Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0M012406.27ON31431416610.0
NDAI0F017406.27ON31330911661e-161
KAFR0G026506.27ON32130911571e-160
NCAS0H015106.27ON31330911421e-157
CAGL0E02519g6.27ON31530211391e-157
SAKL0E01474g6.27ON31131011061e-152
TBLA0E030606.27ON31931810691e-146
TDEL0G044206.27ON32230910661e-146
ZYRO0C07612g6.27ON31930710501e-143
Kpol_1032.96.27ON31829510401e-142
Smik_15.1686.27ON32728310341e-141
Ecym_30316.27ON32831210321e-140
YOL002C (IZH2)6.27ON31727710291e-140
Skud_15.1606.27ON32727710251e-139
KLLA0D01331g6.27ON30831110231e-139
KLTH0C11044g6.27ON31530310151e-138
Kwal_56.224546.27ON31530610061e-137
Suva_15.1736.27ON3272779971e-135
TPHA0M002906.27ON3273229831e-133
ACL002C6.27ON3292709701e-131
SAKL0C09218g3.90ON3143047611e-100
TPHA0A006403.90ON3273187621e-99
KLTH0C09504g3.90ON3192897426e-97
Kwal_56.227043.90ON3203097383e-96
ZYRO0B06556g3.90ON3183147349e-96
Skud_4.7663.90ON3162877322e-95
TDEL0D053403.90ON3163117322e-95
YDR492W (IZH1)3.90ON3162747303e-95
CAGL0G04631g3.90ON3162917295e-95
Smik_4.7693.90ON3162817252e-94
Suva_2.6683.90ON3153117225e-94
NDAI0A071603.90ON3302937132e-92
Kpol_1053.263.90ON3242767123e-92
NCAS0I025703.90ON3142916889e-89
KLLA0C12441g3.90ON3152876871e-88
KAFR0A081303.90ON3192886872e-88
AFR337W3.90ON3173096853e-88
Ecym_35883.90ON3052806694e-86
TBLA0B022903.90ON3262886445e-82
KNAG0K021603.90ON3233236281e-79
TBLA0B082553.90ON2962904416e-52
NCAS0C049203.90ON3262764167e-48
NDAI0G043003.90ON3182913801e-42
CAGL0I07491g3.90ON3012932672e-26
Suva_15.643.90ON3123032182e-19
Skud_15.533.90ON3123002164e-19
Smik_15.563.90ON3123102147e-19
YOL101C (IZH4)3.90ON3122462014e-17
KAFR0J006705.197ON5092322028e-17
KLLA0F15510g5.197ON6222771814e-14
Kpol_2002.945.197ON5772351815e-14
AAL153C5.197ON4192591716e-13
TBLA0C060505.197ON4372341717e-13
TPHA0E031205.197ON5692361664e-12
NDAI0I023305.197ON5782381576e-11
KNAG0B051005.197ON5382401532e-10
YLR023C (IZH3)5.197ON5432351522e-10
KLTH0B03498g5.197ON5462421503e-10
Smik_12.865.197ON5422351433e-09
Skud_12.915.197ON5422351371e-08
ZYRO0B10538g5.197ON5312411362e-08
NCAS0D026005.197ON5432371362e-08
TDEL0E043205.197ON4502391343e-08
Kwal_33.151225.197ON5662411344e-08
Suva_10.1045.197ON5412361282e-07
Ecym_71095.197ON5682341264e-07
CAGL0D03322g5.197ON5452411246e-07
SAKL0G12980g5.197ON5632441246e-07
KNAG0K006703.90ON3212981085e-05
ZYRO0A10274g5.113ON200192810.17
NCAS0A074405.113ON200796800.23
Smik_15.893.149ON45147712.2
Suva_15.963.149ON45147712.3
Skud_15.833.149ON45146693.6
KNAG0F03480singletonON548130694.1
YOL069W (NUF2)3.149ON45147668.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0M01240
         (314 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.2...   644   0.0  
NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27      453   e-161
KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON...   450   e-160
NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON...   444   e-157
CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {O...   443   e-157
SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar...   430   e-152
TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27...   416   e-146
TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON...   415   e-146
ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {O...   409   e-143
Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON} (22700..2...   405   e-142
Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {O...   402   e-141
Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to A...   402   e-140
YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}  ...   400   e-140
Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {O...   399   e-139
KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar...   398   e-139
KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {O...   395   e-138
Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C...   392   e-137
Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {O...   388   e-135
TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27 ...   383   e-133
ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON} Sy...   378   e-131
SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar...   297   e-100
TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON...   298   e-99 
KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {O...   290   6e-97
Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W...   288   3e-96
ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar...   287   9e-96
Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W...   286   2e-95
TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90...   286   2e-95
YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membr...   285   3e-95
CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar...   285   5e-95
Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W...   283   2e-94
Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W...   282   5e-94
NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {...   279   2e-92
Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON...   278   3e-92
NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON...   269   9e-89
KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa] ...   269   1e-88
KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3....   269   2e-88
AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic h...   268   3e-88
Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar ...   262   4e-86
TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON...   252   5e-82
KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.9...   246   1e-79
TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}             174   6e-52
NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {...   164   7e-48
NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90    150   1e-42
CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {O...   107   2e-26
Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON...    89   2e-19
Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON} ...    88   4e-19
Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON} ...    87   7e-19
YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}  ...    82   4e-17
KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5....    82   8e-17
KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some...    74   4e-14
Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON} (2295...    74   5e-14
AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON} Syn...    70   6e-13
TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON} Anc_5...    70   7e-13
TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {O...    69   4e-12
NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197     65   6e-11
KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.1...    64   2e-10
YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON} ...    63   2e-10
KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {...    62   3e-10
Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {O...    60   3e-09
Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {O...    57   1e-08
ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {...    57   2e-08
NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.1...    57   2e-08
TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {O...    56   3e-08
Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023...    56   4e-08
Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {...    54   2e-07
Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}...    53   4e-07
CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {...    52   6e-07
SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]...    52   6e-07
KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {O...    46   5e-05
ZYRO0A10274g Chr1 (828154..834159) [6006 bp, 2001 aa] {ON} simil...    36   0.17 
NCAS0A07440 Chr1 (1471149..1477172) [6024 bp, 2007 aa] {ON} Anc_...    35   0.23 
Smik_15.89 Chr15 (163208..164563) [1356 bp, 451 aa] {ON} YOL069W...    32   2.2  
Suva_15.96 Chr15 (171608..172963) [1356 bp, 451 aa] {ON} YOL069W...    32   2.3  
Skud_15.83 Chr15 (158051..159406) [1356 bp, 451 aa] {ON} YOL069W...    31   3.6  
KNAG0F03480 Chr6 complement(657351..658997) [1647 bp, 548 aa] {O...    31   4.1  
YOL069W Chr15 (198942..200297) [1356 bp, 451 aa] {ON}  NUF2Compo...    30   8.7  

>KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.27
           YOL002C
          Length = 314

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/314 (100%), Positives = 314/314 (100%)

Query: 1   MSSRVQRQTVTITEPVVYEDDGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGYVRET 60
           MSSRVQRQTVTITEPVVYEDDGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGYVRET
Sbjct: 1   MSSRVQRQTVTITEPVVYEDDGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGYVRET 60

Query: 61  NSFLKCVHSLFYLHNESVNVYSHLIPALCFFSVLFLNKYCVKSFETTSLVDYLFIDLFFL 120
           NSFLKCVHSLFYLHNESVNVYSHLIPALCFFSVLFLNKYCVKSFETTSLVDYLFIDLFFL
Sbjct: 61  NSFLKCVHSLFYLHNESVNVYSHLIPALCFFSVLFLNKYCVKSFETTSLVDYLFIDLFFL 120

Query: 121 GAFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFF 180
           GAFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFF
Sbjct: 121 GAFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFF 180

Query: 181 SFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRI 240
           SFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRI
Sbjct: 181 SFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRI 240

Query: 241 QIKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVS 300
           QIKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVS
Sbjct: 241 QIKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVS 300

Query: 301 YELVHKGLSSATKA 314
           YELVHKGLSSATKA
Sbjct: 301 YELVHKGLSSATKA 314

>NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27
          Length = 313

 Score =  453 bits (1166), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 215/309 (69%), Positives = 250/309 (80%), Gaps = 1/309 (0%)

Query: 1   MSSRVQRQTVTITEPVVYEDDGGE-MKTATKKITKRIYTWNEIPEWQKDNEHIIDGYVRE 59
           +  R    T T+ E ++   D G+ ++   +K+  ++Y W+EIPEWQKDNEHII GYVRE
Sbjct: 5   IQKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVRE 64

Query: 60  TNSFLKCVHSLFYLHNESVNVYSHLIPALCFFSVLFLNKYCVKSFETTSLVDYLFIDLFF 119
           TNSF  C+HSLFY+HNES NVYSHL+P + FF  + LNKY +  + TTS+VDYL IDLFF
Sbjct: 65  TNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLFF 124

Query: 120 LGAFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYF 179
            GAF CLILSS FHCFKSHSLKVAT GNKLDYLGIV+LIVTSMISI+Y+GF+D+ + FYF
Sbjct: 125 FGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPLFFYF 184

Query: 180 FSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHR 239
           FS +T  FG AC  VSLKDHFRSREWRPYRAGLFVAFGLSAILPIL+G F YGIEE F R
Sbjct: 185 FSSLTFLFGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFIR 244

Query: 240 IQIKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMV 299
           IQ+KWIILEG FYI GAFLYG+RFPEK  PG +DIWGHSHQ+FHILVVVAA CHL+GL+ 
Sbjct: 245 IQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLLS 304

Query: 300 SYELVHKGL 308
           SYE+VH  L
Sbjct: 305 SYEIVHSRL 313

>KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON}
           Anc_6.27 YOL002C
          Length = 321

 Score =  450 bits (1157), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 214/309 (69%), Positives = 251/309 (81%), Gaps = 5/309 (1%)

Query: 1   MSSRVQRQTVTITEPVVYED----DGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGY 56
           +SSR +R T  +T    ++D    + GE   + +KI + +Y WNEIP+WQKDNEHII GY
Sbjct: 2   ISSRPKRSTRKVTIDTAFQDVVEQNKGETIRSLEKIIQ-LYNWNEIPDWQKDNEHIISGY 60

Query: 57  VRETNSFLKCVHSLFYLHNESVNVYSHLIPALCFFSVLFLNKYCVKSFETTSLVDYLFID 116
           V+ETNSF  C+ SLFYLHNESVNVYSHLIPA+CF     LNK  V  F TT+++DYL+ID
Sbjct: 61  VKETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLMTSLLNKTIVPKFRTTTVLDYLYID 120

Query: 117 LFFLGAFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVM 176
           LFFLGAFTCLILSSTFHCFKSHSL++ATFGNKLDYLGIVVLI TSMIS+LYYGFYD+  +
Sbjct: 121 LFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSL 180

Query: 177 FYFFSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEA 236
           FY F+F+TLSFG AC  VSLKD FRSRE R YRA LFV FGLSA+LP++ G++ YG    
Sbjct: 181 FYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNT 240

Query: 237 FHRIQIKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKG 296
           +HRIQ+KW++LEGVFYI GAFLYGIRFPEK +PGKYDIWGHSHQ+FHILVV+AALCH K 
Sbjct: 241 WHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKA 300

Query: 297 LMVSYELVH 305
           LM SYE VH
Sbjct: 301 LMCSYEHVH 309

>NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON}
           Anc_6.27
          Length = 313

 Score =  444 bits (1142), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 212/309 (68%), Positives = 249/309 (80%), Gaps = 1/309 (0%)

Query: 1   MSSRVQRQTVTITEPVVYEDDGGEMKTATKKIT-KRIYTWNEIPEWQKDNEHIIDGYVRE 59
           +  RV   + + +     +DD   +K   K  T +++YTW+EIPEWQKDNEHII GYVRE
Sbjct: 5   LQQRVALTSTSTSTKTTIDDDNVSIKHTKKTTTIRKLYTWDEIPEWQKDNEHIIAGYVRE 64

Query: 60  TNSFLKCVHSLFYLHNESVNVYSHLIPALCFFSVLFLNKYCVKSFETTSLVDYLFIDLFF 119
           TNSF +C  SLFY+HNE+ NVYSHL+P + FF  +  +KY + SFETT+  DYL I+LFF
Sbjct: 65  TNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTMLFDKYAIVSFETTTFTDYLIINLFF 124

Query: 120 LGAFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYF 179
           LGAFTCLILSSTFHCFKSHSLK+ATFGNKLDYLGIVVLIVTSMISIL+YGFYD+   FY 
Sbjct: 125 LGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIVVLIVTSMISILFYGFYDNGPFFYG 184

Query: 180 FSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHR 239
           FS +TLSFG+AC +VSLKD FRSREWRPYRAGLFVAFGLSA+LPIL+G+  YG  E + R
Sbjct: 185 FSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVAFGLSAVLPILTGVMYYGPHETWTR 244

Query: 240 IQIKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMV 299
           IQ+KW++LEGVFYI GAFLYGIRFPEK   G +DIWGHSHQ+FH+LVVVAA CHLK L+ 
Sbjct: 245 IQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDIWGHSHQIFHLLVVVAAFCHLKALLG 304

Query: 300 SYELVHKGL 308
           SYELVH  L
Sbjct: 305 SYELVHMNL 313

>CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002c
          Length = 315

 Score =  443 bits (1139), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 206/302 (68%), Positives = 247/302 (81%), Gaps = 2/302 (0%)

Query: 4   RVQRQTVTITEPVVYEDDGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGYVRETNSF 63
           +V     T  +P++  D  G++K   K + +++YTW EIPEWQKDNEHI  GYVRET+S 
Sbjct: 8   KVATMVTTEEQPLIGTD--GQIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRETSSV 65

Query: 64  LKCVHSLFYLHNESVNVYSHLIPALCFFSVLFLNKYCVKSFETTSLVDYLFIDLFFLGAF 123
           ++C+ SLFYLHNE+VN+YSHLIPA+ FFS +F NKY V ++ TT+L+DYL ID+FFLGAF
Sbjct: 66  MECIRSLFYLHNETVNIYSHLIPAIAFFSTIFFNKYVVPTYSTTTLIDYLIIDIFFLGAF 125

Query: 124 TCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFV 183
           +CLILSSTFHC KSHSL+VA FGNKLDYLGIV LIV SM+SILYYGF+ +   F  FS +
Sbjct: 126 SCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIFSLI 185

Query: 184 TLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQIK 243
           T++FG AC VVSLKD FRSREWRPYRA LFV FGLSA+LPIL+G+F YG  E + RIQ+K
Sbjct: 186 TMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRIQLK 245

Query: 244 WIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYEL 303
           W+ILEGVFYI GAFLYGIRFPEK SPG +D+WGHSHQ+FHILVVVAALCHLK L+ SY L
Sbjct: 246 WVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLGSYSL 305

Query: 304 VH 305
           VH
Sbjct: 306 VH 307

>SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 311

 Score =  430 bits (1106), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 196/310 (63%), Positives = 244/310 (78%)

Query: 1   MSSRVQRQTVTITEPVVYEDDGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGYVRET 60
           M     R+ + I    + +++     T  KK  +R+Y+W EIP+WQKDNEHI  GYVRET
Sbjct: 1   MEPEPNRRRLQIKRANIVKEETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRET 60

Query: 61  NSFLKCVHSLFYLHNESVNVYSHLIPALCFFSVLFLNKYCVKSFETTSLVDYLFIDLFFL 120
           NSFL C  SLFY+HNESVN+Y+HL+P LCFF V+  +K  +K F+TT+ +DY+ +DLFFL
Sbjct: 61  NSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLFDKVAIKVFDTTTFLDYIMVDLFFL 120

Query: 121 GAFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFF 180
           GAFTCLILSSTFHC K+HSL++A  GNKLDYLGIV LIV+SMISI+YYGF+DS   FY F
Sbjct: 121 GAFTCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGF 180

Query: 181 SFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRI 240
           S +TL FG AC + SL D FRSREWRPYRA LFVAFGLSA+LPI SG+  YG +E + ++
Sbjct: 181 STLTLVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKV 240

Query: 241 QIKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVS 300
           Q+KW++L GVFYI+GA LY +R PE+ SPGK+DIWGHSHQ+FHILVV+AALCHLK ++ S
Sbjct: 241 QVKWVLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNS 300

Query: 301 YELVHKGLSS 310
           YELVHK L+S
Sbjct: 301 YELVHKKLAS 310

>TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27
           YOL002C
          Length = 319

 Score =  416 bits (1069), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 197/318 (61%), Positives = 245/318 (77%), Gaps = 5/318 (1%)

Query: 1   MSSRVQRQTVTITEP----VVYEDDGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGY 56
           M + VQR+ +T +      ++Y D+  ++ T+     KR+YTW+EIP WQ DNE+I  GY
Sbjct: 1   MVTEVQRRKLTSSTEEGVELLYGDNQQQLNTSGSS-GKRLYTWDEIPVWQHDNEYIYTGY 59

Query: 57  VRETNSFLKCVHSLFYLHNESVNVYSHLIPALCFFSVLFLNKYCVKSFETTSLVDYLFID 116
           VRETNS  +   SLFY+HNESVN+Y+HLIPA CF S+L  N Y VK   TT+  DY+ ID
Sbjct: 60  VRETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDYVAID 119

Query: 117 LFFLGAFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVM 176
           LFF+GAFTCL LSSTFHCFKSHSLK++ FGNKLDYLGIV+LI TS+IS+LY+G++D   +
Sbjct: 120 LFFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYLGIVILISTSLISVLYFGYHDDPFI 179

Query: 177 FYFFSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEA 236
           FY FS +TL FG ACG+ SLKD FR+REWRPYRA LFV FGLS +LPI++G+  YGI E 
Sbjct: 180 FYIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREV 239

Query: 237 FHRIQIKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKG 296
           F R+Q+KWII EGV YI GAFLYG RFPEK  PGK DIWG SHQ+FH+LVV+AALCHL+G
Sbjct: 240 FERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRG 299

Query: 297 LMVSYELVHKGLSSATKA 314
           L+ SYELVH+ L +  ++
Sbjct: 300 LIGSYELVHQKLDAQLQS 317

>TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON}
           Anc_6.27 YOL002C
          Length = 322

 Score =  415 bits (1066), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 191/309 (61%), Positives = 240/309 (77%)

Query: 3   SRVQRQTVTITEPVVYEDDGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGYVRETNS 62
           S    QT T+T+        G+      K  +++YTW+EIP WQ+DNEHI+ GYV ET S
Sbjct: 12  SLTTDQTSTVTKEETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEHILSGYVGETRS 71

Query: 63  FLKCVHSLFYLHNESVNVYSHLIPALCFFSVLFLNKYCVKSFETTSLVDYLFIDLFFLGA 122
             +C  SLFYLHNESVN+Y+HL+P + F  VL  +K+ V  FETT+L+DY+ IDLF L +
Sbjct: 72  MFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFDKFAVTQFETTTLIDYVMIDLFSLVS 131

Query: 123 FTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSF 182
           FTCL LSS FHC K+HS  VATFGNKLDYLGIVVL+VTSM+SI+YYGF+++  +FY FSF
Sbjct: 132 FTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFSF 191

Query: 183 VTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQI 242
           +T +FG AC VVSLK+ FR+REWRPYRA +FVAFGLSA+LPI++G+F YG  E + RIQ+
Sbjct: 192 ITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQV 251

Query: 243 KWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYE 302
           KW++L G+FYI GA LYG+RFPEK +PGKYDIWGHSHQ+FH+LVVVAALCHL GL+ SY 
Sbjct: 252 KWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHVLVVVAALCHLYGLIKSYN 311

Query: 303 LVHKGLSSA 311
           LVH  ++ A
Sbjct: 312 LVHLKMAIA 320

>ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  409 bits (1050), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 190/307 (61%), Positives = 234/307 (76%), Gaps = 13/307 (4%)

Query: 6   QRQTVTITEPVVYEDDGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGYVRETNSFLK 65
           Q QT    EPV            T+K  K +YTWNEIP+WQKDNEHI+ GYVRETNS  +
Sbjct: 25  QEQTTIKIEPV-----------NTQK--KLLYTWNEIPDWQKDNEHIVGGYVRETNSIRE 71

Query: 66  CVHSLFYLHNESVNVYSHLIPALCFFSVLFLNKYCVKSFETTSLVDYLFIDLFFLGAFTC 125
           C+ SL YLHNES+N+Y+H +P LCF +    +K+ +K+F+TT+ +DY+ ID FF GAF+C
Sbjct: 72  CLQSLLYLHNESINIYTHFLPGLCFLATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSC 131

Query: 126 LILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTL 185
           LILSSTFHCFKSHS +V+ FGNKLDYLGIV+LIV SMISILYY F+DS+ +FY F+ +  
Sbjct: 132 LILSSTFHCFKSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIF 191

Query: 186 SFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWI 245
            FG +C + S  D FRSREWRPYRAGLFVAFGLSA+LPI+ G+  YG  E + RIQ+KW+
Sbjct: 192 CFGVSCTIASFDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWV 251

Query: 246 ILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYELVH 305
           ILEG+FYI GAFLY IRFPE+ +PG +D  GHSHQ+FH+LVV+AALCHL  LM SYELVH
Sbjct: 252 ILEGIFYIFGAFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVH 311

Query: 306 KGLSSAT 312
             L S +
Sbjct: 312 TNLLSNS 318

>Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON}
           (22700..23656) [957 nt, 319 aa]
          Length = 318

 Score =  405 bits (1040), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 181/295 (61%), Positives = 234/295 (79%)

Query: 19  EDDGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNESV 78
           E DG +   +  K   ++ TW  +P+WQKDNEHI+ GYV+ETNS   C+HSL ++HNESV
Sbjct: 24  EKDGAKSSYSYIKRGVQLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESV 83

Query: 79  NVYSHLIPALCFFSVLFLNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSH 138
           N++SHL+PA CF + +  +KY V+ + TT+L DYL +DLF  GAFTCL++SS FHC K+H
Sbjct: 84  NIFSHLVPAFCFMTTIIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAH 143

Query: 139 SLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKD 198
           S  V++FGNKLDYLGIVVLIV+SM SILYYGFYD+S +++ FS +T +FG +C VVSL +
Sbjct: 144 SPYVSSFGNKLDYLGIVVLIVSSMSSILYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGE 203

Query: 199 HFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGAFL 258
            FR+REWRPYRA +FVAFGLSA+LPI +G   YG++E   R+Q+KW++LEGVFYI GA L
Sbjct: 204 RFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALL 263

Query: 259 YGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYELVHKGLSSATK 313
           YG+RFPE+  PG +DIWGHSHQ+FHILVVVAALCHL+GL+ SY +VH  LSS T+
Sbjct: 264 YGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRLSSLTQ 318

>Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  402 bits (1034), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 183/283 (64%), Positives = 233/283 (82%)

Query: 29  TKKITKRIYTWNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNESVNVYSHLIPAL 88
            KK+ KR+Y+W+EIPEWQ+DN+ I+ GYVRET+SF++   SLFYLHNESVN+YSHL+PAL
Sbjct: 42  AKKVLKRLYSWDEIPEWQRDNDFILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPAL 101

Query: 89  CFFSVLFLNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHSLKVATFGNK 148
            FF+VL L+K  +K FETT+  D++ IDLF+ GAF CLILSS+FHC KSHSL++AT GNK
Sbjct: 102 GFFTVLLLDKSTIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNK 161

Query: 149 LDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPY 208
           LDYLGI +LIVTSM+SIL+YG+Y+   +F  F+ +T+SFG AC +VSLKD FR REWRPY
Sbjct: 162 LDYLGICILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPY 221

Query: 209 RAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGAFLYGIRFPEKGS 268
           RAGLFV FGLS+I+PI SG++ Y   E + +IQ+ W++L GV YI+GA LYG+RFPEK  
Sbjct: 222 RAGLFVCFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVC 281

Query: 269 PGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYELVHKGLSSA 311
           PGK+DIWGHSHQ+FH LVV+A+LCHL+GL+ SYELVH  + S 
Sbjct: 282 PGKFDIWGHSHQLFHFLVVIASLCHLRGLLNSYELVHIKMESG 324

>Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to
           Ashbya gossypii ACL002C
          Length = 328

 Score =  402 bits (1032), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 187/312 (59%), Positives = 238/312 (76%), Gaps = 1/312 (0%)

Query: 2   SSRVQRQTVTITEPVVYEDDGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGYVRETN 61
           +S +  +  T+   V++ED   +  T   K   ++++W+EIPEWQ+DNEHI+ GYV+ETN
Sbjct: 15  TSSLAGKNRTLETSVIFEDLN-QATTIPLKPASKLFSWHEIPEWQRDNEHILGGYVKETN 73

Query: 62  SFLKCVHSLFYLHNESVNVYSHLIPALCFFSVLFLNKYCVKSFETTSLVDYLFIDLFFLG 121
           SF + +HSL YLHNESVN+Y+HLIP +CFF VLFLNKY +  F+TT+  DY  ID FF+G
Sbjct: 74  SFKETLHSLLYLHNESVNIYTHLIPGVCFFCVLFLNKYVISRFKTTTWKDYAIIDTFFVG 133

Query: 122 AFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFS 181
           AF CL++S T+HC KSHS  V+  GN+LDY+GIV+LI TSM S+LYYGFY+SS MFY FS
Sbjct: 134 AFACLVMSGTYHCLKSHSYPVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFS 193

Query: 182 FVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQ 241
            VTL  GT C VV+L   FRSR WRPYRA +FVAFGLS+ILPIL+ +  YG EE ++ +Q
Sbjct: 194 GVTLLLGTICTVVTLDSRFRSRLWRPYRASIFVAFGLSSILPILASILYYGSEETWNSVQ 253

Query: 242 IKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSY 301
           + WIILEGV YI GAF+YGIRFPE  +PG +DIWGHSHQ+FH+LVV+AALCH K +  SY
Sbjct: 254 LGWIILEGVLYIFGAFIYGIRFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSY 313

Query: 302 ELVHKGLSSATK 313
           ELVH  L+ A +
Sbjct: 314 ELVHFRLNEAVQ 325

>YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}
           IZH2Plasma membrane protein involved in zinc homeostasis
           and osmotin-induced apoptosis; transcription regulated
           by Zap1p, zinc and fatty acid levels; similar to
           mammalian adiponectins; deletion increases sensitivity
           to elevated zinc
          Length = 317

 Score =  400 bits (1029), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 181/277 (65%), Positives = 231/277 (83%)

Query: 29  TKKITKRIYTWNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNESVNVYSHLIPAL 88
            KK+ +R+Y+W+EIPEWQ+DN+ I+ GYV+ET+SF++   SLFYLHNESVN+YSHLIPAL
Sbjct: 32  AKKVLRRLYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPAL 91

Query: 89  CFFSVLFLNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHSLKVATFGNK 148
            FF+VL L+K  +K F TT+ +D++ IDLF+ GAF CLILSS+FHC KSHSL++AT GNK
Sbjct: 92  GFFTVLLLDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNK 151

Query: 149 LDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPY 208
           LDYLGI +LIVTSM+SILYYG+++   +F  F+ +T+SFG AC +VSLKD FR REWRPY
Sbjct: 152 LDYLGICILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPY 211

Query: 209 RAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGAFLYGIRFPEKGS 268
           RAGLFV FGLS+I+PI SG++ Y   E + +IQ+ W++L GV YI+GA LYG+RFPEK  
Sbjct: 212 RAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKIC 271

Query: 269 PGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYELVH 305
           PGK+DIWGHSHQ+FH LVV+AALCHL+GL+ SYELVH
Sbjct: 272 PGKFDIWGHSHQLFHFLVVIAALCHLRGLLNSYELVH 308

>Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  399 bits (1025), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 181/277 (65%), Positives = 229/277 (82%)

Query: 29  TKKITKRIYTWNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNESVNVYSHLIPAL 88
            KK+ KR+Y+W+EIPEWQ+DN++I+ GYVRET SF++   SLFY+HNESVN+YSHLIPAL
Sbjct: 42  AKKVLKRLYSWDEIPEWQRDNDYILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPAL 101

Query: 89  CFFSVLFLNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHSLKVATFGNK 148
            FF+VL L+K  +K FETT+  D++ IDLF+ GAF CLILSS+FHC KSHSL++AT GNK
Sbjct: 102 GFFTVLLLDKSTIKVFETTTWKDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNK 161

Query: 149 LDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPY 208
           LDYLGI +LIVTSM SILYYG+Y+   +F  F+ +T+SFG AC +V+LKD FR REWRPY
Sbjct: 162 LDYLGICILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPY 221

Query: 209 RAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGAFLYGIRFPEKGS 268
           RAGLFV FGLS+I+PI SG++ Y   E + +IQ+ W++L GV YI+GA LYG+RFPEK  
Sbjct: 222 RAGLFVCFGLSSIVPIFSGLYCYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVC 281

Query: 269 PGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYELVH 305
           PGK+DIWGHSHQ+FH LVV+A+ CHL+GL+ SYELVH
Sbjct: 282 PGKFDIWGHSHQLFHFLVVIASFCHLRGLLNSYELVH 318

>KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 308

 Score =  398 bits (1023), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 190/311 (61%), Positives = 240/311 (77%), Gaps = 4/311 (1%)

Query: 1   MSSRVQRQTVTITEPVVYEDDGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGYVRET 60
           MS+R  +++V   E  + E+  G  KT  +   +R+Y+W+EIP+WQKDNEHI+ GYVRET
Sbjct: 1   MSTR--KRSVVTEETALIEETPGTKKTV-RVYERRVYSWDEIPDWQKDNEHILHGYVRET 57

Query: 61  NSFLKCVHSLFYLHNESVNVYSHLIPALC-FFSVLFLNKYCVKSFETTSLVDYLFIDLFF 119
            S+ +  HSLFYLHNESVN+Y+HLIPA+  FF +LF   + +  + TTS +DY  I+LFF
Sbjct: 58  QSWKELFHSLFYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFF 117

Query: 120 LGAFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYF 179
            G  TCL +SS FH  K HSL +ATFGNKLDYLGIVVLI TSMISIL+YGF+DSS++FY 
Sbjct: 118 FGCATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYP 177

Query: 180 FSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHR 239
           F+ +T  FG  CG +SLKD FRSREWRPYRA +FV FGLSA+ PI++G   YG +E + R
Sbjct: 178 FAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKR 237

Query: 240 IQIKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMV 299
           +Q+ W+I EGV YI GAFLYG+RFPE+ +PGK+DIWGHSHQ+FH+LVVVAALCHLK L+V
Sbjct: 238 VQLTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHSHQLFHVLVVVAALCHLKALVV 297

Query: 300 SYELVHKGLSS 310
           SY LVH+ LS 
Sbjct: 298 SYGLVHQALSQ 308

>KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  395 bits (1015), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 180/303 (59%), Positives = 237/303 (78%), Gaps = 3/303 (0%)

Query: 6   QRQTVTIT-EPVVYEDDGGEMKTAT--KKITKRIYTWNEIPEWQKDNEHIIDGYVRETNS 62
           QR+ V +     + E++   +K +   ++  +R+YTW+EIPEWQ+DNEHI+ GY+ ET S
Sbjct: 8   QRKPVEVELHHRMVEENSSLLKDSNLKQRTKRRLYTWDEIPEWQRDNEHIVGGYILETKS 67

Query: 63  FLKCVHSLFYLHNESVNVYSHLIPALCFFSVLFLNKYCVKSFETTSLVDYLFIDLFFLGA 122
             +C+ SL YLHNESVN+Y+HL+P  CF  V   N+  ++ FETT L+DY+ IDLFFLG 
Sbjct: 68  TWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMIDLFFLGG 127

Query: 123 FTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSF 182
           FTCL++SS FHCFK HSL VA  GNKLDYLGIV L+VTS++SIL+YGF+D  + F+ FS 
Sbjct: 128 FTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSG 187

Query: 183 VTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQI 242
           +T++FG AC  VSL + FRSREWRPYRA LFVAFGLSA+LP+++G   YG++E + RIQ+
Sbjct: 188 LTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQL 247

Query: 243 KWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYE 302
           +W++L GVFYILGA LYGIRFPE+ +PG +DIWGHSHQ+FHILVVVAALCHL+ L+ +Y+
Sbjct: 248 EWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYK 307

Query: 303 LVH 305
           L H
Sbjct: 308 LFH 310

>Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C -
           Hypothetical ORF [contig 185] FULL
          Length = 315

 Score =  392 bits (1006), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 175/306 (57%), Positives = 234/306 (76%), Gaps = 3/306 (0%)

Query: 6   QRQTVTITEPVVYEDDGGEMKTATK---KITKRIYTWNEIPEWQKDNEHIIDGYVRETNS 62
           +R+ V I    V  ++   +   ++   +  +R+Y W+EIPEWQKDNEHI++GY+ ET S
Sbjct: 8   KRKAVGIEPEGVMTEETTTLLNGSRIEERTRRRLYKWDEIPEWQKDNEHILNGYILETKS 67

Query: 63  FLKCVHSLFYLHNESVNVYSHLIPALCFFSVLFLNKYCVKSFETTSLVDYLFIDLFFLGA 122
              C+ SL YLHNESVN+Y+HLIP  CF  +   N+  ++ +ETT ++DY+ IDLFFLG 
Sbjct: 68  VGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGG 127

Query: 123 FTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSF 182
           FTCL++SSTFHCFK HSL VA  GNKLDYLGIV L+VTSM+SIL+YGF+D+++ FY FS 
Sbjct: 128 FTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSG 187

Query: 183 VTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQI 242
           +T+ FG AC +VSL D FRSR+WRPYRA LFVAFGLSA+ P+++G+  YG +  + RIQ+
Sbjct: 188 LTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQL 247

Query: 243 KWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYE 302
           KW+ LEGVFYILGA LYG+RFPE+ +PG +DIWG SHQ+FH+LVV+AA CHL+ L+ +Y+
Sbjct: 248 KWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYK 307

Query: 303 LVHKGL 308
            VH  +
Sbjct: 308 WVHSQM 313

>Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  388 bits (997), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 179/277 (64%), Positives = 230/277 (83%)

Query: 29  TKKITKRIYTWNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNESVNVYSHLIPAL 88
            KK+ KR+Y+W+EIPEWQ+DN++I+ GYV+ET+SF+    SLFY+HNESVN+YSHLIPA+
Sbjct: 42  AKKVLKRVYSWDEIPEWQRDNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAV 101

Query: 89  CFFSVLFLNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHSLKVATFGNK 148
            F +VL L+K  +  FETT+ +D++ IDLFF GAF CLILSS+FHCFKSHSLK+AT GNK
Sbjct: 102 GFLTVLLLDKTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNK 161

Query: 149 LDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPY 208
           LDYLGI +LIVTSM+SILYYG+YD    F  F+ +T+SFG AC +VSLKD FR REWRPY
Sbjct: 162 LDYLGICILIVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPY 221

Query: 209 RAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGAFLYGIRFPEKGS 268
           RAGLFV FGLS+I+PI SG++ Y   E +++IQ+ W++L G  YI+GA LYG+RFPEK  
Sbjct: 222 RAGLFVCFGLSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVY 281

Query: 269 PGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYELVH 305
           PG++DIWGHSHQ+FH LVV+A+LCH++G++ SYELVH
Sbjct: 282 PGRFDIWGHSHQLFHFLVVIASLCHMRGVLNSYELVH 318

>TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27
           YOL002C
          Length = 327

 Score =  383 bits (983), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 183/322 (56%), Positives = 234/322 (72%), Gaps = 15/322 (4%)

Query: 2   SSRVQR---QTVTITEPVVYED-----DGGEMKTATKKITKR-------IYTWNEIPEWQ 46
           SSR+Q+   +T+  +  V  E+     DG +      KI  R       I  W+++P+WQ
Sbjct: 4   SSRLQKRNGETIVSSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQ 63

Query: 47  KDNEHIIDGYVRETNSFLKCVHSLFYLHNESVNVYSHLIPALCFFSVLFLNKYCVKSFET 106
           KDNEHI +GYV+ETNSF+ C  SLF+LHNESVN+YSH++P LC   +L ++   +K F T
Sbjct: 64  KDNEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDINIIKKFPT 123

Query: 107 TSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISIL 166
           T+ VDY  IDLF  GAF+CLILSS FH  KSHSL VA +GNKLDYLGIV+LIVTSMISIL
Sbjct: 124 TTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISIL 183

Query: 167 YYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILS 226
           YYGFYD+   F+ FS +T+ FG ACG VSL + FRSREWRPYRA LFV FGLSA+ P+L+
Sbjct: 184 YYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLT 243

Query: 227 GMFAYGIEEAFHRIQIKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILV 286
           G++ YG+E+ F RIQ+KWI+ EG FYI GAFLY +R+PE+  PG +D+WGHSHQ+FH+ V
Sbjct: 244 GIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFV 303

Query: 287 VVAALCHLKGLMVSYELVHKGL 308
           V+AA  H  GL+ +YE  H+ L
Sbjct: 304 VIAAYSHFHGLLSAYEYAHEML 325

>ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL002C
          Length = 329

 Score =  378 bits (970), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 172/270 (63%), Positives = 207/270 (76%)

Query: 38  TWNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNESVNVYSHLIPALCFFSVLFLN 97
           +W+++P+WQKDNEHI+ GYVRETNS+ K   SLFYLHNESVN+YSHLIP +CF  +   N
Sbjct: 54  SWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIALFN 113

Query: 98  KYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVL 157
           KY V  + TT+  DYL ID+F LGA  CL LS  +HC KSHSL+V+ FGNKLDY+GIV L
Sbjct: 114 KYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIVAL 173

Query: 158 IVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFG 217
           I  SMIS +YYGFYDS+ MF  FS VTLS   AC VVSL  HFRSREWR YRA +F AFG
Sbjct: 174 ISCSMISQMYYGFYDSTAMFSLFSTVTLSLALACAVVSLSPHFRSREWRKYRAAIFTAFG 233

Query: 218 LSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGH 277
           LS +LP+++  F YG  EA+ RIQ+KW+ LEGV YI GA LYG+RFPEK  PG +DIWGH
Sbjct: 234 LSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIWGH 293

Query: 278 SHQVFHILVVVAALCHLKGLMVSYELVHKG 307
           SHQ+FH+LVV+AALCHL+ L+  Y+ VH  
Sbjct: 294 SHQLFHVLVVIAALCHLRALLSCYKNVHTN 323

>SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 314

 Score =  297 bits (761), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 140/304 (46%), Positives = 202/304 (66%), Gaps = 2/304 (0%)

Query: 8   QTVTITEPVVYEDDGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGYVRETNSFLKCV 67
            T T+ +             AT K  KR+ T+ E+P+WQKDNE I+DGYVRET S  +C 
Sbjct: 3   STTTVRQRRKTTQKASAESIATAKGRKRLCTFEELPDWQKDNELILDGYVRETRSVSECF 62

Query: 68  HSLFYLHNESVNVYSHLIPALCFFSVL-FLNKYC-VKSFETTSLVDYLFIDLFFLGAFTC 125
            SL Y HNE+VN+Y+HL+P + +  +L FL  +  +  F ++++ DY+ I+ F LGAF C
Sbjct: 63  KSLLYFHNETVNIYTHLVPGVTYLLMLMFLTDFILIPKFPSSTMTDYIIINFFLLGAFVC 122

Query: 126 LILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTL 185
           L+ SS FHC K HS + +   +K+DY+GI+VLI  SM+SILYYGF+D    F  F+ VT+
Sbjct: 123 LMCSSCFHCLKQHSEEHSDIWSKVDYMGIIVLISCSMVSILYYGFHDHLFHFKIFTVVTV 182

Query: 186 SFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWI 245
             G+ C    L D F S+ +R +RA  FV+FG S ++PI+ G+  +GI E+ HR+Q+K++
Sbjct: 183 ILGSCCAAFVLNDRFNSKNFRVFRASFFVSFGFSGLVPIIFGLVKFGISESVHRVQLKYV 242

Query: 246 ILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYELVH 305
            LE VFYI GA  YG R PE   PGK+D+ GHSHQ+FH++VV+ +LCHL+ ++ SY  +H
Sbjct: 243 GLEAVFYIGGAVFYGFRIPENFGPGKFDLVGHSHQIFHVMVVLGSLCHLRAVVGSYIFMH 302

Query: 306 KGLS 309
            G++
Sbjct: 303 TGVN 306

>TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON}
           Anc_3.90 YOL101C
          Length = 327

 Score =  298 bits (762), Expect = e-99,   Method: Compositional matrix adjust.
 Identities = 142/318 (44%), Positives = 217/318 (68%), Gaps = 11/318 (3%)

Query: 2   SSRVQRQTVTITEPVVYEDDGGEMKTATKKI---TKRIYTWNEIPEWQKDNEHIIDGYVR 58
           SS++ R+  ++++      +G  +  +T+ +   +K++Y+++E+PEWQKDNE II GYVR
Sbjct: 14  SSKLSRRRFSVSK------NGTVLLESTEIVETYSKKLYSFHELPEWQKDNELIIQGYVR 67

Query: 59  ETNSFLKCVHSLFYLHNESVNVYSHLIPALCFFSVL--FLNKYCVKSFETTSLVDYLFID 116
           ETNS+ KC HSL Y HNES+N+Y+HLIP L +F +L  + +   V SF +T+++DY+ ID
Sbjct: 68  ETNSWFKCFHSLSYFHNESINIYTHLIPGLVYFIMLLFYTDLLVVPSFPSTTIMDYIVID 127

Query: 117 LFFLGAFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVM 176
            + LGAF CL+ SS FHC K HS   + F +K+DY+GI+ LI  S+IS+LYYG++D  + 
Sbjct: 128 FYLLGAFICLVGSSCFHCLKQHSEDQSNFWSKIDYVGIICLISCSLISLLYYGYFDHFIY 187

Query: 177 FYFFSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEA 236
           F  F+ +TL   T C V  L + F ++ +RP RAG FV F  SA++PI +G+  +   E 
Sbjct: 188 FKVFTLITLILATICTVCVLDERFNAKNFRPIRAGFFVVFATSAVIPICTGLIKFDYVEV 247

Query: 237 FHRIQIKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKG 296
            +RIQ++++  E  FY++GA LYG R PE  +PG++D+ G SHQ+FH++VV+ +L HLK 
Sbjct: 248 INRIQLRFVGWETFFYVVGALLYGYRIPEIFAPGRFDLVGSSHQIFHVMVVIGSLFHLKA 307

Query: 297 LMVSYELVHKGLSSATKA 314
           ++ SYE +HK L+    A
Sbjct: 308 VIGSYEFMHKSLNVIETA 325

>KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {ON}
           similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  290 bits (742), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 138/289 (47%), Positives = 190/289 (65%), Gaps = 10/289 (3%)

Query: 28  ATKKITKRIYTWNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNESVNVYSHLIPA 87
           AT      +  + E+P+WQ+DN+ I+ GYVRETNS  KC  SL Y HNE+VN+Y+HLIP+
Sbjct: 26  ATAPGKNGLCCFEELPDWQRDNDKILAGYVRETNSMKKCFESLTYFHNETVNIYTHLIPS 85

Query: 88  ------LCFFSVLFLNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHSLK 141
                 L FF+ LFL    +  F TT++ DY+ I+ F LGAF CL+ S+ FHC K HS  
Sbjct: 86  GTYLVMLMFFTDLFL----IPQFPTTTMSDYIMINFFLLGAFLCLMCSTCFHCLKQHSEA 141

Query: 142 VATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFR 201
            +   +K+DY+GI+VLI  S +S+LYYGFYD    F  F+   +  G+ C    L D F 
Sbjct: 142 QSNIWSKVDYMGIIVLISCSTVSLLYYGFYDYLFHFKMFTIAVVVLGSCCAAFVLNDRFN 201

Query: 202 SREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGAFLYGI 261
           ++ WR  RAG FV FG S I+PI+ G+  +GI E+  R+Q+++++LE +FYI GA +YG 
Sbjct: 202 AKNWRACRAGFFVTFGFSGIVPIVVGLVKFGIAESSKRVQLRFVLLEALFYISGAVIYGF 261

Query: 262 RFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYELVHKGLSS 310
           R PE   PGK+D  GHSHQ+FHILVV+ +LCH + L+ SY  +H G+SS
Sbjct: 262 RIPETLLPGKFDFVGHSHQIFHILVVLGSLCHFRALLGSYFFMHTGISS 310

>Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W -
           Hypothetical ORF [contig 184] FULL
          Length = 320

 Score =  288 bits (738), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 134/309 (43%), Positives = 199/309 (64%), Gaps = 6/309 (1%)

Query: 6   QRQTVTITEPVVYEDDGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGYVRETNSFLK 65
           QR++    E      +G   K+A +     +  + E+PEWQ+DNE I+ GYVRET S  K
Sbjct: 9   QRRSACKNEL----KNGKNSKSAEQTKKSALCRFEELPEWQRDNEKILAGYVRETRSMRK 64

Query: 66  CVHSLFYLHNESVNVYSHLIPALCFFSVL--FLNKYCVKSFETTSLVDYLFIDLFFLGAF 123
           C+ SL Y HNE++N+Y+HLIP+  +  +L  F + + +  F +T++ DY+ I+ + LGAF
Sbjct: 65  CLESLTYFHNETLNIYTHLIPSGTYLVLLMFFTDVFLIPHFPSTTMSDYIMINFYLLGAF 124

Query: 124 TCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFV 183
            CL+ S+ FHC K HS   +   +K+DY+GI+VLI  S +S+LYYGF+D    F  F+  
Sbjct: 125 LCLLCSTCFHCLKQHSEAQSNIWSKVDYMGIIVLISCSTVSLLYYGFHDYLFHFKIFTIA 184

Query: 184 TLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQIK 243
            +  G+ C    L D F ++ WR  RAG FV FG S I+PI+ G+  +G+ E+  R+Q++
Sbjct: 185 VVVLGSCCAAFVLNDRFNAKNWRACRAGFFVTFGFSGIVPIIMGLVKFGVAESSKRVQLR 244

Query: 244 WIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYEL 303
           +++LE  FYI GA +YG R PE   PGK+D  GHSHQ+FHILVV+ +LCH + L+ SY  
Sbjct: 245 FVLLEAFFYIGGAIIYGFRIPETLIPGKFDFVGHSHQIFHILVVLGSLCHFRALIGSYFF 304

Query: 304 VHKGLSSAT 312
           +H G+SS++
Sbjct: 305 MHTGISSSS 313

>ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 318

 Score =  287 bits (734), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 140/314 (44%), Positives = 205/314 (65%), Gaps = 8/314 (2%)

Query: 3   SRVQRQTVTITEPVVYEDDGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGYVRETNS 62
           + V+R+ V    P+   +  G  K   ++  K +Y ++E+PEWQ+DN+ I+ GY+RET S
Sbjct: 5   TEVKRRRV----PIGNGNGEGLYKEVLEE--KTLYDFHELPEWQQDNDKILTGYIRETKS 58

Query: 63  FLKCVHSLFYLHNESVNVYSHLIPALCFFSVLF--LNKYCVKSFETTSLVDYLFIDLFFL 120
            LKCV SLF  +NE+VN+Y+HL+ A+ +F ++    +   V  F T++  DY  I+ + L
Sbjct: 59  VLKCVRSLFIWNNETVNIYTHLVSAVSYFLLMLGITDLVMVPHFPTSTFTDYSVINFYLL 118

Query: 121 GAFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFF 180
           GAF CL+ SS FH FK HS   +   +K+DY+GI+VLI  SMIS++YYGF+D    F  F
Sbjct: 119 GAFGCLMCSSCFHTFKQHSGPHSDAWSKVDYMGIIVLITCSMISLIYYGFFDHMEYFRLF 178

Query: 181 SFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRI 240
           + +TL+  TAC V  L D F  +++RP RAG F+AFGLS + P+ +G+  +GI+    R+
Sbjct: 179 TVLTLTLATACTVCVLSDKFNHKDFRPLRAGFFIAFGLSGVFPVAAGIIKFGIQGGVQRV 238

Query: 241 QIKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVS 300
           Q+K++ LE +FYI GA +YG R PE   PG++D WGHSHQ+FH+LVV+A+  HLK +M S
Sbjct: 239 QLKYLGLEAIFYIAGALIYGFRIPETMFPGRFDFWGHSHQIFHVLVVIASFLHLKAVMGS 298

Query: 301 YELVHKGLSSATKA 314
           Y   H  L+    A
Sbjct: 299 YIFKHSHLNGVGLA 312

>Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  286 bits (732), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 134/287 (46%), Positives = 200/287 (69%), Gaps = 3/287 (1%)

Query: 21  DGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNESVNV 80
           +  + KTA++K  K ++ ++E+PEWQKDN+ I+ GYVRET S+ KC+ SLFY +NE+VN+
Sbjct: 26  EAVQSKTASEK-EKLLHNFDELPEWQKDNDKILTGYVRETLSWKKCLRSLFYWNNETVNI 84

Query: 81  YSHLIPALCFF--SVLFLNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSH 138
           Y+HL+PA+ +F  ++   N + +  F +TS  DY  I++F +GAF+CL+ SS FHC K H
Sbjct: 85  YTHLVPAIIYFLFAITLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCLKQH 144

Query: 139 SLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKD 198
           S + + F +KLDYLGI+ LI  SMI I+Y+G++D    F  F+ VTL   T C V  L +
Sbjct: 145 SEEQSNFWSKLDYLGIISLISCSMIPIIYFGYFDHVSYFSLFTTVTLVLATFCTVCVLHE 204

Query: 199 HFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGAFL 258
            F +  +RP+RA  F+ FG S +LP+ +G F +GI+   +RI++ ++  E +FYI GA +
Sbjct: 205 KFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVI 264

Query: 259 YGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYELVH 305
           YG R PE  +PGK+D  G SHQ+FHI+VV+ +LCHLK ++ SY+L+H
Sbjct: 265 YGFRIPETIAPGKFDFLGSSHQIFHIMVVLGSLCHLKAIIDSYKLMH 311

>TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90
           YOL101C
          Length = 316

 Score =  286 bits (732), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 136/311 (43%), Positives = 202/311 (64%), Gaps = 10/311 (3%)

Query: 4   RVQRQTVTITEPVVYEDDGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGYVRETNSF 63
           R ++ TV  T+      DG         + K++Y +NE+PEWQ+DN+ I+ GYVRET S 
Sbjct: 8   RQRKTTVQETQKARDSKDG--------IMGKKLYHFNELPEWQQDNDKILTGYVRETKSV 59

Query: 64  LKCVHSLFYLHNESVNVYSHLIPALCFFSVL--FLNKYCVKSFETTSLVDYLFIDLFFLG 121
           L+C+ SL Y +NESVN+Y+HL+ A+ +F +L  F +   + SF +T++ DY+ I+ + LG
Sbjct: 60  LRCLDSLSYWNNESVNIYTHLLSAVAYFVLLLFFTDILLIPSFPSTTMTDYIIINFYLLG 119

Query: 122 AFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFS 181
           AF CL+ SS FHCFK HS   +   +K+DY+GI+ LI  S+IS+LYYG++D    F  FS
Sbjct: 120 AFVCLMCSSCFHCFKQHSNSQSDAWSKVDYMGIIGLISCSVISLLYYGYFDHVFYFKLFS 179

Query: 182 FVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQ 241
            +T+    AC V  L D F + + RP RA  F+ F  S+++PI +GMF +G  E FHR+Q
Sbjct: 180 VITVVLAMACSVCVLSDRFNTSDMRPLRASFFITFAFSSVIPIATGMFKFGWTEVFHRVQ 239

Query: 242 IKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSY 301
           ++++  E  FY+ GA LYG R PE  +PGK+D  G SHQ+FH+LVV+ + CHL+ +M SY
Sbjct: 240 LRFVGWEAFFYLSGALLYGYRIPETIAPGKFDFIGSSHQLFHVLVVLGSFCHLRAVMGSY 299

Query: 302 ELVHKGLSSAT 312
             +H  +++  
Sbjct: 300 MFMHAHINAPN 310

>YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membrane
           protein involved in zinc ion homeostasis, member of the
           four-protein IZH family; transcription is regulated
           directly by Zap1p, expression induced by zinc deficiency
           and fatty acids; deletion increases sensitivity to
           elevated zinc
          Length = 316

 Score =  285 bits (730), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 131/274 (47%), Positives = 194/274 (70%), Gaps = 2/274 (0%)

Query: 34  KRIYTWNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNESVNVYSHLIPALCFF-- 91
           K ++ ++E+PEWQKDN+ I+ GYVRET S+ KC++SLFY +NE+VN+Y+HL+PA+ +F  
Sbjct: 38  KLLHNFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVF 97

Query: 92  SVLFLNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHSLKVATFGNKLDY 151
           ++   N + +  F +TS  DY  I++F +GAF+CL+ SS FHC K HS K + F +KLDY
Sbjct: 98  AITLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDY 157

Query: 152 LGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPYRAG 211
           LGI+ LI  SMI I+Y+G++D    F  F+ VTL   T C V  L D F +  +RP+RA 
Sbjct: 158 LGIISLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTVCVLHDKFNTSTFRPFRAM 217

Query: 212 LFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGAFLYGIRFPEKGSPGK 271
            F+ FG S +LP+ +G F +GI+   +RI++ ++  E +FYI GA +YG R PE  +PGK
Sbjct: 218 FFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGK 277

Query: 272 YDIWGHSHQVFHILVVVAALCHLKGLMVSYELVH 305
           +D +G SHQ+FHI+VV+ ++CHLK ++ SY+L+H
Sbjct: 278 FDFFGSSHQIFHIMVVLGSVCHLKAIIDSYKLMH 311

>CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar to
           uniprot|Q03419 Saccharomyces cerevisiae YDR492w
          Length = 316

 Score =  285 bits (729), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 138/291 (47%), Positives = 193/291 (66%), Gaps = 2/291 (0%)

Query: 19  EDDGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNESV 78
            +DG       +K  K ++ +NE+PEWQKDN+ I+ GYVRETNSF +C+ SL YL+NESV
Sbjct: 21  RNDGSIHAHGEEKSEKLLWHFNELPEWQKDNDKILRGYVRETNSFKRCLQSLLYLNNESV 80

Query: 79  NVYSHLIPALCFFSV-LFL-NKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFK 136
           N+Y+HLIPA+ + S+ L+L N + +  + +TS VDY+ I++FFLGAF CL+ SS FHC K
Sbjct: 81  NIYTHLIPAVFYISLSLYLANVFLIPVYPSTSSVDYVIINVFFLGAFFCLLCSSCFHCMK 140

Query: 137 SHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSL 196
            HS       +KLDYLGI+ LI  S + ++YYG++D    F  F+ +TL     C V  L
Sbjct: 141 QHSESQCNVWSKLDYLGIICLISCSTVPMIYYGYFDHISEFTIFTGITLLLAIGCSVFVL 200

Query: 197 KDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGA 256
            D F + E+RP RA  F  FG S I+P+ +G   +G E    RI + +I LE +FYI GA
Sbjct: 201 TDKFNTTEYRPIRASFFTLFGFSGIIPLGAGFLKFGAEGVLQRISLPFIGLEALFYISGA 260

Query: 257 FLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYELVHKG 307
            +YG RFPE  +PGK+D +G SHQ+FHI+VV+ ++CHL  ++ SY L+H  
Sbjct: 261 IIYGFRFPETIAPGKFDFFGSSHQIFHIMVVLGSICHLFAMVESYHLIHSN 311

>Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  283 bits (725), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 131/281 (46%), Positives = 195/281 (69%), Gaps = 2/281 (0%)

Query: 27  TATKKITKRIYTWNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNESVNVYSHLIP 86
           T   +  K ++ ++E+PEWQKDN+ I+ GYVRET S+ KC++SLFY +NE+VN+Y+HL+P
Sbjct: 31  TTVSEKKKLLHNFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLVP 90

Query: 87  ALCFF--SVLFLNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHSLKVAT 144
           A+ +F  ++   N + +  F +TS  DY  I++F +GAF+CL+ SS FHC K HS K + 
Sbjct: 91  AVIYFVFAITLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMKQHSEKQSN 150

Query: 145 FGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSRE 204
           F +KLDYLGI+ LI  SMI I+Y+G++D    F  F+ VTL   T C V  L + F +  
Sbjct: 151 FWSKLDYLGIISLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTVCVLHEKFNTST 210

Query: 205 WRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGAFLYGIRFP 264
           +RP+RA  F+ FG S +LP+ +G F +GI+   +RI++ ++  E +FYI GA +YG R P
Sbjct: 211 FRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGFRIP 270

Query: 265 EKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYELVH 305
           E  +PGK+D  G SHQ+FHI+VV+ ++CHLK ++ SY+L+H
Sbjct: 271 ETLAPGKFDFLGSSHQIFHIMVVLGSICHLKAIIGSYKLMH 311

>Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W
           (REAL)
          Length = 315

 Score =  282 bits (722), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 132/311 (42%), Positives = 206/311 (66%), Gaps = 3/311 (0%)

Query: 2   SSRVQRQTVTITEPVVYEDDGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGYVRETN 61
           + R  ++ V        + +  + K   +K  K ++ ++E+P+WQ+DN+ I+ GYVRET 
Sbjct: 6   TRRRNQENVCCKTSTSIKVEALKSKVTLRK-EKLLHDFHELPDWQRDNDKILTGYVRETL 64

Query: 62  SFLKCVHSLFYLHNESVNVYSHLIPALCFF--SVLFLNKYCVKSFETTSLVDYLFIDLFF 119
           S+ KC++SLFY +NE+VN+Y+HL+PA+ +F   V   N + +  F +T+  DY  I++F 
Sbjct: 65  SWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFGVTLTNYFLIPVFPSTTWSDYTVINIFL 124

Query: 120 LGAFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYF 179
           +GAF CL+ SS FHC K HS K + F +KLDYLGI+ LI  SMI I+Y+G++D +  F  
Sbjct: 125 MGAFLCLMCSSCFHCMKQHSEKQSDFWSKLDYLGIISLISCSMIPIIYFGYFDHASYFSL 184

Query: 180 FSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHR 239
           F+ VTL   T C +  L D F +  +RP+RA  F+ FG S +LP+ +G+F +G++   +R
Sbjct: 185 FTIVTLVLATFCTICVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGLFKFGLQGVLNR 244

Query: 240 IQIKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMV 299
           I++ ++  E +FYI GA +YG R PE  +PGK+D +G SHQ+FHI+VV+ ++CHLK ++ 
Sbjct: 245 IRVSFVFWEALFYISGALIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKAIID 304

Query: 300 SYELVHKGLSS 310
           SY+L+H    S
Sbjct: 305 SYKLMHSHFHS 315

>NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {ON}
           Anc_3.90
          Length = 330

 Score =  279 bits (713), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 133/293 (45%), Positives = 201/293 (68%), Gaps = 6/293 (2%)

Query: 19  EDDGGEMKTATKKITKRIY--TWNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNE 76
           ED+    K  T +  ++I+   ++E+PEWQKDN+ I+ GYVRETNSF+ C  SLFYL+NE
Sbjct: 34  EDNDTSQKPKTNRRKRKIHLSKFDELPEWQKDNDKILTGYVRETNSFIHCFQSLFYLNNE 93

Query: 77  SVNVYSHLIPALCFFSV----LFLNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTF 132
           ++N+Y+HLIP++ +  V    +F+N   +  F TTS++DY+ I++F LGAFTCL+LSS F
Sbjct: 94  TINIYTHLIPSIIYLIVSLTFIFINFIAIPKFPTTSVIDYIVINIFILGAFTCLLLSSCF 153

Query: 133 HCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACG 192
           HC K HS K  T  +KLDY+GI++LI  S+I ILY+G++D    F FF+ +T SF   C 
Sbjct: 154 HCLKQHSFKQCTLWSKLDYIGIIILISCSIIPILYFGYFDRLSYFKFFTILTFSFAIVCS 213

Query: 193 VVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFY 252
           ++ L + F    +RP RAGLF+ F  + ++P+++G + +G +    RI + +++LE +FY
Sbjct: 214 IIVLNEKFDLPSYRPLRAGLFMLFSFTGLIPMITGFYIFGYKGVMERISLNFVLLEAIFY 273

Query: 253 ILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYELVH 305
           I+G  LYG R PE   PG +D++G SHQ+FHI VV+ ++CH   ++ SY L+H
Sbjct: 274 IIGTLLYGFRIPETFKPGNFDMFGSSHQIFHIFVVLGSICHFGAVIKSYCLMH 326

>Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON}
           complement(40099..41073) [975 nt, 325 aa]
          Length = 324

 Score =  278 bits (712), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 131/276 (47%), Positives = 188/276 (68%), Gaps = 2/276 (0%)

Query: 39  WNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNESVNVYSHLIPALCFFSVL--FL 96
           ++E+P+WQKDNE I+ GYVRETNS  KC+ SL   +NES+N+YSHLI A+ +F VL  + 
Sbjct: 44  FHELPDWQKDNEFILTGYVRETNSIKKCLRSLGCFNNESINIYSHLIAAISYFVVLLFYT 103

Query: 97  NKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVV 156
           +  C+ SF +T+ VDY+ IDL+ LGAFTCLI SS FHC K HS   +   +K+DY+GI+ 
Sbjct: 104 DILCIPSFPSTTFVDYMVIDLYLLGAFTCLIGSSLFHCMKQHSESHSDMWSKVDYIGIIC 163

Query: 157 LIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAF 216
           LI  S+IS+LYYG+ D  + F  F+ +TL   T C +  L   F S+ +RP RAG F+ F
Sbjct: 164 LITCSLISLLYYGYMDHFIYFKVFTVITLVLATICTICVLDQRFNSKNFRPIRAGFFILF 223

Query: 217 GLSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWG 276
            +SA++PI +G   +G  E   RIQ++++  E  FY++GA LYG R PE   PG +D+ G
Sbjct: 224 SMSAVIPIGAGFSKFGFTEVLQRIQLRFVAWETFFYVVGALLYGFRIPETLYPGNFDLVG 283

Query: 277 HSHQVFHILVVVAALCHLKGLMVSYELVHKGLSSAT 312
            SHQ+FHI+V++ ++ HLK ++ SY  +H  +SS +
Sbjct: 284 SSHQIFHIMVILGSVFHLKAVLGSYTFMHSNISSNS 319

>NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON}
           Anc_3.90 YDR492W
          Length = 314

 Score =  269 bits (688), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 132/291 (45%), Positives = 193/291 (66%), Gaps = 5/291 (1%)

Query: 21  DGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNESVNV 80
           DG + K   K+   R++ +NE+PEWQ+DN+ I+ GYVRET SF +C+ SL Y +NE++N+
Sbjct: 27  DGDKTKRNWKR---RLFNFNELPEWQRDNDKILTGYVRETKSFKQCLQSLLYWNNETINI 83

Query: 81  YSHLIPALCFF--SVLFLNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSH 138
           Y+HLIPAL +   SV  +N   V  F TTS++DY  I++F +GAF CLILSS FHC K H
Sbjct: 84  YTHLIPALFYLTISVTLINYVVVPHFPTTSIMDYFVINVFLMGAFVCLILSSCFHCLKQH 143

Query: 139 SLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKD 198
           S +  T  +KLDY+GI++LI  S+I ++Y+G++D      FF  +T SF T C +  L +
Sbjct: 144 SSRQCTLWSKLDYMGIIILISCSLIPMIYFGYFDHLYYVNFFIILTFSFATLCSICVLNE 203

Query: 199 HFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGAFL 258
            F    +RP+RA +F+ F  S  +PIL+G + +G    F R+ +K++  E +FYI GA L
Sbjct: 204 KFNVPHYRPFRAIVFMLFSFSGFIPILTGFYLFGFHGVFERVALKFVAWEALFYITGATL 263

Query: 259 YGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYELVHKGLS 309
           YG R PE   PG +D  G SHQ+FHILVV+ ++CH + ++ SY L+H  ++
Sbjct: 264 YGFRIPECFKPGDFDFLGSSHQIFHILVVLGSICHFRAVIKSYILMHSSMN 314

>KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa]
           {ON} similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  269 bits (687), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 129/287 (44%), Positives = 193/287 (67%), Gaps = 2/287 (0%)

Query: 28  ATKKITKRIYTWNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNESVNVYSHLIPA 87
           A     KR+Y ++E+PEWQ+DN+ II GY+RET S  +CV SLF  HNES+N+YSHL+P 
Sbjct: 24  AISSTIKRLYRYSELPEWQQDNDKIITGYIRETKSVKECVKSLFLFHNESINIYSHLVPT 83

Query: 88  LCFFSVL--FLNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHSLKVATF 145
           + +  +L    + + V  F  ++++  + I  F LG+  CL  SS FHC K HS      
Sbjct: 84  ITYLVLLVGLADMFLVPQFPNSTMMQSVMIHFFLLGSVLCLGCSSFFHCLKQHSESHCHI 143

Query: 146 GNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREW 205
            +K+DY+GI+++I  S+IS+LYYGF+D    F  F+  T+  GT C V +L D F S+ +
Sbjct: 144 WSKVDYMGIIIMITCSIISLLYYGFHDHIFHFKCFTVFTVILGTICTVFALHDKFNSKTF 203

Query: 206 RPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGAFLYGIRFPE 265
           RP+RA  +V FGLS I+PI++G + +G  EA  R+Q+K+++LE +FYI GA +YG RFPE
Sbjct: 204 RPFRAMFYVTFGLSGIVPIVTGFWKFGAYEAIRRVQLKYVLLEAMFYIAGAVIYGFRFPE 263

Query: 266 KGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYELVHKGLSSAT 312
             +PGK+D  GHSHQ+FHI+VV+ ++CH + ++ SY  +H G+  ++
Sbjct: 264 VLAPGKFDFVGHSHQIFHIMVVLGSICHFRAILGSYVFMHTGMHHSS 310

>KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3.90
           YOL101C
          Length = 319

 Score =  269 bits (687), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 131/288 (45%), Positives = 195/288 (67%), Gaps = 13/288 (4%)

Query: 28  ATKKITKRI-YTWNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNESVNVYSHLIP 86
           ++ KI KRI Y ++E+P WQ+DN+ I+ GYVRETNSF KC+ SLFYL+NES+N+YSHLIP
Sbjct: 30  SSIKIEKRILYHFHELPTWQQDNDKILGGYVRETNSFTKCIESLFYLNNESINIYSHLIP 89

Query: 87  ALCFFSVL---------FLNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKS 137
           +L + ++          FLN   +  + TT+  D++FI++F +GAF CL+ S  FH  K 
Sbjct: 90  SLIYLTIAVMLLIEIDQFLN---IPIYPTTTKYDFIFINIFLVGAFLCLLGSGCFHLLKQ 146

Query: 138 HSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLK 197
           HS     F +++DY+GI+VLI  SM+ +LYYGF+D  V+FY F  +TL+F + C ++ + 
Sbjct: 147 HSELQCNFWSRIDYMGIIVLISCSMMPVLYYGFFDHIVLFYCFITLTLAFASVCSIIVMS 206

Query: 198 DHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGAF 257
           + F   ++R  RA +F AFG S ++P++ G   +G+   F RI +K+I  E VFY++GA 
Sbjct: 207 ETFNLSKYRLLRACVFAAFGFSGLIPMIVGFSKFGLSGVFQRISLKFIFWESVFYLVGAT 266

Query: 258 LYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYELVH 305
           LYG R PE   PGK+D++G SHQ+FH  VV+ ++ H K ++ SY L+H
Sbjct: 267 LYGFRIPESILPGKFDLFGSSHQLFHCFVVIGSVLHFKAVIESYILMH 314

>AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR492W (IZH1) and
           YOL101C (IZH4)
          Length = 317

 Score =  268 bits (685), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 130/309 (42%), Positives = 196/309 (63%), Gaps = 4/309 (1%)

Query: 1   MSSRVQRQTVTITEPVVYEDDGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGYVRET 60
           MS     +  TI+E  + ++         KK  +++YT++E+P WQKDNE I+ GYVRET
Sbjct: 1   MSEERGMKEQTISE--MAQEMAHTTSEGLKKRIRKLYTFDELPAWQKDNELILSGYVRET 58

Query: 61  NSFLKCVHSLFYLHNESVNVYSHLIPALCFFSV--LFLNKYCVKSFETTSLVDYLFIDLF 118
           NS  +C+ ++ Y +NES+N+Y+HLIP + +  +  +F +    +        ++  +  +
Sbjct: 59  NSVKECLRAMTYFNNESINIYTHLIPGVAYLVLFLIFADLVLAQLLPGLDAGEHRMLRFY 118

Query: 119 FLGAFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFY 178
            LGAFTCL  SS FHC K HS   +   +K+DYLGI+  I  S IS+LYYG++     F 
Sbjct: 119 LLGAFTCLACSSCFHCLKQHSEPHSRLWSKVDYLGILAQITCSTISLLYYGYHSYPSHFV 178

Query: 179 FFSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFH 238
           FFS +T++  +AC V+ L D F +  +RP RA LF+AFGLS ++P+L+G + +G  E   
Sbjct: 179 FFSTLTVALCSACAVLVLNDSFNTVAFRPLRAFLFMAFGLSGVIPVLAGSYQFGFAEWAA 238

Query: 239 RIQIKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLM 298
           RIQ+K+++ E VFYI GA +YG R PE+ +PGK+D+ GHSHQ+FH+LVV+  LCH + + 
Sbjct: 239 RIQLKYVLYEAVFYITGALVYGFRIPERFAPGKFDMVGHSHQIFHLLVVLGTLCHFRAVT 298

Query: 299 VSYELVHKG 307
            SY  +  G
Sbjct: 299 GSYIFICTG 307

>Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR337W
          Length = 305

 Score =  262 bits (669), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 124/280 (44%), Positives = 187/280 (66%), Gaps = 2/280 (0%)

Query: 30  KKITKRIYTWNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNESVNVYSHLIPALC 89
           K   +R+Y+++E+PEWQKDNE I  GYVRETNSFL+C+ S+ Y +NESVN+Y+HL+P++ 
Sbjct: 16  KNFNRRLYSFDELPEWQKDNELIRMGYVRETNSFLECLKSMTYFNNESVNIYTHLVPSVT 75

Query: 90  FF--SVLFLNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHSLKVATFGN 147
           +F   +LF++      F  T++ +Y+ ID +  G F CL+ S+ FHC K HS       +
Sbjct: 76  YFILLLLFVDLVVTPMFPGTTMREYIMIDFYLFGVFVCLMCSTCFHCLKQHSESHNRIWS 135

Query: 148 KLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRP 207
           K+DY+GI+V I +S++SILYYGFYD      + S +TL+ G  C    L D F + ++R 
Sbjct: 136 KVDYIGIIVQITSSIVSILYYGFYDHISHIKWLSVLTLTLGVCCVTFVLNDRFNAIDYRL 195

Query: 208 YRAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGAFLYGIRFPEKG 267
            RA  F  FG S ++P+L G++ +G+ E   RIQ+K+++   +FYI GA +YG R PE  
Sbjct: 196 LRAIFFTVFGFSGVVPVLIGIYQFGLIEWLARIQLKFVLAGTIFYIFGALIYGFRIPEAL 255

Query: 268 SPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYELVHKG 307
           +PGK+D  GHSHQ+FH+LVV+ ++CH + ++ SY  +  G
Sbjct: 256 APGKFDFIGHSHQIFHLLVVLGSICHFRAVIGSYVFMRTG 295

>TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON}
           Anc_3.90 YOL101C
          Length = 326

 Score =  252 bits (644), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 127/288 (44%), Positives = 184/288 (63%), Gaps = 4/288 (1%)

Query: 30  KKITKRI-YTWNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNESVNVYSHLIPAL 88
           +KIT  + YT+ E+P WQ+DNE I+ GY+RETNS+  C+ SL + HNE++N+YSH I A 
Sbjct: 36  QKITDTLLYTYEELPSWQQDNEMILTGYIRETNSWKLCLRSLTFFHNETINIYSHGISAA 95

Query: 89  CFFSVL---FLNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHSLKVATF 145
            +  +L   F N   + SF TT+L DYL +D++ LGA TCL LSS FHC K HS   +  
Sbjct: 96  IYLLLLVFFFTNLIYLPSFPTTTLHDYLVLDIYLLGAATCLTLSSCFHCLKQHSQSQSDI 155

Query: 146 GNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREW 205
            +K+DY+GI+ LI  S IS+LY+G+ D    F FF+  T      C V    + F +R+W
Sbjct: 156 WSKMDYIGIICLITCSTISLLYFGYRDHFNYFKFFAISTFILAITCTVFVTMEKFNTRDW 215

Query: 206 RPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGAFLYGIRFPE 265
           +  RA  F+AF  S ++P+++G+  +G  E + R+Q+  + LE + Y++GA LYG R PE
Sbjct: 216 KHVRALFFIAFAGSGLIPLITGINIFGFPEVWQRVQLPSLTLELICYVIGALLYGYRIPE 275

Query: 266 KGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYELVHKGLSSATK 313
             +PGK+D  G+SHQ FHI VV+ +L HL+ L+ SY  +H  L +  K
Sbjct: 276 VFAPGKFDNIGNSHQWFHIFVVLGSLLHLRALVGSYYFMHSFLLATRK 323

>KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.90
           YOL101C
          Length = 323

 Score =  246 bits (628), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 130/323 (40%), Positives = 195/323 (60%), Gaps = 14/323 (4%)

Query: 1   MSSRVQRQTVTITEPVVYEDD-----------GGEMKTATKKITKRIYTWNEIPEWQKDN 49
           MSS ++++ V++ E  +                G    A      R+  + E+P WQ+DN
Sbjct: 1   MSSELRKRAVSLGETAIETATVSRGSRGKLLVTGTSSGAPSGQRGRLCRYEELPAWQQDN 60

Query: 50  EHIIDGYVRETNSFLKCVHSLFYLHNESVNVYSHLIPALCFFS--VLFLNKYCVKSFETT 107
           + I  GYVRET S  +C+ SL Y +NESVN+YSHL+PA+ + +   L L+++ V  F TT
Sbjct: 61  DCIRTGYVRETLSVRRCLGSLLYWNNESVNMYSHLVPAVLYIAGATLALSQWGVPRFPTT 120

Query: 108 SLVDYLFIDLFFLGAFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILY 167
           +  DYL I+ F +GA  CL+ SS FHC K HS +     +++DY+GI++LI  S I ++Y
Sbjct: 121 TWSDYLIINTFLVGAGACLLCSSLFHCLKQHSERHCEAWSRMDYMGIILLIACSTIPMIY 180

Query: 168 YGFYDSSVMFYFFSFVTLSFGTAC-GVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILS 226
           +G++D       F+ VT++ G AC GVV     F S  ++  RA  F+AF  + ++P+ +
Sbjct: 181 FGYFDYMGHCLLFTAVTVALGVACSGVVLFNKQFNSSSFKLVRAAFFIAFAFNGLIPMAT 240

Query: 227 GMFAYGIEEAFHRIQIKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILV 286
           G   +GI     RI +K++  E VFYI GA LYG R PE   PGK D+WG+SHQ+FH++V
Sbjct: 241 GFVKFGIPGVLDRISLKYVWFEAVFYIAGAMLYGFRVPEIWIPGKVDLWGNSHQMFHVMV 300

Query: 287 VVAALCHLKGLMVSYELVHKGLS 309
           V  +LCHLK ++ SY L+H+ L+
Sbjct: 301 VFGSLCHLKAVLESYSLMHRHLA 323

>TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}
          Length = 296

 Score =  174 bits (441), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 96/290 (33%), Positives = 160/290 (55%), Gaps = 34/290 (11%)

Query: 35  RIYTWNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNESVNVYSHLIPALCFFSVL 94
           ++  +N++P+WQKDN  I++ YVRETNS  K + S+F  H+ES+N+++HLIPAL +    
Sbjct: 7   QLCNFNDLPDWQKDNPLIVNYYVRETNSLFKSLCSIFLFHSESMNIFTHLIPALLY---- 62

Query: 95  FLNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHSLKVATFGNKLDYLGI 154
              K+   +  T   V Y  +  + +    C +LSS FH FK  S++   F  KLDY+GI
Sbjct: 63  --AKFTYNAITTLEQVSYPIV-FYLISVIICFLLSSLFHLFKCTSVQSNEFWGKLDYVGI 119

Query: 155 VVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACG-----VVSLKDHFRSRE----- 204
            +LI  +++S+   GF +S       +FVT    T+C      ++++K H +  E     
Sbjct: 120 SLLINATIVSMALLGFNESRYTIMKNTFVT---QTSCLTAYVIILAIKSHPKQGENEDDN 176

Query: 205 --------------WRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEGV 250
                          +  RA LF + GLS ++P+++G++ YG +  +++I I  +I   +
Sbjct: 177 DGTLSEDDDCCCDDHKGTRAKLFASLGLSGLIPVITGLYIYGPKVVYYKINIPMVIASVL 236

Query: 251 FYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVS 300
            YI+G  +Y  + PEK  PG++D+ G SHQ+FHI +V   +CH   +  +
Sbjct: 237 CYIVGTLIYVFKIPEKFYPGRFDLVGSSHQLFHIFIVFGTVCHYHAIQTA 286

>NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {ON}
           Anc_3.90
          Length = 326

 Score =  164 bits (416), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 94/276 (34%), Positives = 157/276 (56%), Gaps = 7/276 (2%)

Query: 41  EIPEWQKD--NEHIIDGYVRETNSFLKCVHSLFYLHNESVNVYSHLIPALCFFSVL--FL 96
           E+P+WQK   N  II+GYVRETNS +KC+H++ Y +N++VN+  + + +  +F++L  F 
Sbjct: 46  ELPQWQKQYSNSKIINGYVRETNSLIKCLHTVTYWNNQTVNIILNTVFSTVYFTLLLFFT 105

Query: 97  NKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVV 156
           + Y + S   T++ DY+ ++ +  GAF    L+S F+  +SHSL       KL +L  + 
Sbjct: 106 DLYLIPSSPATTMSDYIMVNFYLFGAFQYFALNSIFYLLESHSLAKCHLWFKLSHLAFIN 165

Query: 157 LIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAF 216
            I TS+I+ LYY F+D+   F F +  TL   +   + +L + F  R+ R  R  + + F
Sbjct: 166 YISTSIITQLYYTFFDNVFYFKFLTISTLLISSIFAIFTLSEQFL-RKNRSQRNMVSITF 224

Query: 217 GLS-AILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIW 275
            +S  ILP  S MF +       R++ K I+LE   Y+    L  ++ PE+ S   +D  
Sbjct: 225 IVSLLILPTASLMFKFNTFRILRRVEGKAILLELSLYLFSMTLKAVQVPERFSEN-FDFI 283

Query: 276 GHSHQVFHILVVVAALCHLKGLMVSYELVHKGLSSA 311
           G+S  ++HI +++ +L H K L+ SY  +H GL ++
Sbjct: 284 GNSENIYHICIILGSLLHFKMLLNSYFFMHSGLDAS 319

>NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90
          Length = 318

 Score =  150 bits (380), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 95/291 (32%), Positives = 164/291 (56%), Gaps = 11/291 (3%)

Query: 29  TKKITKRIYTWNEIPEWQK--DNEHIIDGYVRETNSFLKCVHSLFYLHNESVNVYSHLIP 86
           +K  T+  Y   E+PEWQ+  ++  +I G+++ETNSF KC+ S  Y HN S+N+  + I 
Sbjct: 26  SKLSTRNHYKLKELPEWQREFNSGKVITGFLKETNSFKKCLWSTMYWHNSSINISLNGIA 85

Query: 87  ALCFFSVLFL--NKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHSLKVAT 144
           A  +F +LF   + Y + SF +T++ DY+ ++L+ L A    ++ + F+  KSHS + A 
Sbjct: 86  ATVYFMLLFFFTDCYLIPSFPSTTMSDYIVLNLYLLTATQNFMVGTIFYIMKSHSKQQAF 145

Query: 145 FGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGT--ACGVVSLKDHFRS 202
              KL+ +G++  I +S++++LYY ++D    F FF+ VTL   T   C ++S  D F +
Sbjct: 146 LWYKLNNIGLINHIASSVVTLLYYHYFDYVFYFKFFTIVTLLLITLFTCSIIS--DSF-N 202

Query: 203 REWRPYRAGLFVAF-GLSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGAFLYGI 261
           +  R  +  L +A+  L  ++P L  +  +G+ +   RI +  IILE   Y  G  +   
Sbjct: 203 KMTRIRKNFLLLAYIILLTLMPSLFAILRFGLAKVLERISLNLIILEIFIYAFGLTIRTS 262

Query: 262 RFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYELVHKGLSSAT 312
           + PE+     +D  G+S  V+ + ++V +  H K LM SY L+H G++  T
Sbjct: 263 QLPERFF-NSFDFLGNSENVYQLSIIVCSFIHFKILMNSYCLMHSGVNPPT 312

>CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {ON}
           similar to uniprot|Q03419 Saccharomyces cerevisiae
           YDR492w
          Length = 301

 Score =  107 bits (267), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 78/293 (26%), Positives = 140/293 (47%), Gaps = 18/293 (6%)

Query: 30  KKITKRIYTWNEIPEWQKD--NEHIIDGYVRETN-SFLKCVHSLFYLHNESVNVYSHLIP 86
           K +  +I T  ++P W +   N  I  GY   TN ++L C+  L   +N+S+++Y +L+ 
Sbjct: 4   KTVQSKIVTLEKLPVWYRRYGNSRIKTGYFYYTNATYLGCLQKLVKFNNDSISIYMNLVC 63

Query: 87  ALC--FFSVLFLNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHSLKVAT 144
            L      + + +   + S  +T++ DY+ I+LF +   T     +     K HS     
Sbjct: 64  GLISGVMLLFYTDVRLIPSHPSTTMTDYIIINLFLMATTTYFATMTLGQLLKGHSEYQGK 123

Query: 145 FGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSRE 204
             N+   L +V+L+  S++++LYY F+D   +F  F   T    +   +V + D ++   
Sbjct: 124 LWNQAKQLALVLLLTCSIVTLLYYAFFDHVFLFKLFVIWTCLLMSITSIVIINDQYK--- 180

Query: 205 WRPYRAGLFVAFG-LSAILPILSGMFAYGIEEAFHRIQIKWIIL--EGVFYILGAFLYGI 261
            R  +    V FG LS  LPI   +  +G+ +++ + +I + +L  E V Y L A L   
Sbjct: 181 -RVQKLSCVVIFGVLSISLPIAVSIIKFGLFDSYKKQRIPFQVLTWEIVLYSLSAMLQLT 239

Query: 262 RFPE------KGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYELVHKGL 308
           R PE        S    D  G+S QV  ++ + A + H   ++ +YE+VH  +
Sbjct: 240 RLPELTLSTLGDSFWIVDYLGNSDQVSQLVTIFAIIVHFNTIIFAYEVVHASI 292

>Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 88.6 bits (218), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 80/303 (26%), Positives = 138/303 (45%), Gaps = 27/303 (8%)

Query: 18  YEDDGGEMKTATK---KITKRIYTWNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLH 74
           Y D  G + +      K TK+ + ++++ +WQK          +  +S  + + +L YL 
Sbjct: 21  YSDATGAVTSNADVETKETKKGFPFHDLAKWQKQ--------YKNKSSRSESLVALIYLL 72

Query: 75  NESVNVYSHLIPALCFFSVLFLNKYCVKSFETTS-LVDYLFIDLFFLGAFTCLILSSTFH 133
                     + + C   + F + Y +  F TT+ + DY+  + + L  F   ++   +H
Sbjct: 73  GS--------MSSFCLL-IFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMIHFIYH 123

Query: 134 CFKSHSLKV-ATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACG 192
             K+ SL+       K  YL  + L+++S I+ILYY FYD    F  F+ +    G A  
Sbjct: 124 FIKNISLQQHIEIWQKFSYLANINLLISSQITILYYLFYDYVFFFKIFTLLMTFIGLAAY 183

Query: 193 VVSLKDHFRSREWRPYRAGLFVAFGLSAI-LPILSGMFAY-GIEEAFHRIQIKWIILEGV 250
            V L D   S + R  +   F++  +    LP+L+ +  + G+E    RI++  I  E V
Sbjct: 184 FVILTDKLNSYK-RFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKDRIKLNAITWELV 242

Query: 251 FYILGAFLYGIRFPEK--GSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYELVHKGL 308
             ++ + +Y  RFPE       K + W HS   FH+L+   A  H   L+ SY L+H  L
Sbjct: 243 TLVVASMIYVTRFPESLCRRNEKEEGWNHSEYFFHLLISGTAFYHFFILIQSYILMHSSL 302

Query: 309 SSA 311
           +  
Sbjct: 303 NQP 305

>Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 87.8 bits (216), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 79/300 (26%), Positives = 138/300 (46%), Gaps = 29/300 (9%)

Query: 19  EDDGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNESV 78
           E     +   TK+I K+ + ++++ +WQ+          R  +S            NES+
Sbjct: 26  ETTNSNVDAETKEI-KKGFPFHDLAKWQQQ--------YRNKSS-----------RNESL 65

Query: 79  NVYSHLIPALCFFSVL--FLNKYCVKSFETTS-LVDYLFIDLFFLGAFTCLILSSTFHCF 135
               +L+ ++  F +L  F + Y +  F TT+ + DY+  + + L  F   ++   +H  
Sbjct: 66  VALIYLLGSMSSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFVYHFI 125

Query: 136 KSHSLKV-ATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVV 194
           K+ SL+       K  YL  + L+++S I+ILYY FYD    F  F+ +    G      
Sbjct: 126 KNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLVAYFF 185

Query: 195 SLKDHFRSREWRPYRAGLFVAFGLSAI-LPILSGMFAY-GIEEAFHRIQIKWIILEGVFY 252
            L D   S + R  +   F++  +    LP+L+ +  + G+E    RI++K I  E V  
Sbjct: 186 ILTDKLNSSK-RFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKERIKVKAITCELVAL 244

Query: 253 ILGAFLYGIRFPEK--GSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYELVHKGLSS 310
           +  + +Y  RFPE       K + W HS  +FH+++   A  H   L+ SY L+H  L+ 
Sbjct: 245 VAASIIYVTRFPESLFRRNKKEESWNHSEYLFHLVISGTAFYHFFILIQSYILMHSSLNQ 304

>Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 87.0 bits (214), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 82/310 (26%), Positives = 143/310 (46%), Gaps = 31/310 (10%)

Query: 13  TEPVVYEDDGGEMKT---ATKKITKRIYTWNEIPEWQKDNEHIIDGYVRETNSFLKCVHS 69
           T P    +   E+ +   A  K TK+ + ++++ +WQ       + Y  +++        
Sbjct: 16  TTPEKCNNSTAEINSTVGAKTKETKKGFPFHDLAKWQ-------EQYKNKSS-------- 60

Query: 70  LFYLHNESVNVYSHLIPALCFFSVL--FLNKYCVKSFETTS-LVDYLFIDLFFLGAFTCL 126
                NESV    +L+ ++  F +L  F + Y +  F TT+ + DY+  + + L  F   
Sbjct: 61  ----RNESVVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFC 116

Query: 127 ILSSTFHCFKSHSLKV-ATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTL 185
           ++   +H  K+ SL+       K  YL  + L+++S I+ILYY FYD    F  F+ +  
Sbjct: 117 MVHFIYHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMN 176

Query: 186 SFGTACGVVSLKDHFRSREWRPYRAGLFVAFG-LSAILPILSGMFAY-GIEEAFHRIQIK 243
             G       L D   S + R  +   F++   +   LP+L+ +  + G+E    RI++ 
Sbjct: 177 FIGLVAYFFILTDKLISSK-RFNKTVFFISVSVICCSLPLLTAIITFDGLENLKERIKVN 235

Query: 244 WIILEGVFYILGAFLYGIRFPEKGSPGKY--DIWGHSHQVFHILVVVAALCHLKGLMVSY 301
            I  E V  +  + +Y  RFPE    GK   + W HS  +FH+++  AA  H   L+ SY
Sbjct: 236 AITWELVALVAASIIYVTRFPELFLRGKKKEEGWNHSEYLFHLIISGAAFYHFFILIQSY 295

Query: 302 ELVHKGLSSA 311
            L+H  L+  
Sbjct: 296 ILMHSSLNQP 305

>YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}
           IZH4Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by fatty acids and altered zinc levels; deletion
           reduces sensitivity to excess zinc; possible role in
           sterol metabolism
          Length = 312

 Score = 82.0 bits (201), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 70/246 (28%), Positives = 117/246 (47%), Gaps = 9/246 (3%)

Query: 74  HNESVNVYSHLIPALCFFSVL--FLNKYCVKSFETTS-LVDYLFIDLFFLGAFTCLILSS 130
            NES+    +L+ ++  F +L  F + Y +  F TT+ + DY+  + + L  F   ++  
Sbjct: 61  RNESLVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHF 120

Query: 131 TFHCFKSHSLKV-ATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGT 189
            +H  K+ SL+       K  YL  + L+++S I+ILYY FYD    F  F+ +    G 
Sbjct: 121 IYHFVKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGL 180

Query: 190 ACGVVSLKDHFRSREWRPYRAGLFVAFGLSAI-LPILSGMFAY-GIEEAFHRIQIKWIIL 247
                 L D   S + R  +   F++  +    LP+L+ +  + G+E    RI++  I  
Sbjct: 181 VAYFFILTDKLISSK-RFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKERIKVNAITW 239

Query: 248 EGVFYILGAFLYGIRFPEK--GSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYELVH 305
           E V  +  + +Y  RFPE       K + W HS  +FH+L+   A  H   L+ SY L+H
Sbjct: 240 ELVALVAASIIYVTRFPESLFRRNKKEEGWNHSEYLFHLLISGTAFYHFFILIQSYILMH 299

Query: 306 KGLSSA 311
             L+  
Sbjct: 300 SSLNQP 305

>KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5.197
           YLR023C
          Length = 509

 Score = 82.4 bits (202), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 68/232 (29%), Positives = 113/232 (48%), Gaps = 10/232 (4%)

Query: 41  EIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNESVNVYSHLIPALCFFSVLF--LNK 98
           ++P   ++N +II+ Y R  +S  K + S+F LHNE+ N++SHL+ A+ F  VLF  L  
Sbjct: 197 QLPFPYRENRYIINNY-RFYDSHKKSLLSIFKLHNEATNIWSHLLGAIYFLYVLFHDLPN 255

Query: 99  YCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHS-LKVATFGNKLDYLGIVVL 157
             + S         LF+ LF   +  C++ S+ +H F   S LK+      +DY GI +L
Sbjct: 256 SIIVSSSMVPTTAKLFLYLFVFASLKCMLSSTFYHTFNGTSMLKLRRKFMCVDYSGISIL 315

Query: 158 IVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFG 217
           I +S++SI +   YD   +  F+   +   G     ++    F S E RP R   F+   
Sbjct: 316 ITSSILSIQFISLYDYPNILKFYMCASFMLGVLGIFMNWSPLFDSPEARPLRIKFFILLS 375

Query: 218 LSAILPILSGMFAYGIEEA-FHRIQIKWIILEG--VFYILGAFLYGIRFPEK 266
                 +L  +F   +E++ F  I +   +     V+Y++G   YG   PE+
Sbjct: 376 SCGAFALLHLVF---LEKSIFAAIDVLLPLTNKSIVWYLVGVVFYGSFIPER 424

>KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some
           similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 622

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 71/277 (25%), Positives = 125/277 (45%), Gaps = 23/277 (8%)

Query: 41  EIPEWQKDNEHIIDGYVRETNSFLKCVHSL---FYLHNESVNVYSHLIPALCFFSVLFLN 97
           E+P   ++N +II GY R  +S +K V S+   +  HNE++N++SHL  A+    +LF+ 
Sbjct: 303 ELPFPWRENRYIIHGY-RFYDSHVKSVLSVVNWYGWHNETLNIWSHLFGAVYLAYLLFIQ 361

Query: 98  KYCVKSF--ETTSLVDYLFIDLFFLGAFTCLILSSTFHCFK-SHSLKVATFGNKLDYLGI 154
               K F  +   L   L I +F +    CL+ SS +H    +  L +      +DY GI
Sbjct: 362 LPTTKVFMSQDVPLFGKLIIQVFLIAGVKCLLSSSVWHTLNGTCCLPLRCKFACIDYTGI 421

Query: 155 VVLIVTSMISILYYGFYD------SSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPY 208
            VLI  S++S  +   Y+      S+ M  + S ++L  G     ++    F   E RP+
Sbjct: 422 TVLITASILSTEFVSVYNLATQSLSTSMTVYMS-LSLCLGIFGSFMNWSPRFDRPESRPF 480

Query: 209 RAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGAFLYGIRFPEKGS 268
           R   +V      ++  L    + GI+ +    +  W     ++Y++G   YG   PE+  
Sbjct: 481 RIAFYVLLAGLGMISFLHLTISRGIDHSSQFFKPVW-NRSLIWYLIGVVFYGSFIPER-- 537

Query: 269 PGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYELVH 305
                 W    ++ + +   A LC    ++  ++ VH
Sbjct: 538 ------WRTDVELDYTIPTDAELCSNLDILTKHKHVH 568

>Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON}
           (229517..231250) [1734 nt, 578 aa]
          Length = 577

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 111/235 (47%), Gaps = 14/235 (5%)

Query: 41  EIPEWQKDNEHIIDGY--VRETNSFLKCVHSLFYLHNESVNVYSHLIPALCFFSVL---F 95
           ++P   ++N +II+GY    + +  L  V + +  HNE+ N++SHL+ A+ F  ++   F
Sbjct: 255 QLPFPWRENRYIINGYRFYHKNSKLLLSVFNWYGFHNETANIWSHLLGAIYFAYIVLFEF 314

Query: 96  LNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFK-SHSLKVATFGNKLDYLGI 154
              + V+S E      Y+ + LF L    C++ S  +H F  + S+K+      +DY GI
Sbjct: 315 PKSFIVQSPEVPPSAKYI-VYLFLLAGIKCMLASVFWHTFNGTCSIKLRPKYCCVDYSGI 373

Query: 155 VVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFV 214
            +LI  S+++  +   YD   +   +  ++L FG     ++    F S E RP R   F+
Sbjct: 374 TILITASILTAEFVSLYDHRSIMTVYMSLSLLFGCFGLYLNWSPKFDSPEARPLRIKFFI 433

Query: 215 AFGLSAILPILSGMFAYGIEEA---FHRIQIKWIILEGVFYILGAFLYGIRFPEK 266
                  L      +  G+  A   +  +  K I    V+Y++G F YG   PE+
Sbjct: 434 LLAALGGLAFFHVAYLEGMAYAAWLYSPVTSKSI----VWYLIGVFFYGSFIPER 484

>AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR023C
          Length = 419

 Score = 70.5 bits (171), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 61/259 (23%), Positives = 115/259 (44%), Gaps = 33/259 (12%)

Query: 26  KTATKKITKRIYTWNEIPEWQKDNEHIIDG---YVRETNSFLKCVHSLFYLHNESVNVYS 82
           ++  + + + ++ W E+P   ++N +II G   Y     S L  +++ +  HNE++N++S
Sbjct: 95  ESRARGLARHLHYW-ELPYAWRENRYIIYGHRFYHSHRKSLLSVLNA-YGWHNETINIWS 152

Query: 83  HLIPALCFFSVL---FLNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHS 139
           HL+ A     +L   +      ++ +   L  +  I  F      C+  S  +H F    
Sbjct: 153 HLVGAAVLAYLLCWGWPRSDVYRAAQVPRLAKWA-IGAFLACGVKCMASSVAWHTFNGTC 211

Query: 140 -LKVATFGNKLDYLGIVVLIVTSMISILYYGFYD-SSVMFYFFSFVTLSFGTACGVVSLK 197
            LK+ +    +DY GI +L+  S+++ +    Y  S  + Y +   ++  GTA GV++  
Sbjct: 212 HLKLRSRFVCVDYTGITLLVTASVVTTVAVTLYGLSRPLMYAYMVASIGLGTAAGVMNWS 271

Query: 198 DHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFH-RIQIKW---------IIL 247
            HF   E RP R  ++V            G+ A G+    H  +Q++W         +  
Sbjct: 272 PHFDRPEARPLRIAVYV------------GLAALGLVSFVHVWMQVRWASAHLMAPLVYK 319

Query: 248 EGVFYILGAFLYGIRFPEK 266
             V+Y +G   Y    PE+
Sbjct: 320 SLVWYGIGVVFYATLVPER 338

>TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON}
           Anc_5.197 YLR023C
          Length = 437

 Score = 70.5 bits (171), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 107/234 (45%), Gaps = 12/234 (5%)

Query: 41  EIPEWQKDNEHIIDGYVRETNSFLKCVHSL---FYLHNESVNVYSHL--IPALCFFSVLF 95
           ++P   ++N +II GY R  +S +KC+ S+   +  HNE++N++SHL     L + +V  
Sbjct: 118 QLPFPWRENRYIIKGY-RFYDSNVKCLLSVVNYYGWHNETLNIWSHLGGFLTLLYIAVFV 176

Query: 96  LNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFK---SHSLKVATFGNKLDYL 152
                V   E       + + +F +    C++ S  +H F    S++L+       +DY 
Sbjct: 177 YPNTEVYQSELIPTTAKMLLFVFLIAGMKCMLASVFWHTFDGTCSYTLRPKFCC--VDYT 234

Query: 153 GIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPYRAGL 212
           GI +LI  S+++  Y     + +  + +  ++L+ GT    ++    F   E RP R   
Sbjct: 235 GITILITASILTAEYVSLSHAPIWMFIYMSLSLALGTFGVYINWSPKFDGPEARPLRIKF 294

Query: 213 FVAFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGAFLYGIRFPEK 266
           FV       L  +  +F   +  A   +    I    ++Y++G F YG   PEK
Sbjct: 295 FVTLSAMGCLSFVHLIFTTSLRHACWLLA-PIISKSTIWYVIGVFFYGSFIPEK 347

>TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {ON}
           Anc_5.197 YLR023C
          Length = 569

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 63/236 (26%), Positives = 107/236 (45%), Gaps = 15/236 (6%)

Query: 41  EIPEWQKDNEHIIDGYVRETNSFLKCVHSLFY---LHNESVNVYSHLIPA---LCFFSVL 94
           E+P   ++N++II GY R  + F + + S+F    +HNE+ N+++H++ A   +   +V 
Sbjct: 248 ELPFPWRENKYIIHGY-RFHDKFYQLILSVFNWYGVHNETTNIWTHMLAAFYLIYLLTVD 306

Query: 95  FLNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFK-SHSLKVATFGNKLDYLG 153
           F   + V   E         I +F      C+  S  +H F  + S+++      +DY G
Sbjct: 307 FQKTFIVLDTEHVPATTKYIIYMFLGAGIKCMFASVFWHTFNGTTSIRLRPKFCCVDYTG 366

Query: 154 IVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLF 213
           I +LI  S++S  Y   YD      F+  ++  F      ++    F S E RP R   F
Sbjct: 367 ITLLISASIMSAEYITLYDYPKAMSFYMILSGIFAVFGLYLNWSPKFDSPEARPLRIKFF 426

Query: 214 VAFGLSAILPILSGMFAYGIEEA---FHRIQIKWIILEGVFYILGAFLYGIRFPEK 266
           V       L  ++ +   G+  A   F  +  K +I    +YI+G F YG   PE+
Sbjct: 427 VLLAAVGGLSFVNLVCLEGLSRAIWLFSPVTNKSVI----YYIIGVFFYGSFIPER 478

>NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197
          Length = 578

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 107/238 (44%), Gaps = 20/238 (8%)

Query: 41  EIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYL---HNESVNVYSHLIPA--LCFFSVL- 94
           ++P   ++N +II  Y R  +S  K + S+F     HNES N+++HL+ A  L + S+  
Sbjct: 254 QLPFPWRENRYIIYNY-RFYDSHKKSLLSIFNWYGWHNESSNIWTHLLGAIYLIYLSIYD 312

Query: 95  FLNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHS-LKVATFGNKLDYLG 153
           F N    +S E       L + LF   A  CL+ S  +H F   S LK+ +    +DY G
Sbjct: 313 FPNSEIFQS-EKVPTTAKLIVYLFLFAAIKCLLASVFWHTFNGTSFLKLRSKFACVDYSG 371

Query: 154 IVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLF 213
           I +LI  S+++  +   Y S      +  ++LS G     ++    F   E RP R   F
Sbjct: 372 ITILITASILTTEFVTMYSSFFAMCIYMTISLSLGMFGVFMNWSPKFDRPEARPLRIKFF 431

Query: 214 VAFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEG-----VFYILGAFLYGIRFPEK 266
           +      +L  L   +   ++ A       W++        V+Y++G   YG   PE+
Sbjct: 432 ILLASMGVLSFLHLTYLTNLQYA------TWLLTPVTNKSIVWYLVGVVFYGSFIPER 483

>KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.197
           YLR023C
          Length = 538

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 110/240 (45%), Gaps = 24/240 (10%)

Query: 41  EIPEWQKDNEHIIDGYVRETNSFLKCVHSL---FYLHNESVNVYSHLIPALCFFSVLFLN 97
           E+P   ++N +II  Y R  +S +K + S    +  HNE+ N++SH    L FF V++L 
Sbjct: 221 ELPFPWRENRYIIHNY-RFYDSNVKSLLSAINWYGWHNETSNIWSHF---LGFFYVVYLA 276

Query: 98  KY------CVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHS-LKVATFGNKLD 150
            Y        +S    S   ++ + +F   A  CLI S+ +H F   + LK+      +D
Sbjct: 277 VYEFPQSVVFQSDRIPSSAKFV-VYIFLFAAMKCLIASAFWHTFNGTAFLKMRRRFACVD 335

Query: 151 YLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPYRA 210
           Y GI +LI  S+++  +    D   M   +  ++L+ G     ++    F + E RP R 
Sbjct: 336 YSGISILITASILTAEFVTLNDHRPMMILYMTISLTLGIIGVFLNCSPQFDTPEARPLRI 395

Query: 211 GLFVAFGLSAILPILSGMF----AYGIEEAFHRIQIKWIILEGVFYILGAFLYGIRFPEK 266
             F+      +L  ++  +    AY + +    I  K I    V+Y++G   YG   PE+
Sbjct: 396 RFFMLLAAMGVLSFINASYLESWAYAV-DLLSPITNKSI----VWYLVGVVFYGSFIPER 450

>YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON}
           IZH3Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by zinc deficiency; deletion reduces sensitivity
           to elevated zinc and shortens lag phase, overexpression
           reduces Zap1p activity
          Length = 543

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 105/235 (44%), Gaps = 14/235 (5%)

Query: 41  EIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYL---HNESVNVYSHLIPAL--CFFSVLF 95
           ++P   ++N +II GY R  N+  K + S+F     HNE+ N++SHL+ A+   + ++  
Sbjct: 220 QLPFPWRENRYIIHGY-RFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAIYIIYLAIYD 278

Query: 96  LNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHS-LKVATFGNKLDYLGI 154
             +  V             + +F   A  C++ S  +H F   S LK+ +    +DY GI
Sbjct: 279 FPQSEVWRNSQVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDYSGI 338

Query: 155 VVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFV 214
            +LI  S+++  +   Y      Y +  ++L+ G     ++    F   E RP R   F+
Sbjct: 339 TILITASILTTEFVTMYSCYWAMYTYMSISLALGVFGVFMNWSPRFDRPEARPLRIRFFI 398

Query: 215 AFGLSAILPILSGMFAYGIEEA---FHRIQIKWIILEGVFYILGAFLYGIRFPEK 266
                 +L  L  +F   +  A   F  +  K +    V+Y++G   YG   PE+
Sbjct: 399 LLATMGVLSFLHLIFLTDLHYAATLFSPVTYKSV----VWYLVGVVFYGSFIPER 449

>KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 546

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 112/242 (46%), Gaps = 23/242 (9%)

Query: 41  EIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYL---HNESVNVYSHLIPALCFFSVLFLN 97
           E+P   ++N  II GY R  NS+ K + S+F     HNE+VN+++HL  AL +F+ L   
Sbjct: 219 ELPFPWRENRFIIHGY-RFYNSYSKSLLSIFNWYGWHNETVNIWTHLCGAL-YFAFLIFK 276

Query: 98  KYCVKSFETTSLVDYL--FIDLFFLGA-FTCLILSSTFHCFKS-HSLKVATFGNKLDYLG 153
            +   +   + LV     F+   FL A   C + S  +H F     LK  +    +DY G
Sbjct: 277 GFSQTTVYQSELVPTAAKFMAFVFLTAGLECFLFSVVWHTFNGICHLKQRSNCACVDYTG 336

Query: 154 IVVLIVTSMISILYYGFYDSSVMFY-----FFSFVTLSFGTACGVVSLKDHFRSREWRPY 208
           I VL+  S+++  +     SS   +     FF+  + + G     ++    F   E RP 
Sbjct: 337 ITVLVTASILTTEFVTLSGSSDATFTWSLLFFTGASAALGAVGVFMNWSPKFDRPESRPL 396

Query: 209 RAG---LFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEGV-FYILGAFLYGIRFP 264
           R     L  +FG  + L   S +F   ++ +     IK + ++ + +YI+G   YG   P
Sbjct: 397 RIAFYLLLASFGFFSYL--HSRLFNTAVDSS---DLIKPVFMKSLAWYIIGVVFYGTFIP 451

Query: 265 EK 266
           E+
Sbjct: 452 ER 453

>Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 104/235 (44%), Gaps = 14/235 (5%)

Query: 41  EIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYL---HNESVNVYSHLIPA--LCFFSVLF 95
           ++P   ++N +II GY R  N+  K + S+F     HNE+ N++SHL+ A  L + ++  
Sbjct: 219 QLPFPWRENRYIIHGY-RFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAMYLIYLAIYD 277

Query: 96  LNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHS-LKVATFGNKLDYLGI 154
             +  V             + +F   A  C++ S  +H F   S LK+ +    +DY GI
Sbjct: 278 FPQSEVWKNPKVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDYSGI 337

Query: 155 VVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFV 214
            +LI  S+++  +   Y        +  ++L+ G     ++    F   E RP R   F+
Sbjct: 338 TILITASILTTEFVTMYSCYWAMCTYMGISLALGIFGVFMNWSPRFDRPEARPLRIRFFI 397

Query: 215 AFGLSAILPILSGMFAYGIEEA---FHRIQIKWIILEGVFYILGAFLYGIRFPEK 266
                 +L  L  +F   +  A   F  +  K +    V+Y++G   YG   PE+
Sbjct: 398 LLATMGVLSFLHLIFLTDLRYAARLFSPVTYKSV----VWYLVGVAFYGSFIPER 448

>Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 104/235 (44%), Gaps = 14/235 (5%)

Query: 41  EIPEWQKDNEHIIDGYVRETNSFLKCVHSL---FYLHNESVNVYSHLIPAL--CFFSVLF 95
           ++P   ++N +II GY R  N+  K + S+   +  HNE+ N++SHL+ A+   + ++  
Sbjct: 219 QLPFPWRENRYIIHGY-RFYNTHSKSLLSIINWYGWHNETSNIWSHLLGAMYIIYLAIYD 277

Query: 96  LNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHS-LKVATFGNKLDYLGI 154
             +  V             + +F   A  C++ S  +H F   S L++ +    +DY GI
Sbjct: 278 FPQSEVWRNPNVPQQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLRLRSKFACVDYSGI 337

Query: 155 VVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFV 214
            +LI  S+++  +   Y        +  ++L+ G     ++    F   E RP R   F+
Sbjct: 338 TILITASILTTEFVTMYSCYWAMCTYMGISLALGVIGVFMNWSPRFDRPEARPLRIRFFI 397

Query: 215 AFGLSAILPILSGMFAYGIEEA---FHRIQIKWIILEGVFYILGAFLYGIRFPEK 266
                 +L  L  +F   I  A   F  +  K +    V+Y++G   YG   PE+
Sbjct: 398 LLATMGVLSFLHLIFLTDIYYASRLFGPVTYKSV----VWYLVGVVFYGSFIPER 448

>ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 531

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/241 (22%), Positives = 105/241 (43%), Gaps = 26/241 (10%)

Query: 41  EIPEWQKDNEHIIDGY---VRETNSFLKCVHSLFYLHNESVNVYSHLIPAL-----CFFS 92
           ++P   ++N++II GY        SFL  + + +  HNE+ N+++HL+  L      F+ 
Sbjct: 209 QLPFPYRENKYIIHGYRFYASHKKSFLSII-NWYGWHNETSNIWTHLLGGLYLIYLAFYH 267

Query: 93  VLFLNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFK-SHSLKVATFGNKLDY 151
               N +        +      + +F   A  C+  S  +H F  +H L++ +    +DY
Sbjct: 268 FPHSNIWLSDRVPKPAKC---IVAVFLAAAIKCMFASVFWHTFNGTHLLRLRSKFACVDY 324

Query: 152 LGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPYRAG 211
            GI +LI  S++++ +   YD  +   F+   +L+ G     ++    F   E RP R  
Sbjct: 325 TGITILITASILTVEFVTMYDYKISLLFYMICSLALGIIGVSMNWSPKFDRPEARPLRIK 384

Query: 212 LFV---AFGLSAILPIL---SGMFAYGIEEAFHRIQIKWIILEGVFYILGAFLYGIRFPE 265
            F+     G S+ + ++   +  +A  +        + W       Y++G F YG   PE
Sbjct: 385 FFILLATVGCSSFIRLVFLTNWRYAADLLTPLTNKSVVW-------YLIGVFFYGSFIPE 437

Query: 266 K 266
           +
Sbjct: 438 R 438

>NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.197
           YLR023C
          Length = 543

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 102/237 (43%), Gaps = 18/237 (7%)

Query: 41  EIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYL---HNESVNVYSHLIPAL--CFFSVLF 95
           ++P   ++N +II  Y R  +S  K + S+F     HNE+ N+++HLI  L   + +V  
Sbjct: 220 QLPFPWRENRYIIYNY-RFYDSHKKSLLSIFNWYGWHNETSNIWTHLIGGLYLIYMAVYD 278

Query: 96  LNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFK-SHSLKVATFGNKLDYLGI 154
             +  +   +       L + LF   A  CL  S  +H F  + +LK+ +    +DY GI
Sbjct: 279 FPRSEIFLSDKIPTTAKLIVYLFLFAAIKCLFASVFWHSFNGTCTLKLRSKFACVDYSGI 338

Query: 155 VVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFV 214
            +LI  S+++  +   Y S      +  ++LS G     ++    F   E RP R   FV
Sbjct: 339 SILITASILTTEFVTLYSSYRAMCVYMAISLSLGIFGVFMNWSPKFDRPEARPLRIKFFV 398

Query: 215 AFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEG-----VFYILGAFLYGIRFPEK 266
                 +L  L   F    + A       W++        V+Y +G   YG   PE+
Sbjct: 399 LLASMGVLSFLHLTFLTDWKYA------TWLLAPVTNKSIVWYCIGVVFYGSFIPER 449

>TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {ON}
           Anc_5.197 YLR023C
          Length = 450

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 104/239 (43%), Gaps = 22/239 (9%)

Query: 41  EIPEWQKDNEHIIDGYVRETNSFLKCVHSL---FYLHNESVNVYSHLIPAL--CFFSVLF 95
           ++P   ++N  II GY R  +S  K + S+   +  HNE+ N+++HL  AL   + +V  
Sbjct: 136 QLPFPWRENRFIIHGY-RFYDSHYKSLLSIVNWYGWHNETANIWTHLGGALYVLWLAVYD 194

Query: 96  LNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFK-SHSLKVATFGNKLDYLGI 154
             +  V   E   +V    + +F   A  C++ S   H F  +  L + +    +DY GI
Sbjct: 195 FPRTSVWESEQVPMVAKCIVYVFLAAALKCMLASVFGHTFNGTCCLALRSKFACVDYSGI 254

Query: 155 VVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFV 214
            +LI  S+++  +   Y+      F+  V+   G    +++    F   E RP R   F+
Sbjct: 255 TMLITASILTTEFVTMYNYPWSLRFYLAVSTVLGIFGVIMNWSPKFDRPEARPLRIKFFI 314

Query: 215 AF----GLSAILPILSGMFAYG---IEEAFHRIQIKWIILEGVFYILGAFLYGIRFPEK 266
                 GLS +   L G + Y    +    H+          V+Y+LG   YG   PE+
Sbjct: 315 LLAAMGGLSFMQLGLLGGWKYASWLMAPVTHK--------SLVWYLLGVAFYGSFVPER 365

>Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023C -
           Hypothetical ORF [contig 94] FULL
          Length = 566

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 65/241 (26%), Positives = 109/241 (45%), Gaps = 21/241 (8%)

Query: 41  EIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYL---HNESVNVYSHLIPALCFFSVLF-- 95
           E+P   ++N  II GY R  NS+ K + S+F     HNE+VN+++HL  AL    +LF  
Sbjct: 239 ELPFPWRENRFIIHGY-RFYNSYKKSLLSIFNWYGWHNETVNIWTHLGGALYLAYLLFRG 297

Query: 96  LNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKS-HSLKVATFGNKLDYLGI 154
            ++  V   E           +F L    C + S  +H F     L+  +    +DY GI
Sbjct: 298 FSQTAVYQSELVPTAAKCMAFVFLLSGLECFLFSVVWHTFNGICHLQQRSNCACVDYTGI 357

Query: 155 VVLIVTSMIS---ILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPYRAG 211
            +L+  S+++   +   G  ++   +    F T S  +  GV+ +  ++  +  RP    
Sbjct: 358 TILVTASILTTEFVTLSGAAEAPFTWSLLFFTTTS--SILGVIGVYMNWSPKFDRPESRP 415

Query: 212 LFVAFGLSAILPILSGMFAYGIEEAFHRI-----QIKWIILEGV-FYILGAFLYGIRFPE 265
           L +AF L   L    G F+Y     FH        IK ++ + + +Y++G   YG   PE
Sbjct: 416 LRIAFYL---LLASFGFFSYLHSRIFHTSISSSELIKPVLSKSLAWYLIGVVFYGTFIPE 472

Query: 266 K 266
           +
Sbjct: 473 R 473

>Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {ON}
           YLR023C (REAL)
          Length = 541

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 107/236 (45%), Gaps = 16/236 (6%)

Query: 41  EIPEWQKDNEHIIDGYVRETNSFLKCVHSL---FYLHNESVNVYSHLIPAL--CFFSVL- 94
           ++P   ++N +II GY R  N+  K + S+   +  HNE+ N+++HL+ A+   + +V  
Sbjct: 219 QLPFPWRENRYIIHGY-RFYNTHYKSLLSVINWYGWHNETSNIWTHLLGAMYIVYLAVYD 277

Query: 95  FLNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHS-LKVATFGNKLDYLG 153
           F +    ++ E      ++ +  F   A  C++ S  +H F   S L + +    +DY G
Sbjct: 278 FPHSEVWQNPEVPQQARWI-VFAFLAAALKCMLSSVFWHTFNGTSFLGLRSKFACVDYSG 336

Query: 154 IVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLF 213
           I +LI  S+++  +   Y        +  ++L+ G     ++    F   E RP R   F
Sbjct: 337 ITILITASILTTEFVTMYSCYWAMCTYMTISLALGVFGVFMNWSPRFDRPEARPLRIRFF 396

Query: 214 VAFGLSAILPILSGMFAYGIEEA---FHRIQIKWIILEGVFYILGAFLYGIRFPEK 266
           +      +L  L  +F   +  A   F  +  K +    V+Y++G   YG   PE+
Sbjct: 397 ILLATMGVLSFLHLIFLTDLHYAIWLFSPVTNKSV----VWYLVGVVFYGSFIPER 448

>Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}
           similar to Ashbya gossypii AAL153C
          Length = 568

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/234 (21%), Positives = 103/234 (44%), Gaps = 11/234 (4%)

Query: 41  EIPEWQKDNEHIIDG---YVRETNSFLKCVHSLFYLHNESVNVYSHLIPALCFFSVLFLN 97
           E+P+  ++N +II G   Y     S L  ++ ++  HNE++N++SH+  A+    ++   
Sbjct: 244 ELPQPWRENPYIIYGHRFYHSHKKSLLSILN-VYGWHNETINIWSHIAGAIILLYIMLRG 302

Query: 98  KYCVKSFETTSL--VDYLFIDLFFLGAFTCLILSSTFHCFKSHS-LKVATFGNKLDYLGI 154
                 F +T +  V    I +F L    C++ S  +H F     L + +  + +DY GI
Sbjct: 303 FPNSDVFNSTQVPKVAKGAIYVFLLCGIKCMVSSVMWHTFSGTCHLPLRSRFSCVDYTGI 362

Query: 155 VVLIVTSMISILYYGFYD-SSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLF 213
            +LI  S+++   +  Y  +    Y +  ++L  G      +    F   + R +R   +
Sbjct: 363 TILITASVMTTEAFTLYRLAPKAMYLYMGISLCLGVFAAFTNWSRRFDGPDSRIFRVAFY 422

Query: 214 VAFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEG-VFYILGAFLYGIRFPEK 266
           V      ++  +        + +  R+ I  +I +  V+Y++G   Y    PE+
Sbjct: 423 VILAGLGLISFVH--LTVHSDWSSSRLMITPLINKSIVWYLIGVVFYATLVPER 474

>CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q07959 Saccharomyces cerevisiae
           YLR023c
          Length = 545

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 64/241 (26%), Positives = 105/241 (43%), Gaps = 26/241 (10%)

Query: 41  EIPEWQKDNEHIIDGYVRETNSFLKCVHSL---FYLHNESVNVYSHLIPALCFFSVLFLN 97
           E+P   ++N  II+GY R  NS  K + S+   +  HNE+ N+++HL+  L    ++F  
Sbjct: 218 ELPFPWRENRCIINGY-RFYNSHKKSLLSIVNWYGWHNETSNIWTHLLGGLYILYLMFYQ 276

Query: 98  KYCVKSF--ETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHSL-KVATFGNKLDYLGI 154
               + F  E       L   +F + A  CL  S  +H F   SL ++      +DY GI
Sbjct: 277 FPSSEVFMSEQVPKAAKLITYVFLIAAAKCLFSSVFWHTFNGTSLLRLRCKFACVDYSGI 336

Query: 155 VVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGV----VSLKDHFRSREWRPYRA 210
            +LI  S+++  +   Y     +   S++ LS  TA G+    ++    F   E RP R 
Sbjct: 337 SILITASILTTEFVTMYQCP--WAMVSYMALS--TALGIFGVFMNWSPKFDRPEARPLRI 392

Query: 211 GLFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWII-----LEGVFYILGAFLYGIRFPE 265
             F+      IL  L   F   +  +       W++        V+Y++G   YG   PE
Sbjct: 393 KFFILLASMGILSFLHLTFITSLSHS------TWLLSPITKKSVVWYLVGVVFYGSFIPE 446

Query: 266 K 266
           +
Sbjct: 447 R 447

>SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]
           {ON} some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 563

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 104/244 (42%), Gaps = 24/244 (9%)

Query: 41  EIPEWQKDNEHIIDGYV---RETNSFLKCVHSLFYLHNESVNVYSHL-----IPALCFFS 92
           E+P   ++N  II GY      T S L  + + +  HNE+ N+++HL     I  L F+ 
Sbjct: 236 ELPFPWRENRFIIHGYRFYHSHTKSLLSIL-NWYGWHNETTNIWTHLFGSLYIAYLAFYE 294

Query: 93  VLFLNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFK-SHSLKVATFGNKLDY 151
             F       S +      Y+ + LF    F CL+ S T+H F  +  L + +    +DY
Sbjct: 295 --FPQSSVYLSGDVPQFAKYM-VYLFLGAGFKCLVSSVTWHTFNGTCKLHLRSKFACMDY 351

Query: 152 LGIVVLIVTSMISILYYGFY------DSSVMFYFFSFVTLSFGTAC-GV-VSLKDHFRSR 203
            GI VLI  S+++  +   Y      +S V F    ++ +S    C GV ++    F   
Sbjct: 352 TGITVLITASIMTAEFVSLYGNGDNPNSPVTFSLIFYMAVSSVLCCFGVFMNWSPRFDRP 411

Query: 204 EWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEGV-FYILGAFLYGIR 262
           E RP R   ++       L  L          A     I+ ++ + V +Y++G   YG  
Sbjct: 412 ESRPLRIAFYLLLAGMGFLAFLHLTLITNF--AHSSWLIRPVLDKSVCWYLIGVIFYGSF 469

Query: 263 FPEK 266
            PE+
Sbjct: 470 IPER 473

>KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {ON} 
          Length = 321

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 66/298 (22%), Positives = 124/298 (41%), Gaps = 21/298 (7%)

Query: 19  EDDGGEMKTATKKITKRIYTWNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNESV 78
            +     KTAT   +  IY +  I    + +        R   S L+   S+    + S 
Sbjct: 36  PEKPANNKTATAITSINIYIYKHIHVRTRKHGTTYKNPRRPPMSKLQVQVSVHAQGHRSE 95

Query: 79  NVYSHLIPALCF-FSVLFLNKYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKS 137
             ++  + A+ F   V F + Y V    +T++ DY+ +++F   AF C        CF +
Sbjct: 96  LWWTGSVTAVYFVLLVFFTDVYLVPRHVSTTMTDYVLLNVFLATAFQC-AACHMVQCFTT 154

Query: 138 HSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFG---TACGVV 194
                 T G+ L  + ++     S +++LYY +YD+   F   +  T ++     A  V 
Sbjct: 155 ------TAGSVLSTITMLNHWACSAVTLLYYSYYDNVFYFKLLALFTANWTLVVAAVTVT 208

Query: 195 SLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYIL 254
           S   +   R+W   R  L V   +   +P++ G+  +G  +   R+  + ++ E   Y++
Sbjct: 209 STASNSPKRQWWSRRTLLLVYVVVLVSVPLVVGLLRFGTAKVLRRLDWRLLLAELAVYLI 268

Query: 255 GAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYELVHKGLSSAT 312
               YG    EK +  K          F++    A+L HL+ L+ ++ L+  G +  T
Sbjct: 269 SGVFYG--GTEKDTLPKLP--------FYVAFHTASLIHLQLLLNAFHLMRAGTNKPT 316

>ZYRO0A10274g Chr1 (828154..834159) [6006 bp, 2001 aa] {ON} similar
           to uniprot|P50077 Saccharomyces cerevisiae YGR217W CCH1
           Voltage-gated calcium channel involved in calcium influx
           in response to mating pheromones
          Length = 2001

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 45/92 (48%)

Query: 112 YLFIDLFFLGAFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFY 171
           Y F  +  L  FTCL+   T+    +     + + + +++L  V+  ++ +  I+ +GF+
Sbjct: 329 YRFFMVVMLSLFTCLMAYRTYEPHSNILFSFSNWADVINFLLCVLFTLSDVSKIIAFGFW 388

Query: 172 DSSVMFYFFSFVTLSFGTACGVVSLKDHFRSR 203
           D S MF  +    +S     GV+ L  + R++
Sbjct: 389 DDSEMFAAYGKKYVSLLEKFGVIKLYLYLRNK 420

>NCAS0A07440 Chr1 (1471149..1477172) [6024 bp, 2007 aa] {ON}
           Anc_5.113 YGR217W
          Length = 2007

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 44/96 (45%), Gaps = 7/96 (7%)

Query: 112 YLFIDLFFLGAFTCLILSSTFHCFKSHSLK-VATFGNKLDYLGIVVLI---VTSMISILY 167
           Y FI +  L  FT L+    +  +  H ++ +  F N  DY+  ++ +   +  +  I+ 
Sbjct: 320 YRFIYMVLLSFFTGLL---AYRTYDPHDIQFLYRFSNWSDYVTFILFLFFTINDLTKIIA 376

Query: 168 YGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSR 203
           +GF+D S MF  F    L      G+  L  H R++
Sbjct: 377 FGFWDDSQMFKAFGKDYLPLVERFGISKLYKHLRAK 412

>Smik_15.89 Chr15 (163208..164563) [1356 bp, 451 aa] {ON} YOL069W
           (REAL)
          Length = 451

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 6/47 (12%)

Query: 72  YLHNESVNVYSHLIPALCFFSVLFLNKYCVKSFETTSLVDYLFIDLF 118
           +L +E+ N+YS  +      +VL LNK C K FE   + D+   DL+
Sbjct: 72  HLQDENENIYSDTL------NVLVLNKICFKFFENIGVQDFNMTDLY 112

>Suva_15.96 Chr15 (171608..172963) [1356 bp, 451 aa] {ON} YOL069W
           (REAL)
          Length = 451

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 6/47 (12%)

Query: 72  YLHNESVNVYSHLIPALCFFSVLFLNKYCVKSFETTSLVDYLFIDLF 118
           Y  +E+ N+YS  +      +VL LNK C K FE   + D+   DL+
Sbjct: 72  YFQDENENIYSDTL------NVLVLNKICFKFFENIGVQDFNMTDLY 112

>Skud_15.83 Chr15 (158051..159406) [1356 bp, 451 aa] {ON} YOL069W
           (REAL)
          Length = 451

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 6/46 (13%)

Query: 73  LHNESVNVYSHLIPALCFFSVLFLNKYCVKSFETTSLVDYLFIDLF 118
           L +E+ N+YS  +      +VL LNK C K FE   + D+   DL+
Sbjct: 73  LQDENENIYSDTL------NVLVLNKICFKFFENIGVQDFNMTDLY 112

>KNAG0F03480 Chr6 complement(657351..658997) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 58/130 (44%), Gaps = 9/130 (6%)

Query: 141 KVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHF 200
           +VA FG +  Y+    L +   +           V+  FFS +  S   A G  ++ D  
Sbjct: 165 EVAKFGRQQIYIYTFFLFMVFQVGCATVKNIGGLVVLRFFSGILCSPSLATGGATMGDIV 224

Query: 201 RSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGA--FL 258
            ++ WRP   GL+    ++A  P+L+ +    +  A +   I W++L    ++ GA   L
Sbjct: 225 EAK-WRPVLIGLWAIGAVAA--PVLAPLLGAAMVVAKNWRWIFWLML----WMCGASLIL 277

Query: 259 YGIRFPEKGS 268
           + I FPE  +
Sbjct: 278 FVICFPETSA 287

>YOL069W Chr15 (198942..200297) [1356 bp, 451 aa] {ON}
           NUF2Component of the evolutionarily conserved
           kinetochore-associated Ndc80 complex
           (Ndc80p-Nuf2p-Spc24p-Spc25p); involved in chromosome
           segregation, spindle checkpoint activity and kinetochore
           clustering
          Length = 451

 Score = 30.0 bits (66), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 6/47 (12%)

Query: 72  YLHNESVNVYSHLIPALCFFSVLFLNKYCVKSFETTSLVDYLFIDLF 118
           +L  E+ N+Y      L   +VL LNK C K FE   + D+   DL+
Sbjct: 72  HLQEENENIY------LDTLNVLVLNKICFKFFENIGVQDFNMTDLY 112

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.329    0.142    0.445 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,588,326
Number of extensions: 1413743
Number of successful extensions: 4743
Number of sequences better than 10.0: 85
Number of HSP's gapped: 4792
Number of HSP's successfully gapped: 85
Length of query: 314
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 205
Effective length of database: 40,982,805
Effective search space: 8401475025
Effective search space used: 8401475025
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 65 (29.6 bits)