1683 bp, 560 aa] {ON}
           Protein of unknown function with low sequence identity
           to Pdc1p; mRNA identified as translated by ribosome
           profiling data
          Length = 560

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 123/542 (22%), Positives = 209/542 (38%), Gaps = 74/542 (13%)

Query: 5   TLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANE--LNAAYAADGYA 62
           T  ++  + L +  + T+FG+ G   + L D +    G+++    NE   + A +A GY 
Sbjct: 4   TATQHFAQLLQKYGIDTVFGIVGIPIVQLADTMV-ANGIKFIPCRNEQAASYAASAYGYI 62

Query: 63  RVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAK---QLLLHHTLGN 119
             K    +I   G G + AL GI  S +    +L + G  S S   K   Q L   +L  
Sbjct: 63  SDKPGVLLIVG-GPGLIHALAGIYNSMSNRWPLLVIAGSSSQSDIHKGGFQELDQVSL-- 119

Query: 120 GDFTVFHRMSANIS-ETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPT 178
              + F + +  ++ +   M+T        ++ CI+ T       Y+ +PA+ ++   P 
Sbjct: 120 --LSPFLKFTGKLTPDNIDMITQ-----KALNYCIQGTAGVS---YIDVPADFIEYEKPL 169

Query: 179 H---LLETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLI 235
                    + + L PN                    N  IL     G      E  +L+
Sbjct: 170 EGNDRTGNELPMILTPNICGPDPSKIKKVVQLILQHKNKNILIVIGKGAVKNSHEIRRLV 229

Query: 236 DMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRN-AVESADLILSVGALLSDFNT 294
           +    P   TPM KG + + +P         L+  + R+ A++ AD++L +GA L+    
Sbjct: 230 NTFNLPFLPTPMAKGIVPDSSP---------LNVSSARSQALKIADIVLVLGARLNWILH 280

Query: 295 GSFSYSYKTKNI-VEFHSDYIKI-RNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPR 352
              S  + +++I ++F S+   +  N   PG          L++ G    G +   L   
Sbjct: 281 FGTSPKWNSESIFIQFDSNPETLGDNNVSPGAD--------LSIWGDI--GLSVTALVEE 330

Query: 353 LTPNEPCPPDTILRQEWM----------------------WNEVSKFFR----DGDIILT 386
           LT  + C   + ++QE                        +N+V    R    D   IL 
Sbjct: 331 LTRQDSCWKYSGVKQEIREKIQLNQTRLLRKEKTRGAQLNYNQVYGTLRPLIDDYRTILV 390

Query: 387 ETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEIDPSKRVILFIGDGS 446
             G     I +  FP  T    + L      T G  LG + A +   P   V+L  GD +
Sbjct: 391 TEGANTMDIARISFP--TDAPRRRLDAGTNATMGIGLGYALACKASHPELDVVLIQGDSA 448

Query: 447 LQLTVQEISTLIRWDLKPYLFVLNNNG-YTIERLIHGPNAGYNAIQPWRHTKLLEAFGAN 505
              +  EI T +R  L   + V+NN+G Y  E+ I G        +  R+  + +  GAN
Sbjct: 449 FGFSAMEIETAVRCQLALVIVVMNNSGIYHGEKDIEGDLPPTALSKNCRYDLVGKGLGAN 508

Query: 506 DY 507
           D+
Sbjct: 509 DF 510

>SAKL0D10934g Chr4 (907649..909301) [1653 bp, 550 aa] {ON} similar
           to uniprot|P39994 Saccharomyces cerevisiae YEL020C
           Hypothetical ORF
          Length = 550

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/261 (23%), Positives = 108/261 (41%), Gaps = 30/261 (11%)

Query: 230 ETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRN-AVESADLILSVGAL 288
           E  + +D  Q P   TPM KG + + +P         L+  + R+ A+  AD++L +GA 
Sbjct: 218 EIRRFVDQFQLPFLPTPMAKGVVPDSHP---------LNVSSARSLALRKADVVLLLGAR 268

Query: 289 LSDFNTGSFSYSYKTKNIVEF-HSDYI--KIRNATFPGVQMKFVLNKLLAV--VGSAVKG 343
           L+      F    K K+ V+F   DY   ++ +    G+      +  L++  +GS +  
Sbjct: 269 LNWIL--HFGEPPKWKDTVKFVQFDYTPEELGHNNVAGLNYSLCGDIGLSLEELGSKLHA 326

Query: 344 YTPVPL-----------PPRLTPNEPCPPDTILRQEWMWNEVSKFFRDGDIILTETGTAA 392
           +    L             +L   E      +L    ++  + ++  D + IL   G   
Sbjct: 327 FKYRGLNNAIREKIDTNELKLRGKERETRTALLHYNQVYALMRQYITDDETILVTEGANT 386

Query: 393 FGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEIDPSKRVILFIGDGSLQLTVQ 452
             + +  FP +     + L      T G  LG + AA+  D +K VI   GD +   +  
Sbjct: 387 MDVARISFPTDYP--KRKLDAGTNATMGIGLGYALAAKASDTTKTVICIQGDSAFGFSAM 444

Query: 453 EISTLIRWDLKPYLFVLNNNG 473
           E+ T +R  L   + V+NN+G
Sbjct: 445 ELETAVRCSLPLVVVVMNNSG 465

>Smik_5.87 Chr5 complement(124637..126319) [1683 bp, 560 aa] {ON}
           YEL020C (REAL)
          Length = 560

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 113/508 (22%), Positives = 194/508 (38%), Gaps = 81/508 (15%)

Query: 8   RYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANE--LNAAYAADGYARVK 65
           +Y  E L +  + T+FG+ G   + L D +    G+++    NE   + A +A GY   K
Sbjct: 7   QYFAELLQRYGIDTVFGIVGIPIVQLADTMVS-KGIKFIPCRNEQAASYAASAYGYVNDK 65

Query: 66  GMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAK---QLLLHHTLGNGDF 122
               +I   G G + +L GI  S +    +L + G  S     K   Q L   +L     
Sbjct: 66  PGVLLIVG-GPGLIHSLAGIYNSMSNRWPLLVIAGSSSHGDTHKGGFQELDQVSL----L 120

Query: 123 TVFHRMSANIS-ETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVP---- 177
           + F + +  ++ +   M+T        ++ CI+ T       Y+ +PA+ ++   P    
Sbjct: 121 SPFLKFTGKLAPDNIRMITQ-----KALNHCIQGTAGV---AYIDVPADFIEYEKPLEGN 172

Query: 178 THL-LETPIDLTLKPNDQEAXXXXXXXXXXXXXXASN--PVILADACAGRHDVKVETNKL 234
            H+  E P+ LT      +                +N   VI   A    H+V+    +L
Sbjct: 173 CHIGDELPVILTPNKCGPDPSRIKEVVQLILKNKENNILVVIGKGAVKNSHEVR----RL 228

Query: 235 IDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRN-AVESADLILSVGALLSDFN 293
           I+    P   TPM KG + + +P         L+  + R+ A+++AD++L +GA L+   
Sbjct: 229 INKFNIPFLPTPMAKGIVPDSSP---------LNVSSARSQALKTADIVLVLGARLNWIL 279

Query: 294 TGSFSYSYKTKNI-VEFHSDYIKI-RNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPP 351
               S  + +++I ++F S+   +  N   PG          L+V G    G +   L  
Sbjct: 280 HFGASPKWNSESIFIQFDSNPETLGDNNISPGAD--------LSVWGDI--GLSVTALME 329

Query: 352 RLTPNEPC--------------------------PPDTILRQEWMWNEVSKFFRDGDIIL 385
            +   +PC                             T L    ++  +     D    L
Sbjct: 330 EVVRQDPCWKYSGISQAIQEKIQFNQTRLLKKERTGGTQLNYHQVYGTLRPLIDDYRTFL 389

Query: 386 TETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEIDPSKRVILFIGDG 445
              G     I +  FP N     + L      T G  LG + A +   P   V+L  GD 
Sbjct: 390 VTEGANTMDIARVSFPTN--APKRRLDAGTNATMGVGLGYALACKASHPELDVVLIQGDS 447

Query: 446 SLQLTVQEISTLIRWDLKPYLFVLNNNG 473
           +   +  EI T +R  L   + V+NN+G
Sbjct: 448 AFGFSAMEIETAVRCQLALVIVVMNNSG 475

>KLTH0H14102g Chr8 (1226474..1228129) [1656 bp, 551 aa] {ON} similar
           to uniprot|P39994 Saccharomyces cerevisiae YEL020C
           Hypothetical ORF
          Length = 551

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 105/496 (21%), Positives = 191/496 (38%), Gaps = 70/496 (14%)

Query: 9   YLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARVKGM- 67
           YL E L+   +  +FG+ G   + L D +     +++ G  NE  A+YAA  Y  + G  
Sbjct: 7   YLSELLHGYGITAVFGIVGIPIVELADAMISHGKVKFYGFRNEQAASYAASAYGYLTGRP 66

Query: 68  ACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTVFHR 127
             ++   G G + AL G+  S +    ++ + G    S++            G F    +
Sbjct: 67  GVLLVVGGPGVIHALAGVYNSISNKWPLIVLAGSSEDSNR------------GGFQELDQ 114

Query: 128 MS--ANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPT------- 178
           ++  +   + ++ +++     +  D   +    T    YL +PAN++D  V         
Sbjct: 115 IALLSKYVKYSSRLSNSNVDQSFYDALRQAVLGTPGVSYLDIPANVIDQEVEKNESFSRR 174

Query: 179 HLLETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMT 238
           H+ +    ++ +P D                   +  IL     G  +   +    +D  
Sbjct: 175 HIAK----ISYQPTD-----AALQRVAKLLNANRDKNILCVIGKGATENAQQIRPFVDEF 225

Query: 239 QFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRN-AVESADLILSVGALLSDFNTGSF 297
           Q P   TPM KG + + +          L+  + R+ A++SAD++L +GA L+      F
Sbjct: 226 QLPFLSTPMAKGVVPDSH---------ALNVSSARSLALKSADIVLVLGARLNWIL--HF 274

Query: 298 SYSYKTKN---IVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPV------- 347
             + K KN    ++  +   ++ +    G      L  L   +G+ V   TP+       
Sbjct: 275 GEAPKWKNDAIFIQIDTTAEELGHNNGAG-----TLFSLCGDIGTTVAKLTPLLAGFSGR 329

Query: 348 ----PLPPRLTPNEP------CPPDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQ 397
                L  R+  NE         P   L    ++  + K   D D I+   G     + +
Sbjct: 330 GLFGSLETRIQQNEKRLRARENEPSPALTYNKVYATIRKQIVDKDTIIVSEGANTMDVAR 389

Query: 398 SLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTL 457
             FP +   +   +      T G  LG + AA+   P K VI   GD +   +  E+ T 
Sbjct: 390 ISFPTDYPKLR--MDAGTNATMGVGLGYAIAAKIAHPQKNVIAIQGDSAFGFSGMELETA 447

Query: 458 IRWDLKPYLFVLNNNG 473
            R+ L   + V+NN+G
Sbjct: 448 SRYKLGITVVVMNNSG 463

>AEL055C Chr5 complement(533904..535541) [1638 bp, 545 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL020C
          Length = 545

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 102/506 (20%), Positives = 190/506 (37%), Gaps = 61/506 (12%)

Query: 14  LYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARVKGM-ACIIT 72
           L Q  ++ +FG+ G   + L +K+ E  G+R+    NE + +YAA  Y  +      ++ 
Sbjct: 13  LKQHGIEVVFGIVGIPIVELAEKLAE-HGVRFIACRNEQSCSYAASVYGYLTNKPGALLV 71

Query: 73  TFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTVFH-RMSAN 131
             G G + AL GI  ++     +L + G      +     L        +T F  R+S  
Sbjct: 72  VGGSGVVHALAGIHNAWVNKWPLLVIAGSTEDEYKGGFQELDQLRIVAPWTSFKGRLS-- 129

Query: 132 ISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHLLETPIDLTLKP 191
           +     MV             ++T  +     YL +P  L+++     L   P+D+    
Sbjct: 130 LDNVNYMVYT----------AVKTAVLQHGVSYLDVPGRLINMDAVGPLASKPVDIQHVR 179

Query: 192 NDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETNKLIDMTQFPAFVTPMGKGT 251
           +  ++               +  V++   CA    V       ++  + P    PM KG 
Sbjct: 180 SGPDSSRVQGAAKLLQDGR-NILVVVGRGCAEYPGV---VRSFLERYRLPFLPVPMAKGI 235

Query: 252 IDERNPRFGGVYVGTLSNENVRN-AVESADLILSVGALLS-DFNTGSFSYSYKTKNIVEF 309
           + + +          L+    R+ A++ A+++L +GA L+   + GS          ++ 
Sbjct: 236 VPDSH---------ELNVNGCRSLALKRAEIVLVLGARLNWILHYGSAPKWNADATFIQV 286

Query: 310 HSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNE------------ 357
             D   + +    GV    + +  L +  +A+    P     R   NE            
Sbjct: 287 DRDPATLGHNNSSGVNYSVLSDVELFI--NAITAVLPQSWQYRGVDNEVLDKIRENGVKL 344

Query: 358 ----PCPPDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWG 413
                  P + L    +++ + K   D + IL+  G      ++  F   T    + L  
Sbjct: 345 QRKAQLTPGSPLNYHAVYSLLRKLIDDKNTILSAEGANTMDNSRLWF--GTDYPKRRLDA 402

Query: 414 SIGFTGGAVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNG 473
             G T G  +G + +A+  +P K V+   GD +   +  E+ T +R  +   + V+NN G
Sbjct: 403 GTGATMGLGVGYALSAKLANPDKFVVALEGDSAFGFSCMELETAVRNKVGLVVVVMNNGG 462

Query: 474 YTIERLIHG-PNAGYNAIQPWRHTKL 498
                + HG P +G     P R T L
Sbjct: 463 -----IYHGNPGSG-----PVRTTDL 478

>Kwal_34.16116 s34 complement(208847..210508) [1662 bp, 553 aa] {ON}
           YEL020C - Hypothetical ORF [contig 268] FULL
          Length = 553

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 68/289 (23%), Positives = 113/289 (39%), Gaps = 54/289 (18%)

Query: 223 GRHDVKVETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRN-AVESADL 281
           G  D  +E  K I+  Q P   TPM KG + + +P         L+  + R+ A+ SAD+
Sbjct: 212 GATDSSMEVRKFIERFQLPFLPTPMAKGVVPDSHP---------LNVSSARSLALRSADI 262

Query: 282 ILSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQM---KFVLNKLLAVVG 338
           +L +GA L+               I+ F       +NA F  V     +   N     + 
Sbjct: 263 VLVLGARLN--------------WILHFGEPPKWNQNAIFVQVDTSADELGFNNSAGTLY 308

Query: 339 SAVK--GYTPVPLPPRLTPNEPCPPDTILRQEWMWNEVSKFFRDGDIILTETGTAAFG-- 394
           S+    G T   L P L   + C     + Q+   N+V    ++    LT      +   
Sbjct: 309 SSCGHIGATLQSLTPMLKKFKYCGLSRSMLQQVEQNKVRLRAKETQKTLTLNYNQVYAAM 368

Query: 395 ----INQSLF----PNNTIGISQV----------LWGSIGFTGGAVLGASFAAEEIDPSK 436
               ++++ F      NT+ I++V          L      T G  +G + AA+   P K
Sbjct: 369 REHMVDRNTFIVSEGANTMDIARVSFPTDYPKLRLDAGTNATMGVGIGYAIAAKLAHPEK 428

Query: 437 RVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLIHGPNA 485
            V+   GD +   +  E+ T  R+ L     V+NN+G     + HG ++
Sbjct: 429 SVVCIQGDSAFGFSGLELETASRYQLGIVFVVMNNSG-----IYHGEDS 472

>TBLA0C01560 Chr3 (362966..364714) [1749 bp, 582 aa] {ON} Anc_1.450
           YEL020C
          Length = 582

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 69/325 (21%), Positives = 130/325 (40%), Gaps = 74/325 (22%)

Query: 230 ETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRN-AVESADLILSVGAL 288
           + N+ ++  Q P   TPM KG + + +P         L+    R+ A++++D+I+ +GA 
Sbjct: 230 KINEFVNKFQLPFLPTPMAKGIVPDSHP---------LNVSVARSFALKNSDIIIVIGAR 280

Query: 289 LS-DFNTGSFSYSYKTKNIVEFHSDYIKIRNAT----------------------FPGVQ 325
           L+   + GSF    KTK   +    +I+I N +                         + 
Sbjct: 281 LNWILHFGSFG---KTK--FKPGCQFIQIDNDSEVLGWNNNQGNENCLLSDIGLALDSIS 335

Query: 326 MKFVL-----------NKLLAVVGSAVKGYT-PVPLPPRLTPNEPCPPDTILRQEWMWNE 373
            K  L           NKL   +   ++  T  + L  R   N   P       E ++ +
Sbjct: 336 QKLPLGFKFSKEKQEDNKLSNEIQKIIENNTNKLRLKQRYDHNNGAPS-----YEQVYYK 390

Query: 374 VSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEID 433
           +++   D   IL   G     I +  F  +   + ++  G+   T G  +G + A++   
Sbjct: 391 LNQVINDKQTILVTEGANTMDIARICFQTD-YPLHRLDCGT-NATMGIGIGYAIASKLAV 448

Query: 434 PSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLIHGPNAGYNAIQPW 493
           P K  +L  GD +   +  E+ T+ R+ L   + ++NN+G     + HG N  +N ++P+
Sbjct: 449 PDKLTVLIQGDSAFGFSGMELETISRFKLGIVVIIMNNSG-----IYHG-NEKFNPMEPY 502

Query: 494 -----------RHTKLLEAFGANDY 507
                      R+  + +  G N Y
Sbjct: 503 SNKVTDLTYNCRYDIMAQGLGCNGY 527

>Suva_5.68 Chr5 (108954..110639) [1686 bp, 561 aa] {ON} YEL020C
           (REAL)
          Length = 561

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 113/502 (22%), Positives = 198/502 (39%), Gaps = 62/502 (12%)

Query: 5   TLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANE--LNAAYAADGYA 62
           T+ ++  + L +  + T+FG+ G   + L D +    G+++    NE   + A +A GY 
Sbjct: 4   TVTQHFAQLLQKYGIDTVFGIVGIPIVQLADTMV-ANGVKFIPCRNEQAASYAASAYGYV 62

Query: 63  RVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAK---QLLLHHTLGN 119
             K    +I   G G + +L GI  S +    +L + G  S +   K   Q L   +L  
Sbjct: 63  NDKPGVLLIVG-GPGLIHSLAGIYNSMSNRWPLLVIAGSSSQNDVYKGGFQELDQISL-- 119

Query: 120 GDFTVFHRMSANI-SETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVD----- 173
              + F + +  + S+   MVT        ++ CI+ T       Y+  PA+L++     
Sbjct: 120 --LSPFLKFTGKLTSDNIDMVTR-----KALNHCIQGTMGVS---YIDFPADLIENEKKS 169

Query: 174 LPVPTHLL-ETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDVKVETN 232
           L    HL+ E P+ LT  PN                    +  IL     G      E  
Sbjct: 170 LAGNDHLVNELPMILT--PNKCGPDPSKIEEIVQLILQNRDKNILIVIGKGAVKNSHEIR 227

Query: 233 KLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRN-AVESADLILSVGALLSD 291
           +L+     P   TPM KG + + +P         L+  + R+ A+++AD++L +GA L+ 
Sbjct: 228 RLVSSFNLPFLPTPMAKGIVPDSSP---------LNVSSARSQALKTADIVLVLGARLNW 278

Query: 292 FNTGSFSYSYKTKNI-VEF--HSDYIKIRNATFP---------GVQMKFVLNKL------ 333
                 S  +  +++ ++F  H + +   N +           G+ +  ++ +L      
Sbjct: 279 ILQFGSSPRWNAESVFIQFDSHPETLGDNNTSAGAGLSVWGDIGLSVTALMEELARQRPR 338

Query: 334 --LAVVGSAVKGYTPVPLPPRLTPNEPCPPDTILRQEWMWNEVSKFFRDGDIILTETGTA 391
              + V +A++    V    RL   E       L    ++  +     D   IL   G  
Sbjct: 339 WKYSGVNNALREKIHVN-ETRLQEKEKM-GGAQLNYHQVYGVLRPLIEDYRTILVTEGAN 396

Query: 392 AFGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEIDPSKRVILFIGDGSLQLTV 451
              I +  FP  T      L      T G  LG + A++   P   V+L  GD +   + 
Sbjct: 397 TMDIARVSFP--TDAPRHRLDAGTNATMGIGLGYALASKASRPELDVVLIQGDSAFGFSA 454

Query: 452 QEISTLIRWDLKPYLFVLNNNG 473
            EI T +R  L   + V+NN+G
Sbjct: 455 MEIETAVRCQLALVIVVMNNSG 476

>KNAG0H01580 Chr8 complement(279178..280860) [1683 bp, 560 aa] {ON}
           Anc_1.450 YEL020C
          Length = 560

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 116/565 (20%), Positives = 210/565 (37%), Gaps = 115/565 (20%)

Query: 13  RLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADGYARVKGM-ACII 71
           R Y+VD+  +FG+ G   ++L ++ +   G+R+    NE +A+YAA  Y  + G    ++
Sbjct: 14  RHYEVDL--VFGIVGIPIVTLANE-FITHGIRFVSCRNEQSASYAASAYGYLTGKPGVLL 70

Query: 72  TTFGVGELSALNGI-------------AGS----YAEHVGVLHVVGVPSISSQAKQLLLH 114
              G G + +L G+             AGS    + ++ G    +   S+     +    
Sbjct: 71  VVGGPGLIHSLAGVYNSINNRWPLIVLAGSNDHGHDQYRGAFQELDQISLLKPYVKFSGK 130

Query: 115 HTLGNGDFTVFHRMSANISETTAMV-TDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVD 173
            T GN D  +F   +  +  T  +   DI   P  +        +  + V  G P  L  
Sbjct: 131 LTEGNVDHVLFSAYNIALQGTKGVTYVDI---PGNL--------IETQAVCAGTPGLLPP 179

Query: 174 LPVPT------HLLETPIDLTLKPNDQEAXXXXXXXXXXXXXXASNPVILADACAGRHDV 227
           +P P       H ++    L L+  D++                    +L     G    
Sbjct: 180 VPQPIKCSPDPHTVKRVASLILENRDKK--------------------VLVVVGKGSQGA 219

Query: 228 KVETNKLIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRN-AVESADLILSVG 286
                + ID   FP   TPMGKG + + +          L+  + R+ A+  A ++L +G
Sbjct: 220 FAAVRRFIDEFNFPFLPTPMGKGVVPDEH---------ELNVSSARSYALAHAGIVLIMG 270

Query: 287 ALLSDFNTGSFSYSYKTK---NIVEFHSDY----IKIRNATFPGVQM--------KFVLN 331
           A L+        Y+   K   N V    D     +   N    G+ +        + + N
Sbjct: 271 ARLNWI----LHYAGPPKWNPNAVFIQCDSNGETLGQNNQYHAGLSLFGDIEYTVEALSN 326

Query: 332 KLLAVVGSAVK-GYTPVPLPPRLTPN------------EPCPPDTILRQEWMWNEVSKFF 378
           +L +  G   + G     +  ++  N            E   P  +L    ++  +    
Sbjct: 327 ELRSAGGGDYRYGGLSSSIQEKIHKNEQRLRDSEHAVPEESSPPHVLNYNRVYGIIRPLL 386

Query: 379 RDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAAEEIDPSKR- 437
                +L   G       +  FP +T   S++  G+   T G  LG + AA+    + R 
Sbjct: 387 EQDRTVLVTEGANTMDKARVSFPAST-PFSRLDAGT-NATMGVGLGYAMAAKLSSGAARD 444

Query: 438 VILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLIHGPNAGYNA--IQPWRH 495
           V+L  GD +   +  E+ TL+R+ +   + ++NN+G     + HG   G +    +  R+
Sbjct: 445 VVLIQGDSAFGFSGMELETLVRFQVGVVVMIMNNSG-----IYHGNGVGLSTKLSEQCRY 499

Query: 496 TKLLEAFGANDYENVKITTTGEWQT 520
             +    G   +    + TTGE  T
Sbjct: 500 DVMARGLGCRAH----LVTTGEELT 520

>KAFR0H02890 Chr8 complement(551945..553627) [1683 bp, 560 aa] {ON}
           Anc_1.450 YEL020C
          Length = 560

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 42/92 (45%), Gaps = 7/92 (7%)

Query: 418 TGGAVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIE 477
           T G  LG   A+   +P+   IL  GD +   +  EI TL R+ L   + ++NN+G    
Sbjct: 424 TMGVGLGYLMASRLANPNLDNILIQGDSAFGFSGMEIETLCRFKLGSVIIIMNNSG---- 479

Query: 478 RLIHGP--NAGYNAIQPWRHTKLLEAFGANDY 507
            + HG   N+     +  R+  L +  GA  Y
Sbjct: 480 -IYHGNDVNSATKLGEKTRYDLLAQGLGAKGY 510

>Kpol_1061.50 s1061 (141784..143499) [1716 bp, 571 aa] {ON}
           (141784..143499) [1716 nt, 572 aa]
          Length = 571

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%)

Query: 418 TGGAVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNG 473
           T G  LG + +A+   P K V+L  GD +   +  EI T +R  L   + V+NN+G
Sbjct: 427 TMGVGLGYAISAKLSRPDKTVVLIQGDSAFGFSGMEIETAVRNKLGLIIIVMNNSG 482

>NDAI0G00520 Chr7 complement(112068..113795) [1728 bp, 575 aa] {ON}
           Anc_1.450 YEL020C
          Length = 575

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 80/344 (23%), Positives = 130/344 (37%), Gaps = 60/344 (17%)

Query: 234 LIDMTQFPAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRN-AVESADLILSVGALLSDF 292
            I   QFP   TPMGKG I + +P         L+  + R+ A+  +D++L  GA L+  
Sbjct: 232 FIHKYQFPFLPTPMGKGIISDMDP---------LNVSSARSSALSKSDIVLVFGARLNWL 282

Query: 293 NTGSFSYSYKTKNIVEF---HSDYIKIRNATFPGVQ------MKFVLNKLLAVVGSAVKG 343
               F    K K+ V+F    +D   I N     +       +  ++N+L   +      
Sbjct: 283 --LHFGKPPKWKSTVKFILCDNDPHAIGNNNMQSINYSLLGDIGLIINELTEELDRVENE 340

Query: 344 Y-----TPVPLPPRLTPNE---------PCPPDTILRQEWMWNEVSKFFRDGDIILTETG 389
           +         L   +  N+               +L    ++  + +     +  L   G
Sbjct: 341 WGRKYGVTKELRSEILKNQFKLQEKESRSNTNGALLNYHVVYRTLREMLDLKNTFLVTEG 400

Query: 390 TAAFGINQSLFPNNTIGISQVLWGSIGFTGGAVLGASFAA---EEIDPSKRVILFI-GDG 445
                I +  FP  ++   Q L      T G  LG   AA   ++   SK  IL I GD 
Sbjct: 401 ANTMDIARISFP--SLKPKQRLDAGTNATMGVGLGYGIAARLSQDYMKSKPDILVIQGDS 458

Query: 446 SLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLIHGPNAGYNAIQPW-----------R 494
           +   +  EI T +R+ L   + V+NN+G     + HG       I P+           R
Sbjct: 459 AFGFSAIEIETAVRFKLGLIIIVINNSG-----IYHGTEQS-KKISPYSFPATKLSQKCR 512

Query: 495 HTKLLEAFGANDY--ENVKITTTGEWQTLTQDKQFNEPSKIRMI 536
           +  L    GA+ Y  EN+K   T   ++L   +  +E S I +I
Sbjct: 513 YDLLGIGLGAHGYLVENIKQLQTAFERSLNSARTSSETSVINVI 556

>KNAG0J02370 Chr10 (447825..450698) [2874 bp, 957 aa] {ON} Anc_3.311
           YBR084W
          Length = 957

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 33/76 (43%), Gaps = 6/76 (7%)

Query: 120 GDFTVFHRMSANISETTAMVTDIGTAPAEIDR---CIRTTYVTQRPVYLGLPANLVDLPV 176
            D T + RM    +E  +MV+     PA+I       R   +   P    L   L+ LP+
Sbjct: 65  ADSTTYIRMKQKAAENCSMVSKTEHLPADITEQSLLQRIKIINDDPAVDAL---LIQLPL 121

Query: 177 PTHLLETPIDLTLKPN 192
           P+HL E  I   + PN
Sbjct: 122 PSHLNEERITEAIAPN 137

>CAGL0M03245g Chr13 complement(372122..373810) [1689 bp, 562 aa]
           {ON} similar to uniprot|P39994 Saccharomyces cerevisiae
           YEL020c
          Length = 562

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 28/56 (50%)

Query: 418 TGGAVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNG 473
           T G  LG + AA+   P   ++   GD +   +  EI T +R+ L     ++NN+G
Sbjct: 420 TMGVGLGYAIAAKVHSPELNIVTIQGDSAFGFSGMEIETAVRYRLGIIFIIMNNSG 475

>KNAG0H01500 Chr8 complement(264925..265659) [735 bp, 244 aa] {ON}
           Anc_8.618 YPL121C
          Length = 244

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 37/68 (54%), Gaps = 4/68 (5%)

Query: 274 NAVESADLILSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKL 333
           +++ESA L   VG L+++ +  + +YS KTK +     D IK+  +     + + +++K 
Sbjct: 58  SSIESAVLYKEVGKLVAELDRQTAAYSRKTKEL----QDAIKVMESPEVEAETRALIDKW 113

Query: 334 LAVVGSAV 341
            A+   AV
Sbjct: 114 RAIAQGAV 121

>NCAS0A08420 Chr1 complement(1667102..1668286) [1185 bp, 394 aa]
           {ON} Anc_1.456
          Length = 394

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 5/70 (7%)

Query: 267 LSNENVRNAVESADLILSVGALL---SDFNTGSFSYSYKTKNIVEF--HSDYIKIRNATF 321
             +EN   A E+AD+I + G+LL    D+    F Y    K + E+    D  +  N  F
Sbjct: 229 FDSENFSKAYEAADIIKNSGSLLFKQKDYKNALFKYKKSLKYVNEYIPEPDVDEKNNIKF 288

Query: 322 PGVQMKFVLN 331
             ++MK  LN
Sbjct: 289 LTLKMKLYLN 298

>NCAS0B07970 Chr2 complement(1512368..1512985) [618 bp, 205 aa] {ON}
           
          Length = 205

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 18/89 (20%), Positives = 41/89 (46%)

Query: 98  VVGVPSISSQAKQLLLHHTLGNGDFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTY 157
           +V   +++ +  ++     L  G       + A+ +     +TDI  +  EI   +   Y
Sbjct: 1   MVAFKAVTPKKARVAADEPLEKGVLRFLVSIGASYTTRPEFLTDIVDSTTEIIDTVGNKY 60

Query: 158 VTQRPVYLGLPANLVDLPVPTHLLETPID 186
            + +  YL +  N+ DL + T+++++P D
Sbjct: 61  ESTQFGYLNIKTNVKDLKIKTYVIKSPED 89

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,569,209
Number of extensions: 2535999
Number of successful extensions: 6143
Number of sequences better than 10.0: 140
Number of HSP's gapped: 6033
Number of HSP's successfully gapped: 167
Length of query: 563
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 448
Effective length of database: 40,294,809
Effective search space: 18052074432
Effective search space used: 18052074432
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)