Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0M012306.25ON73873838690.0
NCAS0H008606.25ON75575920830.0
KAFR0G026606.25ON73574120670.0
Suva_15.1766.25ON74574619760.0
Kpol_1037.296.25ON74676219670.0
SAKL0E01452g6.25ON73775619650.0
Skud_15.1626.25ON73474619050.0
CAGL0E02585g6.25ON73775219020.0
YOR001W (RRP6)6.25ON73374518920.0
NDAI0D008506.25ON79076718900.0
Smik_15.1706.25ON77374618890.0
ZYRO0C07678g6.25ON74175518660.0
TDEL0G044406.25ON73574718630.0
TBLA0A071706.25ON77175018640.0
TPHA0J003706.25ON74374918420.0
KLLA0D01309g6.25ON74474818280.0
ACL001C6.25ON74575617760.0
Kwal_56.224476.25ON73574417590.0
Ecym_30306.25ON74775117560.0
KLTH0C11066g6.25ON73574417400.0
KAFR0G004208.860ON37449771.0
Ecym_71517.403ON53679725.5
KLLA0F24244g2.143ON92792717.0
TPHA0B033508.239ON69046717.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0M01230
         (738 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {...  1494   0.0  
NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {O...   806   0.0  
KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.2...   800   0.0  
Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001...   765   0.0  
Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {O...   762   0.0  
SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} simila...   761   0.0  
Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001...   738   0.0  
CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} simila...   737   0.0  
YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nucle...   733   0.0  
NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {O...   732   0.0  
Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001...   732   0.0  
ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} simila...   723   0.0  
TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.2...   722   0.0  
TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6...   722   0.0  
TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON...   714   0.0  
KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} simila...   708   0.0  
ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON} S...   688   0.0  
Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001...   682   0.0  
Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to ...   681   0.0  
KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {...   674   0.0  
KAFR0G00420 Chr7 (122124..123248) [1125 bp, 374 aa] {ON} Anc_8.860     34   1.0  
Ecym_7151 Chr7 complement(311699..313309) [1611 bp, 536 aa] {ON}...    32   5.5  
KLLA0F24244g Chr6 complement(2261810..2264593) [2784 bp, 927 aa]...    32   7.0  
TPHA0B03350 Chr2 complement(771611..773683) [2073 bp, 690 aa] {O...    32   7.7  

>KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {ON}
           Anc_6.25 YOR001W
          Length = 738

 Score = 1494 bits (3869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 728/738 (98%), Positives = 728/738 (98%)

Query: 1   MDSEEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSI 60
           MDSEEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSI
Sbjct: 1   MDSEEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSI 60

Query: 61  DENSKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLV 120
           DENSKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLV
Sbjct: 61  DENSKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLV 120

Query: 121 GNDSSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHY 180
           GNDSSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHY
Sbjct: 121 GNDSSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHY 180

Query: 181 PNPYDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDL 240
           PNPYDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDL
Sbjct: 181 PNPYDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDL 240

Query: 241 EHHDYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIW 300
           EHHDYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIW
Sbjct: 241 EHHDYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIW 300

Query: 301 LQRDLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMS 360
           LQRDLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMS
Sbjct: 301 LQRDLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMS 360

Query: 361 VYARADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPI 420
           VYARADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPI
Sbjct: 361 VYARADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPI 420

Query: 421 EKESPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTD 480
           EKESPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTD
Sbjct: 421 EKESPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTD 480

Query: 481 PVSLVSVNSYVTDCVRSNSKVLANLIKSFVESSKLGPQSSYTPNTENTSTPFVLTLSQIK 540
           PVSLVSVNSYVTDCVRSNSKVLANLIKSFVESSKLGPQSSYTPNTENTSTPFVLTLSQIK
Sbjct: 481 PVSLVSVNSYVTDCVRSNSKVLANLIKSFVESSKLGPQSSYTPNTENTSTPFVLTLSQIK 540

Query: 541 DIGMRFTKLTENFQSSSCQKISPLQRSSFFGDLSKGKVTVSYNDAKTTPVSQSVLESRSK 600
           DIGMRFTKLTENFQSSSCQKISPLQRSSFFGDLSKGKVTVSYNDAKTTPVSQSVLESRSK
Sbjct: 541 DIGMRFTKLTENFQSSSCQKISPLQRSSFFGDLSKGKVTVSYNDAKTTPVSQSVLESRSK 600

Query: 601 QFNEYMKAFGDIEYKIPSIVEPVMDLPIPSGTTSTESADSKTVEKPPKNIKEDMDEIVVL 660
           QFNEYMKAFGDIEYKIPSIVEPVMDLPIPSGTTSTESADSKTVEKPPKNIKEDMDEIVVL
Sbjct: 601 QFNEYMKAFGDIEYKIPSIVEPVMDLPIPSGTTSTESADSKTVEKPPKNIKEDMDEIVVL 660

Query: 661 KKVKRELPKPKGNDEDAEREIVDYSKEDKVLVQRQFDXXXXXXXXXXRFDPFSAISEGPK 720
           KKVKRELPKPKGNDEDAEREIVDYSKEDKVLVQRQFD          RFDPFSAISEGPK
Sbjct: 661 KKVKRELPKPKGNDEDAEREIVDYSKEDKVLVQRQFDKKKKNNNNKKRFDPFSAISEGPK 720

Query: 721 APKKRKAVTKGKNASFKR 738
           APKKRKAVTKGKNASFKR
Sbjct: 721 APKKRKAVTKGKNASFKR 738

>NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {ON}
           Anc_6.25 YOR001W
          Length = 755

 Score =  806 bits (2083), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/759 (54%), Positives = 538/759 (70%), Gaps = 34/759 (4%)

Query: 4   EEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSIDEN 63
           E++K LL K V TVRA+S+L  QDV F+ ++D ++A S+++  N++ +MIN +L SIDEN
Sbjct: 7   EQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVLLSIDEN 66

Query: 64  SKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQG-TRKNGQAGSEVQYLDDLVGN 122
           S+    + E + + W+DF NL DNLFEKSDRS+DII +G    NGQ+G  +QY+D+  G 
Sbjct: 67  SEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSG--MQYIDEFSGR 124

Query: 123 DSSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHYPN 182
           D + GK+I KPQL F+ P+DN+ES PF PLL EKP ALKPL+ES+QM+P  E  P HYP 
Sbjct: 125 DLTPGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPMHYPQ 184

Query: 183 PYDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDLEH 242
           PY+YEI +QEYN+ IL+ + PIPST W ++EP+WVD+   LQS++ DL+   E+A+DLEH
Sbjct: 185 PYEYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAVDLEH 244

Query: 243 HDYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIWLQ 302
           HDYR+YYGI CLMQISTR  DYL+DT+ALR++L ILN VF +PM+TKVFHGAFMDIIWLQ
Sbjct: 245 HDYRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDIIWLQ 304

Query: 303 RDLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMSVY 362
           RDLGLY+V LFDTFHAS+A+G PKHSLAYLLE  A FKTSKKYQLADWRIRPLSK M  Y
Sbjct: 305 RDLGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMHAY 364

Query: 363 ARADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPD--VFTPI 420
           ARADTHFLLNIFDQMRN LI+ NKLAGVL ESR VAKRRFEYS FRPK+ Q +  V++PI
Sbjct: 365 ARADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLVYSPI 424

Query: 421 EKESPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTD 480
           EK+ PW+T+MFQYN+ P+KE L+K LY+WRD IARRDDESPR++MPNQLL+SL AYTP D
Sbjct: 425 EKDDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAYTPID 484

Query: 481 PVSLVSVNSYVTDCVRSNSKVLANLIKS---------FVESSKLGPQSSYTPNTENTSTP 531
              +VSV++ VTD VRSNSK+LANLIK+         F++++      S  P T +  + 
Sbjct: 485 APGVVSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDNNVAEEGISVVPETGHDLSQ 544

Query: 532 FVLTLSQIKDIGMRFTKLTENFQSSSCQKISPLQRSSFFGDLS-KGKVTVSY-NDAKTTP 589
             LT+ Q++++  +F  L++ F +S   ++S   +   F  +S    VT+ Y  D K   
Sbjct: 545 -KLTIHQLQNLKSKFQLLSDKFNNSVKTRLSNHDQLYLFDGISFADDVTIKYFADGKIQT 603

Query: 590 VSQSVLESRSKQFNEYMKAFGDIEYKIPSIVEPVM-----DLPIPSGTTSTESADSKTVE 644
            ++   E RS+QF++ MK   ++EY IP I E        ++P  +  T+ E   ++ +E
Sbjct: 604 TAEQYKE-RSEQFDDAMKQLEEVEYCIPVIEENKQTQDQDNIPPITVATNAEGQVNEMIE 662

Query: 645 KPPKNIKEDMDEIVVLKKVKRELP---KPKGNDEDAEREIVDYSKEDKVLV--QRQFDXX 699
           KP     ED+DE++VL+K  +      KPK N E+ E EI+DY K  KVL   +      
Sbjct: 663 KP-----EDLDEVIVLRKTNKNKSIKNKPK-NREEPELEIIDYFKTAKVLTNDKNSRGGR 716

Query: 700 XXXXXXXXRFDPFSAISEGPKAPKKRKAVTKGKNASFKR 738
                   RFDP+SA +EGP APKKRK VT+GKN SFKR
Sbjct: 717 NNNGNKRKRFDPYSAANEGPAAPKKRKNVTRGKNVSFKR 755

>KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  800 bits (2067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/741 (53%), Positives = 522/741 (70%), Gaps = 16/741 (2%)

Query: 4   EEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSIDEN 63
           EEQKKLLS  V TVRASS+L  QDV F+ +LD+ V+ S+ E+ +E+ +M+N I+ SIDEN
Sbjct: 4   EEQKKLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSIDEN 63

Query: 64  SKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLVGND 123
            +   E  E++ ESW+  +N+ DNLFEKSDRS+DI+  G +K        +Y ++    +
Sbjct: 64  YETLDEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKP-TNPPFEYFENATTTE 122

Query: 124 SSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHYPNP 183
           +   KRI KPQL F  P+DNSES PF PLL EKPNALK + ES +++ + EN+P HY +P
Sbjct: 123 NIPQKRINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYAHP 182

Query: 184 YDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDLEHH 243
           Y+YEI NQ YN+ IL+ R PIPS  W E+E VWVD+ E L  +L D+KKY E+AIDLEHH
Sbjct: 183 YEYEIDNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLEHH 242

Query: 244 DYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIWLQR 303
           DYR+YYGIVCLMQISTR+TDYLVDTIALR++L +LN+VFTDP V KV HGAFMDIIWLQR
Sbjct: 243 DYRTYYGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWLQR 302

Query: 304 DLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMSVYA 363
           DLGLYIVSLFDTFHAS+ALGFP+HSLAYLLE  ANFKTSKKYQLADWR+RPLSK M+ YA
Sbjct: 303 DLGLYIVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTAYA 362

Query: 364 RADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPIEKE 423
           RADTHFLLNI+DQ+RN+L++ NKL GVL ESR VAKRRFEYSKFRP++  P+V++ +EKE
Sbjct: 363 RADTHFLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALEKE 422

Query: 424 SPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTDPVS 483
            PWRTLMFQYN+  E+E+L+K L+EWRD IARRDDESPRYIMPNQL+++L AYTPTDP  
Sbjct: 423 DPWRTLMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDPAG 482

Query: 484 LVSVNSYVTDCVRSNSKVLANLIKSFVESSK-LGPQSSYTPNT---ENTSTPFVLTLSQI 539
           ++S +  VTD VRSNSK++ANLIK+ +  +K    Q  +  +    E+  +   +T+SQI
Sbjct: 483 VISASQVVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVADNHTRESYRSTDKMTVSQI 542

Query: 540 KDIGMRFTKLTENFQSSSC--QKISPLQRSSFFGDLSKGKVTVSYNDAKTTPVSQSVLES 597
           K+    F ++ E   + +   Q+     RS++FG LSK    + Y + +   V Q  L S
Sbjct: 543 KETASVFIQIAEKLGTCNNDQQQSKSFARSNYFGSLSKKLDIIEYKNGEKHSVKQQQLVS 602

Query: 598 RSKQFNEYMKAFGDIEYKIPSIVEPVMDLPIPSGTTSTESADSKTVEKPPKNIKEDMDEI 657
           R   + + +    ++ Y++P   EP    P        E   +   +  P   + D+DE+
Sbjct: 603 RFNTYTKQVNELTNVRYELPVHKEP----PQLQKDDVEEVKKTIIADSIPAKPEIDLDEV 658

Query: 658 VVLKKVKRELPKPKGNDEDAEREIVDYSKEDKVLVQRQFDXXXXXXXXXXR-FDPFSAIS 716
           VVLKKV R+ P     +E+ + + +DYSK +K+L   + D          R FDPF+A +
Sbjct: 659 VVLKKVNRQ-PNKTKLEENEKIDFIDYSKSEKIL---KGDKQRKKRESKKRQFDPFAASN 714

Query: 717 EGPKAPKKRKAVTKGKNASFK 737
           EGPKA +KRK+ T+G+N S+K
Sbjct: 715 EGPKAARKRKSGTRGRNLSYK 735

>Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001W
           (REAL)
          Length = 745

 Score =  765 bits (1976), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/746 (52%), Positives = 505/746 (67%), Gaps = 27/746 (3%)

Query: 1   MDSEEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSI 60
           M SE    LLSK V  +RA+SSL  QDV F+ NLD + +  ++   +++ EM+N I+ SI
Sbjct: 19  MASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSI 78

Query: 61  DENSKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLV 120
           DE+        E++ + W+DF N+ DNL EKSD S+D + + +  N  A  ++QYL D  
Sbjct: 79  DEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAA-DLQYLGDFS 137

Query: 121 GNDSSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHY 180
           G DS   KR+ KPQL F  P+DNSES PF PLL EKPNALKPL +SL+M+   EN P HY
Sbjct: 138 GKDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHY 197

Query: 181 PNPYDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDL 240
           P+PY+YEI +QEYN +IL+ +  IPS PW  SEP+W++S   L+S+L+DLK   E+A+DL
Sbjct: 198 PHPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDL 257

Query: 241 EHHDYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIW 300
           EHHDYRSYYG+VCLMQ+STR+ DYLVDT+ LR++LHILN+VFT+P + KVFHGAFMDIIW
Sbjct: 258 EHHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIW 317

Query: 301 LQRDLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMS 360
           LQRDLGLY+V LFDT+HASKA+G P+HSLAYLLE  ANFKTSKKYQLADWRIRPLSKPM+
Sbjct: 318 LQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMT 377

Query: 361 VYARADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPI 420
            YARADTHFLLNI+DQ+RN+LI+ NKLAGVL ESR VAKRRFEYSK+RP      V++P 
Sbjct: 378 AYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPT 437

Query: 421 EKESPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTD 480
           EKE+PWR LM+QYN+ PE+EELVK LYEWRD IARRDDESPR+IMPNQLL +L AYTP D
Sbjct: 438 EKENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPID 497

Query: 481 PVSLVSVNSYVTDCVRSNSKVLANLIKSFVESSKLGPQSSYTPNTENTSTPF------VL 534
            + +VS+++ VTD VR N+K+LANLIKS + S K     ++  + E  S+ F       +
Sbjct: 498 VIGVVSLSNGVTDHVRQNAKILANLIKSALRSMK----DTHKESAEIVSSKFKSASLEAI 553

Query: 535 TLSQIKDIGMRFTKLTENFQSSSCQKISPLQRSSFFGD-LSKGKVTVSYNDAKT-TPVSQ 592
           T+SQI+DI  RF+  + N   +  + +     S  FG  L   +  + Y D+     V  
Sbjct: 554 TVSQIRDIMDRFSVFSSN-SVTEDRSMDSTASSILFGKILPYEEGDIVYEDSGLPHKVKV 612

Query: 593 SVLESRSKQFNEYMKAFGDIEYKIPSIVEPVMDLPIPSGTTSTESADSKTVEKPPKNIKE 652
             +  R+++FN  +    DI++++            P     +E    +T  +PP  I E
Sbjct: 613 EDMRDRAQRFNSALVGLEDIKFEVEK----------PVNVEKSEMVKIETTPEPPTKI-E 661

Query: 653 DMDEIVVLKKVKRELPKPKGNDEDAEREIVDYSKEDKVLVQRQFDXXXXXXXXXXRFDPF 712
           D DE+VVLKK +    +     + A  E VDYSK   VL  +             RFDP 
Sbjct: 662 DPDEVVVLKKKRIHKKQVAKRSDVAAEEAVDYSKIPNVLSSKP--GQNNKQQRKRRFDPS 719

Query: 713 SAISEGPKAPKKRKAVTKGKNASFKR 738
              SEGP+APKK++  T+GKN SFKR
Sbjct: 720 FNDSEGPRAPKKKRPTTRGKNVSFKR 745

>Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {ON}
           complement(68981..71221) [2241 nt, 747 aa]
          Length = 746

 Score =  762 bits (1967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/762 (52%), Positives = 517/762 (67%), Gaps = 40/762 (5%)

Query: 1   MDSEEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSI 60
           M  +  K+LLS  V TVRA+SSL  QDV F+ NLD  +++S+ E   E+  MIN +L SI
Sbjct: 1   MSEDINKELLSSVVSTVRAASSLAAQDVDFYRNLDKEISTSLNESSKEITNMINTLLLSI 60

Query: 61  DENSKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLV 120
           +EN++      E + + W+DF+N+ DNLFEKSDRS+DII +    N    SE QYL D  
Sbjct: 61  NENNEELESGKEGLEQYWKDFSNVMDNLFEKSDRSLDIITRSKTSNDNK-SEFQYLSDSA 119

Query: 121 GNDSSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHY 180
            +DS+  KR+TKPQL FSRPVDNSES+PF PLL +KP+++K   +SL ++P +E +PSHY
Sbjct: 120 QSDSNPSKRVTKPQLQFSRPVDNSESKPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHY 179

Query: 181 PNPYDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDL 240
            +PY+ EI  QEYN  +L+   P+ S PW+ SE  WVD++E LQS+L  LK+  E+A+DL
Sbjct: 180 AHPYEVEIDKQEYNASVLQVAEPLKSQPWN-SESTWVDTSEALQSMLDKLKECTEIAVDL 238

Query: 241 EHHDYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIW 300
           EHHDYRSYYGIVCLMQISTR  D+LVDT+ALRDELHILN+VF DP + KV HGAFMDIIW
Sbjct: 239 EHHDYRSYYGIVCLMQISTRKEDFLVDTLALRDELHILNEVFADPNILKVLHGAFMDIIW 298

Query: 301 LQRDLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMS 360
           LQRDLGLY+VSLFDT+HAS+ALGFP+HSLAYLLE  ANFKTSKKYQLADWR+RPLSKPM 
Sbjct: 299 LQRDLGLYVVSLFDTYHASRALGFPRHSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMH 358

Query: 361 VYARADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPI 420
            YARADTHFLLNI+DQ+RNQLI++NKLA VL ESR VAKRRFEYS+FRPK+  P VFTPI
Sbjct: 359 AYARADTHFLLNIYDQIRNQLIRENKLAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPI 418

Query: 421 EKESPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTD 480
           EKE PWRTL++QYNV   K EL+K ++EWRD IARRDDESPRYIMPNQL+ISL  YTP D
Sbjct: 419 EKEEPWRTLVYQYNVPSTKIELLKRIWEWRDMIARRDDESPRYIMPNQLMISLVEYTPID 478

Query: 481 PVSLVSVNSYVTDCVRSNSKVLANLIKSFVESSKLGPQSSYTP--NTE-NTSTPFV---L 534
           P  ++SV++ +TD VRSNSKV+ANLIK  +E  K  P  + T   N +      F    L
Sbjct: 479 PAGVISVSNVMTDHVRSNSKVIANLIKKSLEDMKSVPAGALTAFQNIDYKIGQKFASDKL 538

Query: 535 TLSQIKDIGMRFTKLTEN---FQSSSCQKISPLQRSSFFGDLSKGKVTVSYNDAKTTPVS 591
           T+SQI+++   F ++  N    +    +KI P+  S+ F  LSK ++ V Y+  K   V+
Sbjct: 539 TISQIQNMTALFKEIASNPSIIEKDVSKKIDPILFSNIF--LSKNEI-VLYDHDKRHVVT 595

Query: 592 QSVLESRSKQFNEYMKAFGDIEYKIPSIVEPVMDLPIPSGTTSTESADSKTVEKPP-KNI 650
              L  R+++   +M    +    I       M +  P      E+ +   +  PP  N+
Sbjct: 596 NEQLAGRAEEVEGFMNEANNTTLAINIESSAEMHVEEP------EAKEKNALFSPPISNV 649

Query: 651 K----------EDMDEIVVLKKVKRE--LPKPKGNDEDAEREIVDYSKEDKVLVQRQFDX 698
           +          EDM++I+VLK VK+   +   K       +E++DYSK D +L + + + 
Sbjct: 650 ENASSSNTDGFEDMNDIIVLKDVKKRTNIKDHKKKQGMPNKEVIDYSKLDTILSKEKRE- 708

Query: 699 XXXXXXXXXRFDPFSAIS--EGPKAPKKRKAVTKGKNASFKR 738
                    + DPF   +  EGPKA KKRK + +GKN SFKR
Sbjct: 709 ----NSKKRKGDPFGEENGLEGPKAAKKRKQINRGKNVSFKR 746

>SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 737

 Score =  761 bits (1965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/756 (51%), Positives = 514/756 (67%), Gaps = 39/756 (5%)

Query: 1   MDSEEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSI 60
           M S++  KLLS  VGTVRA+S+L  QD+ FF +LD+ ++ SV+   +++L +IN++L SI
Sbjct: 1   MSSDKPDKLLSNLVGTVRAASALSAQDLDFFKSLDSGISKSVEGSSSKLLNLINEVLLSI 60

Query: 61  DENSKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLV 120
           DEN+       +   ESW+D  ++ DNLFEKSD + D + + +    Q  S VQYLDD  
Sbjct: 61  DENNDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKRNSI--NQGNSNVQYLDDSS 118

Query: 121 GNDSSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHY 180
            ++ +  KRI KPQL+F  P+DN+ES PFKPLL  KP+AL+PL E L+  P TENIPSHY
Sbjct: 119 RSNLNPSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHY 178

Query: 181 PNPYDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDL 240
           P+PY YEI  QEYN  IL+ R PIPS PW +++PVWVD+ E LQ LL +L+  KE+A+DL
Sbjct: 179 PHPYGYEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDL 238

Query: 241 EHHDYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIW 300
           EHHDYRSYYGIVCLMQISTR+ D+LVDTIALR+ELH+LN++FTDP V KVFHGAFMDIIW
Sbjct: 239 EHHDYRSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIW 298

Query: 301 LQRDLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMS 360
           LQRDLG+Y+VSLFDT+HAS++LG P+HSLAYLLE  A FKTSKKYQLADWRIRPL+KPM 
Sbjct: 299 LQRDLGIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMR 358

Query: 361 VYARADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPI 420
            YARADTHFLLNI+DQ+RN LI+ NKLA VL +SR VAKRRFEY+ FRPK+   DVF+PI
Sbjct: 359 AYARADTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPI 418

Query: 421 EKESPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTD 480
           EK+ PWR LM+QYN+   +E L++ LYEWRDTIARRDDESPRY+MPNQLL+SL A  PTD
Sbjct: 419 EKDEPWRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTD 478

Query: 481 PVSLVSVNSYVTDCVRSNSKVLANLIKSFVESSKLGPQSSYTPNT---ENTSTPFVLTLS 537
           P  ++SV++++TD VRSNSK+L+NLIK  +ES K G  S+    +   E      VL++S
Sbjct: 479 PAGVLSVSNFITDYVRSNSKMLSNLIKKTLESLKNGDVSTNNAGSSQLEEKDLSQVLSIS 538

Query: 538 QIKDIGMRFTKLTE-----NFQSSSCQKISPLQRSSFFGD-LSKGKVTVSYNDAKTTPVS 591
           QI+++ ++F  L       N  ++S  K+S L    F GD +      V Y+      + 
Sbjct: 539 QIQNMCLQFNSLASKVKKANSATNSMPKVSIL----FDGDHIFSNDRAVLYSKNSKIVID 594

Query: 592 QSVLESRSKQFNEYMKAFGDIEYKIPSIVEPVMDLPIPSGTTSTESADSKTVEKPPKN-- 649
           ++ L+ R  + +E          K+  + EP   L +   T  T+       EK   N  
Sbjct: 595 ENQLQERKLEVSE----------KLKEVQEPDFRLHVNVTTKETDEVSKDVSEKDDVNRA 644

Query: 650 -----IKEDMDEIVVLKKVKRELPKPK---GNDEDAEREIVDYSKEDKVLVQRQFDXXXX 701
                ++ + DEI+VLKK KR  P+ +   GN  D E   +DY   +K+L   +      
Sbjct: 645 SETDPLETNKDEIIVLKKKKRHEPQDRKKVGNSTDVEP--MDYKNAEKLLGNSK--KSSK 700

Query: 702 XXXXXXRFDPFSAISEGPKAPKKRKAVTKGKNASFK 737
                 RFDP+++ + GP++ KKRK  T GKN SFK
Sbjct: 701 QKTTKRRFDPYTSENVGPQSAKKRKKPTPGKNMSFK 736

>Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001W
           (REAL)
          Length = 734

 Score =  738 bits (1905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/746 (52%), Positives = 508/746 (68%), Gaps = 20/746 (2%)

Query: 1   MDSEEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSI 60
           M SE    L SK V  VRA+SSL  QDV F+ NL+   ++ +K   +++ +M+N+I+ SI
Sbjct: 1   MPSENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSI 60

Query: 61  DENSKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLV 120
           DE+ + F    +++   W+DF N+ DNL E SD S+D +   T  +  +G+E+QYL D  
Sbjct: 61  DEHHESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNH-TANSKVSGAELQYLGDFS 119

Query: 121 GNDSSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHY 180
           G DS S KR+ KPQL F + +DNSES PF PLL EKPNALKPL ESL++  A EN PSHY
Sbjct: 120 GKDSLSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPLSESLRLAEAEENNPSHY 179

Query: 181 PNPYDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDL 240
            +PY YEI +QEY++D+L+ +  IPS  W +SEP+W+D+   L  +L+DLK   E+A+DL
Sbjct: 180 LHPYAYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDL 239

Query: 241 EHHDYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIW 300
           EHHDYRSYYGIVCLMQ+STR+ DYLVDTI LRD LHILN+VFTDP++ KVFHGAFMDIIW
Sbjct: 240 EHHDYRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIW 299

Query: 301 LQRDLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMS 360
           LQRDLGLY+V LFDT+HASKA+G P+HSLAYLLE  ANFKTSKKYQLADWR RPLSKPM+
Sbjct: 300 LQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMT 359

Query: 361 VYARADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPI 420
            YARADTHFLLNI+DQ+RN+LI+ NKLAGVL ESR VAKRRFEYSK RP+    +V++PI
Sbjct: 360 AYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPI 419

Query: 421 EKESPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTD 480
           EKE+PWR LM+QYN+T EKEELVK LY WRD IARRDDESPR++MPNQLL +L AY P D
Sbjct: 420 EKENPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPID 479

Query: 481 PVSLVSVNSYVTDCVRSNSKVLANLIKSFVESSKLGPQSSYTPNTENTSTP-----FVLT 535
            + +VS+ + VT+ VR N+KVLANLI++ + + K       T  T + S P      V+T
Sbjct: 480 VIGVVSLTNGVTEHVRQNAKVLANLIENALGNIK-DTNKKTTSITSSESKPDGISLEVIT 538

Query: 536 LSQIKDIGMRFTKLTENFQSSSCQKISPLQRSSFFGD-LSKGKVTVSYNDAKTTPVSQSV 594
           +SQI+DI  RF+ L+ +   ++  K      S   G  L   +  +SY   K TP    V
Sbjct: 539 ISQIRDIMERFSLLSNSGVINNRTKTGDSTSSILLGKTLPFEECGISYG-KKGTPNKVKV 597

Query: 595 --LESRSKQFNEYMKAFGDIEYKIPSIVEPVMDLPIPSGTTSTESADSKTVEKPPKNIKE 652
             +++R+++FN  +    +I +++    +PV    +P+     E+ + ++  + P    E
Sbjct: 598 EDIKARAQKFNSALAGLENIMFELE---KPVT---VPASVEKGEAVEIESAPELPSK-AE 650

Query: 653 DMDEIVVLKKVKRELPKPKGNDEDAEREIVDYSKEDKVLVQRQFDXXXXXXXXXXRFDPF 712
             D+I+VLKK K    +P    +   +E VDYSK   VL  +             RFDP 
Sbjct: 651 SFDDIIVLKKKKMHKKQPAKGKDMTVKEAVDYSKMPSVLSSKP--GQNRKQQRKRRFDPS 708

Query: 713 SAISEGPKAPKKRKAVTKGKNASFKR 738
           S  SEGP+A KK++   +GKN SFKR
Sbjct: 709 SNDSEGPRAAKKKRPAPRGKNMSFKR 734

>CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001w RRP6
          Length = 737

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/752 (53%), Positives = 515/752 (68%), Gaps = 29/752 (3%)

Query: 1   MDSEEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSI 60
           M S+    +L K + TVRAS++L  QDV+F  ++D +VA+S+++    +  ++N+IL SI
Sbjct: 1   MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 60

Query: 61  DENSKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLV 120
           D N++    + E + E  ++F+N+ D LFEK+DRS+DI+ + +  N    + +Q+LDD+ 
Sbjct: 61  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKN-MQFLDDVN 119

Query: 121 GNDSSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHY 180
             ++   +RI+KPQL+F  PVDNSES PFKPLL EKPNALK ++ES Q+V ATE+IP H+
Sbjct: 120 VAENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHF 179

Query: 181 PNPYDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDL 240
             PY+YEI NQEYNNDILE + PIPST W ++  +WVD+   LQ ++++LKK  E+A+DL
Sbjct: 180 QQPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDL 239

Query: 241 EHHDYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIW 300
           EHHD+RSYYG+VCLMQISTR  DY+VDTIALRD+L +LN+VFT+P++TKVFHGAFMDIIW
Sbjct: 240 EHHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIW 299

Query: 301 LQRDLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMS 360
           LQRDLGLYIVSLFDTFHASKALG PKHSLAYLLE  ANFKTSKKYQLADWR RPLSK M 
Sbjct: 300 LQRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMM 359

Query: 361 VYARADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPI 420
            YARADTHFLLNIFDQMRN LI   KLAGVL ESR VA RRFEYSK++PK+   ++FTP+
Sbjct: 360 AYARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPV 419

Query: 421 EKESPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTD 480
           EKESPWRTLM+QYN+  +KE L++ LYEWRD +ARRDDESPRY+MPNQLL+SL AY P D
Sbjct: 420 EKESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVD 479

Query: 481 PVSLVSVNSYVTDCVRSNSKVLANLIKSFVESSKLGPQSSYTPNTENTSTPFVLTLSQ-- 538
           P+S+VSV+S VTD VR NSK LANLIK  +E  KLG   S      N   P  L +SQ  
Sbjct: 480 PISVVSVSSVVTDHVRRNSKTLANLIKKKLEEIKLGEVKSI-----NNRLPSSLDVSQDE 534

Query: 539 --------IKDIGMRFTKLTENFQSSSCQKISPLQRSSFFGD-LSKGKVTVSYNDAKTTP 589
                   I+ +   F ++ EN  + + +    +  S    + L   +  V Y++     
Sbjct: 535 LQFLPSHKIELMTGAFKEI-ENQLTQATKSKQAMTSSVVLSEILLHPEHAVKYHNGSACS 593

Query: 590 VSQSVLESRSKQFNEYMKAFGDIEYKIPSIVEPVMDLPIPSGTTSTESADSKTVEKPPKN 649
           V +S L+ R   +  Y+KA      K  ++V    +   P  T  T +  S  ++  P+ 
Sbjct: 594 VEESELKDR---YLSYIKATLLAASKNINMVLETSNSNAPLETEETHNKKSDQIQVIPEK 650

Query: 650 IKEDMDEIVVL--KKVKRELPKPKGNDEDAEREIVDYSKEDKVLVQRQFDXXXXXXXXXX 707
            +EDMDEIVVL  KK+     K K +D D   E VDYSK + +L     D          
Sbjct: 651 -QEDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKAN-ILAS---DNREVKKKDKK 705

Query: 708 R-FDPFSAISEGPKAPKKRKAVTKGKNASFKR 738
           R FDP+S+  EGPKA KKR+ VTKGK  SFK+
Sbjct: 706 RVFDPYSSTGEGPKAAKKRRLVTKGKKISFKK 737

>YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nuclear
           exosome exonuclease component; has 3'-5' exonuclease
           activity; involved in RNA processing, maturation,
           surveillance, degradation, tethering, and export; has
           similarity to E. coli RNase D and to human PM-Sc1 100
           (EXOSC10); mutant displays reduced transcription
           elongation in the G-less-based run-on (GLRO) assay
          Length = 733

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/745 (50%), Positives = 507/745 (68%), Gaps = 19/745 (2%)

Query: 1   MDSEEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSI 60
           M SE    LLS+ +  VRA+SSL  QDV F+ NLD   +  +K   +++ +M N+I+ SI
Sbjct: 1   MTSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFSKDLKSKADKLADMANEIILSI 60

Query: 61  DENSKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLV 120
           DE+ + F    E + + W +F N+ DNL E SD S+D +        + GS++QYL +  
Sbjct: 61  DEHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSR-GSDLQYLGEFS 119

Query: 121 GNDSSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHY 180
           G + S  KR+ KPQL F  P+DNSES PF PLL EKPNALKPL ESL++V   EN PSHY
Sbjct: 120 GKNFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHY 179

Query: 181 PNPYDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDL 240
           P+PY+YEI +QEY+ +IL+ R  IPS  W +S P+WVD++  L+S+L+DLK  KE+A+DL
Sbjct: 180 PHPYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDL 239

Query: 241 EHHDYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIW 300
           EHHDYRSYYGIVCLMQISTR+ DYLVDT+ LR+ LHILN+VFT+P + KVFHGAFMDIIW
Sbjct: 240 EHHDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIW 299

Query: 301 LQRDLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMS 360
           LQRDLGLY+V LFDT+HASKA+G P+HSLAYLLE  ANFKTSKKYQLADWRIRPLSKPM+
Sbjct: 300 LQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMT 359

Query: 361 VYARADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPI 420
            YARADTHFLLNI+DQ+RN+LI+ NKLAGVL ESR VAKRRFEYSK+RP     +V++PI
Sbjct: 360 AYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPI 419

Query: 421 EKESPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTD 480
           EKESPW+ LM+QYN+ PE+E LV+ LY+WRD IARRDDESPR++MPNQLL +L AYTPTD
Sbjct: 420 EKESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTD 479

Query: 481 PVSLVSVNSYVTDCVRSNSKVLANLIKSFVESSK-LGPQSSYTPNTENTSTPFVL---TL 536
            + +VS+ + VT+ VR N+K+LANLI+  + + K    +++  P++E  +   +L   ++
Sbjct: 480 VIGVVSLTNGVTEHVRQNAKLLANLIRDALRNIKNTNEEATPIPSSETKADGILLETISV 539

Query: 537 SQIKDIGMRFTKLTENFQSSSCQKISPLQRSSFFGD--LSKGKVTVSYN-DAKTTPVSQS 593
            QI+D+  RF+ L  +  S S  K  P+  SS      L + +  ++Y+ D     V   
Sbjct: 540 PQIRDVMERFSVLCNSNISKSRAK--PVTNSSILLGKILPREEHDIAYSKDGLPNKVKTE 597

Query: 594 VLESRSKQFNEYMKAFGDIEYKIPSIVEPVMDLPIPSGTTSTESADSKTVEKPPKNIKED 653
            +  R++ F   +    DI ++I    +P++   +P      ++ D  +       I ++
Sbjct: 598 DIRIRAQNFKSALANLEDIIFEIE---KPLV---VPVKLEEIKTVDPASAPNHSPEI-DN 650

Query: 654 MDEIVVLKKVKRELPKPKGNDEDAEREIVDYSKEDKVLVQRQFDXXXXXXXXXXRFDPFS 713
           +D++VVLKK   +  +P       E++ VDYSK   +L  +             RFDP S
Sbjct: 651 LDDLVVLKKKNIQKKQPAKEKGVTEKDAVDYSKIPNILSNKP--GQNNRQQKKRRFDPSS 708

Query: 714 AISEGPKAPKKRKAVTKGKNASFKR 738
           + S GP+A KKR+   KGKN SFKR
Sbjct: 709 SDSNGPRAAKKRRPAAKGKNLSFKR 733

>NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {ON}
           Anc_6.25 YOR001W
          Length = 790

 Score =  732 bits (1890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/767 (50%), Positives = 512/767 (66%), Gaps = 39/767 (5%)

Query: 8   KLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSIDENSKPF 67
           +LL + V TVRAS +L  QDV F+ ++D   A ++KE  +++ +MIN +L ++DENS+  
Sbjct: 27  QLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSETL 86

Query: 68  AESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLVGNDSSSG 127
             + E + ++W+DF+NL DNL EKSDRSMD++ +         S +QYLD+  G D +S 
Sbjct: 87  DGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNT-NTNNSNMQYLDEYSGRDDTSS 145

Query: 128 KR--ITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHYPNPYD 185
           KR  I KPQL F  PVDN+E+ PF PLL  KPNALK L ES+Q++P  EN+P HY  PY+
Sbjct: 146 KRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPYE 205

Query: 186 YEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDLEHHDY 245
           YEI NQ YN+ IL+   PIPS PW E+  +WVD+ E LQS++KDL    E A+DLEHHDY
Sbjct: 206 YEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHDY 265

Query: 246 RSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIWLQRDL 305
           R+YYGIVCLMQISTR  DY+VDT+ LR  L  LN+ FT+P +TKV HGAFMDIIWLQRDL
Sbjct: 266 RTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRDL 325

Query: 306 GLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMSVYARA 365
           GLYIVSLFDTFHAS+ALGFPK+SLAYLLE  +NFKTSKKYQ+ADWRIRPLSK M+ YAR+
Sbjct: 326 GLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYARS 385

Query: 366 DTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPIEKESP 425
           DTHFLLNIFDQMRN+L++D KLAGVL ESR VAKRRFEY K+RP +    V++PIEK  P
Sbjct: 386 DTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKIDP 445

Query: 426 WRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTDPVSLV 485
           W+TLM+QYN+   KE L+K LY+WRD IARRDDESPRYIMPNQLL+SL AY P +P  +V
Sbjct: 446 WKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGVV 505

Query: 486 SVNSYVTDCVRSNSKVLANLIKSFVESSK--------LGPQSSYTPNTENTSTPF----V 533
           SV++ VTD VRSNSK+LANLIK+ +   K        +  Q    P T  T+T       
Sbjct: 506 SVSNMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTNVDLSEQ 565

Query: 534 LTLSQIKDIGMRFTKL---TENFQSSSCQKISPLQRSSF--------FGDLSKGKVTVSY 582
           L++ Q+  +  +F  L     + +  +    +  +++SF        F D   GK  + Y
Sbjct: 566 LSIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMSFND-EDGKNFIKY 624

Query: 583 N---DAKTTPVSQSVLESRSKQFNEYMKAFGDIEYKIPSIVEPVMDLPIPSGTTSTESAD 639
           +   D K    ++ +L+ R + F++ M+    +EY IP     ++ +       S  +A+
Sbjct: 625 SVSPDKKDKITTEELLK-REEMFDQAMEQLQQVEYSIPIPENEIVVVESEQQEPSIPAAN 683

Query: 640 SKTVEKPPKNIKEDMDEIVVLKKVKRELPKPK-----GNDEDAEREIVDYSKEDKVL--- 691
           ++         KED+DEI+VLKK  R   K +      +D++ E E++DYSK +KVL   
Sbjct: 684 AEITTAVASRKKEDLDEIIVLKKTNRNKGKKRERKHSDDDDEGEIEVIDYSKMEKVLDNS 743

Query: 692 VQRQFDXXXXXXXXXXRFDPFSAISEGPKAPKKRKAVTKGKNASFKR 738
             ++            RFDP++  +EGP+APKKRKA+T+GKN SFKR
Sbjct: 744 NTKRNQNKNNNGNKRKRFDPYNVNNEGPRAPKKRKAMTRGKNVSFKR 790

>Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001W
           (REAL)
          Length = 773

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/746 (50%), Positives = 502/746 (67%), Gaps = 21/746 (2%)

Query: 1   MDSEEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSI 60
           M S+    LLSK V  +RA+SSL GQDV F+ NLD      +K   +++ +M N+I+ SI
Sbjct: 41  MASQNPDVLLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSI 100

Query: 61  DENSKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLV 120
           DE+ + F    E +   W DF N+ DNL E SD S+D + +        G+++QYL D  
Sbjct: 101 DEHHESFELKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPN-GADLQYLGDFS 159

Query: 121 GNDSSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHY 180
             + S  KR+ KPQL F  P+DNSES PF PLL EKPNALKPL +SL+++   +N PSHY
Sbjct: 160 EKNLSPAKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHY 219

Query: 181 PNPYDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDL 240
           P+PY+YEI +QEY ++IL+ R  IPS  W++SEP+W+D+   L+S+L++LK  +E+A+DL
Sbjct: 220 PHPYEYEIDHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDL 279

Query: 241 EHHDYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIW 300
           EHHDYRSYYGIVCLMQISTR+ DYLVDT+ LR+ LHILN+VFTDP + KVFHGAFMDIIW
Sbjct: 280 EHHDYRSYYGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIW 339

Query: 301 LQRDLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMS 360
           LQRDLGLY+V LFDT+HASKA+G P+HSLAYLLE  ANFKTSKKYQLADWRIRPLSKPM 
Sbjct: 340 LQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMI 399

Query: 361 VYARADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPI 420
            YARADTHFLLNI+DQ+RN+LI+ NKLAGVL ESR VAKRRFEYSK+RP++   +V++PI
Sbjct: 400 AYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPI 459

Query: 421 EKESPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTD 480
           EKE+PWR LM+QYN+T EKEELVK LY+WRD IARRDDESPR++MPNQLL +L AYTP D
Sbjct: 460 EKEAPWRVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPID 519

Query: 481 PVSLVSVNSYVTDCVRSNSKVLANLIKSFV----ESSKLGPQSSYTPNTENTSTPFVLTL 536
            + ++S+ + +T+ VR N+KVL NLIK+ +    ++ K     +++ +  N  +   +T+
Sbjct: 520 VIGVISLTNGITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFSESMTNEVSLEAITI 579

Query: 537 SQIKDIGMRFTKLTENFQSSSCQKISPLQRSSFFGD-LSKGKVTVSY-NDAKTTPVSQSV 594
            QI+DI  RF+ L+ N   S+C+  +    S   G  L   +  ++Y N+     V    
Sbjct: 580 PQIRDIMERFSVLS-NSNVSNCRAKNGATPSILLGRILPLEENDIAYKNNGLPNRVKFED 638

Query: 595 LESRSKQFNEYMKAFGD--IEYKIPSIVEPVMDLPIPSGTTSTESADSKTVEKPPKNIKE 652
           + +R++ FN  +    D  +E + P I        +P+     E  +++ V K    I E
Sbjct: 639 IRARAQSFNSALSNLEDCMLEVEKPHI--------LPTNVKKIERINTEDVPKHSATI-E 689

Query: 653 DMDEIVVLKKVKRELPKPKGNDEDAEREIVDYSKEDKVLVQRQFDXXXXXXXXXXRFDPF 712
           + D+IVVLKK      +     +    + +DYSK   VL  +             R DP 
Sbjct: 690 NPDDIVVLKKKNIHRTQSMNAKDTMGEKAIDYSKIPNVLSSKS--DQNRRQQKKRRSDPL 747

Query: 713 SAISEGPKAPKKRKAVTKGKNASFKR 738
              S+GP+A KK++  T+G+N SFKR
Sbjct: 748 FNDSDGPRAAKKKRPATRGRNVSFKR 773

>ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 741

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/755 (51%), Positives = 506/755 (67%), Gaps = 31/755 (4%)

Query: 1   MDSEEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSI 60
           M  E  ++LL K VGTVRA+++L  QDV F+ +LD  VA S+ +  NE++ MIN  L  I
Sbjct: 1   MAEESNEQLLPKVVGTVRAAAALAAQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCI 60

Query: 61  DENSKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLV 120
           D+NS+      E++ +S +DF+NL DNLFEKSDRS+DI+    R   + G+ + YLDD  
Sbjct: 61  DQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDILR--GRAPDRKGAALMYLDDAA 118

Query: 121 GNDSSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHY 180
            +D    KRI KPQ+ F RP+DN+E+ PFKPLL  KP+AL+PL + +++V A E+IP HY
Sbjct: 119 RSDMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHY 178

Query: 181 PNPYDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDL 240
           P PY+YEI NQEYN  IL+   PIPS PW  SEPVWVD+ E L S+L+DLKK  E+A+DL
Sbjct: 179 PQPYEYEIENQEYNESILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDL 238

Query: 241 EHHDYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIW 300
           EHHDYRSYYGIVCLMQ+STR TDYLVDT+ALRD+L +LN+VF +P++ KVFHGAFMDIIW
Sbjct: 239 EHHDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIW 298

Query: 301 LQRDLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMS 360
           LQRDLGLYIVSLFDT+HAS+ALGFP+HSLAYLLET A+FKTSKKYQLADWR+RPLSK MS
Sbjct: 299 LQRDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMS 358

Query: 361 VYARADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPI 420
            YARADTHFLLNI+DQ+RN+LI +NKLAGVL ESR VAKR F+YSK+RPK+    V++P+
Sbjct: 359 AYARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPV 418

Query: 421 EKESPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTD 480
           ++   W+ LM QYN+  EKE LVK LYEWRDTIARRDDESPRY+MPNQLL  L  YTP D
Sbjct: 419 DRADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLD 478

Query: 481 PVSLVSVNSYVTDCVRSNSKVLANLI-KSFVESSKLGP--QSSYTPNTENTSTPFVLTLS 537
           P  ++SV+  VTD VR+N+K LANLI KS  + +  G   +     + +      VLT+ 
Sbjct: 479 PTGVISVSPTVTDHVRTNAKALANLIVKSLQQIADAGSDIKVESVQHKDQHDLSQVLTVG 538

Query: 538 QIKDIGMRFTKLTENFQS-SSCQKISPLQRSSFFGDLSKGKVT-VSYNDAKTTPVSQSVL 595
           QI+    +F  L++ F+  S     S    S  FG++       V Y  +   PV+   +
Sbjct: 539 QIESQVSQFHDLSKAFKGLSQGTNSSNSSSSIIFGNILHAPCGFVGYGRSLKKPVTDKQI 598

Query: 596 ESRSKQFNEYMKAFGDIEYKIPSIVEPVMDLPIPSGTTST-ESADSKTVEK--------- 645
           E R  + +E ++ F D E    +I E         G+  T E AD K V +         
Sbjct: 599 EKRKLELSEALE-FIDAETAT-TIQEE------DRGSELTHEPADDKKVSENDESKKEEA 650

Query: 646 PPKNIKEDMDEIVVLKKVKRELPKPKGNDEDAEREIVDYSKEDKVLVQRQFDXXXXXXXX 705
                +ED +EI+ LKKVK    K K ++E    E +DY K  K+L   +          
Sbjct: 651 KETEPEEDKNEIITLKKVKDRGKKSKRSNESEPEEPIDYKKSKKILETEKKSKSTKKRA- 709

Query: 706 XXRFDPFSAISEGPKA--PKKRKAVTKGKNASFKR 738
              FDP++A ++   A  PKK++ + +GK+ASFKR
Sbjct: 710 ---FDPYAASNDAGNAPKPKKKRRMARGKSASFKR 741

>TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  722 bits (1863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/747 (50%), Positives = 499/747 (66%), Gaps = 21/747 (2%)

Query: 1   MDSEEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSI 60
           M   E+ +LL K V T+RASS+L  QDV F  +L   +  S+ E    ++ +IN +L SI
Sbjct: 1   MPPAEEDQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSI 60

Query: 61  DENSKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDII--AQGTRKNGQAGSEVQYLDD 118
           D+NS+P  E  E + E W+DF+N+ DNLFE SD S DI+  A G+RK+G+   ++++LD+
Sbjct: 61  DQNSEPLVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGE---KLKFLDN 117

Query: 119 LVGNDSSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPS 178
              NDS   KRI+KPQL+F  PV+N+E QPF PLL EKP AL+PL   +  VP  + +P 
Sbjct: 118 SSSNDSIPSKRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPLISDI--VPGNDAVPE 175

Query: 179 HYPNPYDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAI 238
           HY  PY+YEI +QEY   ++    PIPS PW  +E +WVD+ E L++++ DLK   E+A+
Sbjct: 176 HYAQPYEYEIEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAV 235

Query: 239 DLEHHDYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDI 298
           DLEHHDYRSYYGIVCLMQISTR+ DYL+DTIALRD+L ILN+VF +P + KVFHGAFMDI
Sbjct: 236 DLEHHDYRSYYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDI 295

Query: 299 IWLQRDLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKP 358
           IWLQRDLGLY+VSLFDTFHAS+A+G P+HSLAYLLE  ANFKTSKKYQLADWR+RPLSK 
Sbjct: 296 IWLQRDLGLYVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKA 355

Query: 359 MSVYARADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFT 418
           M+ YARADTHFLLNI+DQ+RN LI+ NKLAGVL ESR VAKRRFEYSKFRP    P V+ 
Sbjct: 356 MNAYARADTHFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYC 415

Query: 419 PIEKESPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTP 478
           PI+K  PW+ LMFQY+++P +EELVK LY+WRDTIARRDDESPRY+MPNQLL+ L+   P
Sbjct: 416 PIDKPDPWKVLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAP 475

Query: 479 TDPVSLVSVNSYVTDCVRSNSKVLANLIKSFVESS-KLGPQSSYTPNTENTSTPFVLTLS 537
           T+P++++SVNS VTD VRSNS VLA+LIK+ + SS K   + ++  +  +T    +LT+ 
Sbjct: 476 TEPINVISVNSIVTDHVRSNSLVLAHLIKNTLASSDKESDKGTFEADNNSTDAASLLTVP 535

Query: 538 QIKDIGMRFTKLTENFQSSSCQKISPLQRSSFFGDLSKGKVTVSYNDAKTTPVSQSVLES 597
           QI+ +   F  ++  F     +       S F   L+     V+Y       +++  L  
Sbjct: 536 QIQKLAACFAGVSRAFTILQNEYKDGRSSSIFTDILTSEDDAVNYVGNNMDHITKKELGK 595

Query: 598 RSKQFNEYMKAFGDIEYKIPSIVEPVMDLPIPSGTT-STESADSKTVEKPPKNIKEDMDE 656
           R+ +  + M+ F +      S   P+ ++   S T         + V++ P   KEDMDE
Sbjct: 596 RAAKALQSMEQFDEAT----SYYMPIPEIAKESNTMEEIRPPAPEEVKESPSPPKEDMDE 651

Query: 657 IVVL---KKVKRELPKPKGNDEDAEREI--VDYSKEDKVLVQRQFDXXXXXXXXXXRFDP 711
           I+ L   KK K + PK  G    +EREI  VDY+K  KVL   Q             +  
Sbjct: 652 IITLKKIKKQKSQSPKELGI---SEREIPAVDYTKTKKVLATNQDKNKDKKKRKFDPYAA 708

Query: 712 FSAISEGPKAPKKRKAVTKGKNASFKR 738
            +  S+ P+APKKRK V + +N SFKR
Sbjct: 709 SNHSSDAPRAPKKRKPVNRERNVSFKR 735

>TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6.25
           YOR001W
          Length = 771

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/750 (50%), Positives = 506/750 (67%), Gaps = 16/750 (2%)

Query: 1   MDSEEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSI 60
           M  +  ++LL   VG VRAS++L  QDV F+ +LD  V+ S+ +  N+ L++ N +L SI
Sbjct: 26  MSEDNCEELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSI 85

Query: 61  DENSKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLV 120
           DEN  P  E  +++ + W  F+N+ DNL EKSD  +D +++    NG+   E  +LD+  
Sbjct: 86  DENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYN-ETTFLDNNS 144

Query: 121 GNDSSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHY 180
             +S+  KRI KPQL FS+PVDN++S+PFKPLL EKPNALKPLK+SL +VP +  +P+HY
Sbjct: 145 RTNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHY 204

Query: 181 PNPYDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDL 240
             PY+YEI NQEYN +++E R P P  PW  +  +W+D+ E L  LL DL+K  E+A+DL
Sbjct: 205 LQPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDL 264

Query: 241 EHHDYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIW 300
           EHHD RSYYGI CLMQISTR+ DY+VDTI+LRD+L +LN++FT+P +TKVFHGA MDIIW
Sbjct: 265 EHHDLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIW 324

Query: 301 LQRDLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMS 360
           LQRDLGLYIVSLFDTFHASKALG  +HSLAYLLE  A+FKTSKKYQLADWR RPL+  M 
Sbjct: 325 LQRDLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNML 384

Query: 361 VYARADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPI 420
            YAR+DTHFLLNIFDQ+RN LIK NKLAGVL ESR VAKRRFEY KFRP +  P+++T I
Sbjct: 385 AYARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLI 444

Query: 421 EKESPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTD 480
           EKE+PW++L+ QYN+  EKE LV+ L+EWRD IARRDDESPRYIMP Q+LISL +YTPTD
Sbjct: 445 EKEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTD 504

Query: 481 PVSLVSVNSYVTDCVRSNSKVLANLIKSFVESSKLGPQSSYTPNTEN-----TSTPFVLT 535
              ++SV++ VT+ VRSNS  LANLIK  +ES+K  P SS + +T N     T+   +++
Sbjct: 505 SSGVISVSNMVTEHVRSNSTTLANLIKKALESTKSIPNSSDSSSTFNMSRTDTNVASLIS 564

Query: 536 LSQIKDIGMRFTKLTENFQSSSCQKISPLQRSSFFGDLSKGKVTVS-YNDAKTTPVSQSV 594
           +++I +I ++F  L++++ +S          S  F ++      +S Y+  KTT      
Sbjct: 565 ITEINNICLKFNSLSKHYNTSKFLTSGIEVSSLLFSNIMTSSPKISDYSKDKTTSFKSED 624

Query: 595 LESRSKQFNEYMKAF---GDIEYKIPSIVEPVMDLPIPSGTTSTESADSKTVEKPPKNIK 651
           + +R  + +E +K         Y+ P  VE +  + I +           T +K  K I 
Sbjct: 625 MIARHIRLSEGLKGLSANNSFIYQPP--VEDIKSIEITTENPIPTLEPKSTQKKTTKEIN 682

Query: 652 EDMDEIVVLKKVKRELPKPKGNDEDAEREIVDYSKEDKVLVQRQFDXXXXXXXXXXRFDP 711
           ED +EI+VLKKV R+  K K + +     +VDYSK  K+  Q++ +           FDP
Sbjct: 683 EDNEEIIVLKKVNRKYQKGKKDADKDSTVVVDYSKAKKIF-QKKDETINGNSKKRKSFDP 741

Query: 712 FSAISEG---PKAPKKRKAVTKGKNASFKR 738
           ++   +    P+A KKR+  T+GKN S+KR
Sbjct: 742 YNNDGDTDKVPRALKKRQTNTRGKNISYKR 771

>TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON}
           Anc_6.25 YOR001W
          Length = 743

 Score =  714 bits (1842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/749 (49%), Positives = 501/749 (66%), Gaps = 28/749 (3%)

Query: 8   KLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSIDENSKPF 67
           +LL   V +VRA+S+L  QDV F+ +LD  +ASS+     +V +MIN I+ S+DENS+  
Sbjct: 5   ELLPLVVSSVRAASALAAQDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEGL 64

Query: 68  AESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLVGNDSSSG 127
            E  E + ESW+D  NL D+LFE +D S+D +++ ++K+     +++YL+D +  +S + 
Sbjct: 65  VEGKENLDESWKDIGNLLDSLFELADHSIDALSKASQKSSN-DPKMKYLNDSLNFESDNV 123

Query: 128 KRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHYPNPYDYE 187
            R++KPQL+FS PVDNSE+ PF+PLLT+KPNA+ PL E L++V  TE+ P HYP PY+ E
Sbjct: 124 TRLSKPQLNFSVPVDNSETHPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYETE 183

Query: 188 ISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDLEHHDYRS 247
           I  QEYN  +L+   PIPS  W E+E +WVD+ E L ++L +LK   ELA+DLEHHD+RS
Sbjct: 184 IDKQEYNEQVLQFSDPIPSKVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFRS 243

Query: 248 YYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIWLQRDLGL 307
           YYGI CLMQISTR+TDYLVDTIALRD+L +LN VFTDP +TK+ HGAFMDIIWLQRDLGL
Sbjct: 244 YYGITCLMQISTRNTDYLVDTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLGL 303

Query: 308 YIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMSVYARADT 367
           YIVSLFDT+HAS+ALGFP+HSLAYLLE  A+FKTSK+YQLADWR RPLSK M+ YARADT
Sbjct: 304 YIVSLFDTYHASRALGFPRHSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARADT 363

Query: 368 HFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPIEKESPWR 427
           HFLLNIFDQ+RN LI+++KLA +L ESRKVAKRRFEYSK++P L    VF+P E + PWR
Sbjct: 364 HFLLNIFDQLRNMLIQEDKLASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMPWR 423

Query: 428 TLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTDPVSLVSV 487
           ++++QYN+  +K ELVK L+EWRDTIARRDDESPRYIMPNQL+ SL  Y PT+P  ++SV
Sbjct: 424 SMIYQYNIPSQKVELVKRLWEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVISV 483

Query: 488 NSYVTDCVRSNSKVLANLIKSFVESSKLGPQSSYTPNT---ENTSTPFVLTLSQIKDIGM 544
           N  +TD VRSN+K +ANLIKS +E  K    S+   +T   +  ++   L+ SQIK I  
Sbjct: 484 NRMMTDPVRSNAKAIANLIKSTLEDMKNNNISTTVVSTTAKDKETSSNDLSTSQIKFIVS 543

Query: 545 RFTKLTENFQS--------SSCQKISPLQRSSFFGDLSKGKVTVSYNDAKTTPVSQSVLE 596
           +F  + E + S        +S +    L  S  F   S+  + ++Y+      +++  L 
Sbjct: 544 QFENILEKYSSNNSNLNDVTSKEGKDSLVFSKIFN--SRDDI-ITYDKGTKHLITEQQLS 600

Query: 597 SRSKQFNEYMKAFGDIEY--KIPSIVEPVMDLPIPSGTTSTESADSKTVEKPPKNIKEDM 654
            R K+ +  MK   +I +  ++    +  M  P P        +     E   K  +ED+
Sbjct: 601 DRQKEVDAAMKQAEEIAFSMEVQDTHKESMKQPFPEPEEVISQSHLPAFED--KEEQEDL 658

Query: 655 DEIVVLKKVK---RELPKPKGNDEDAEREIVDYSKEDKVLVQRQFDXXXXXXXXXXRFDP 711
           DEI+VLK  K       + +G   D++  ++DYSK DK+L Q              ++DP
Sbjct: 659 DEIIVLKDTKDRRNRQHRGRGRSADSDHTVIDYSKGDKILSQ----DNRRRTPNKRKYDP 714

Query: 712 FSAIS--EGPKAPKKRKAVTKGKNASFKR 738
           FSA +     +  K+R+   K +N SFKR
Sbjct: 715 FSADNNENALQGAKRRRPTAKNRNVSFKR 743

>KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 744

 Score =  708 bits (1828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/748 (50%), Positives = 499/748 (66%), Gaps = 14/748 (1%)

Query: 1   MDSEEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSI 60
           M SE++  LLS  V TVR+SS+L  QD+ F+ +LD+N+ +S+++    +L +IND+L SI
Sbjct: 1   MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTSTNILSLINDLLLSI 60

Query: 61  DENSKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLV 120
           D N+    +  +   +SW+  +N+ DNLFEKSD ++D I  G   N    S ++YL+D  
Sbjct: 61  DPNNDVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRAGNGGNAGGPS-LKYLNDDD 119

Query: 121 GNDSSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHY 180
            +++   KRI KPQL F  PVDN+E  PFKPLL  KP++L+P + SL+MVP  E+IPSHY
Sbjct: 120 RSNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHY 179

Query: 181 PNPYDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDL 240
           P+PY+YEI +Q+YN+ IL    PIPS  W E+E +WVD+ EGL  +  +L K  ELAIDL
Sbjct: 180 PHPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDL 239

Query: 241 EHHDYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIW 300
           EHHDYRSYYGIVCLMQIS R+ D++VDTIALR+EL+ILN +FTDP VTKV HGAFMDIIW
Sbjct: 240 EHHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIW 299

Query: 301 LQRDLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMS 360
           LQRDLGLYIV LFDT+HAS+ LGFPKHSLAYLLE  ANFKTSKKYQLADWRIRPL+KPM 
Sbjct: 300 LQRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPML 359

Query: 361 VYARADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPI 420
            YARADTHFLLNIFD++RN L++ NK++ VL ESRKVAKRRFEYS FRPK+    VF+PI
Sbjct: 360 AYARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPI 419

Query: 421 EKESPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTD 480
           EK+ PW+ +MFQYN+   KE L++ LYEWRDTIARRDDESPRY+MPNQLL+SL A  PT+
Sbjct: 420 EKDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTE 479

Query: 481 PVSLVSVNSYVTDCVRSNSKVLANLIKSFVESSKLGPQSSYTPNTEN-----TSTPFVLT 535
           P++++SV+SYV++ +R+NSKV+ANLIK  +E  K    SS  P  E+     T    ++T
Sbjct: 480 PINVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGTDLANIIT 539

Query: 536 LSQIKDIGMRFTKLTENFQSSSCQKISPLQRSSFFGDLSKGKV--TVSYNDAKTTPVSQS 593
            SQIK I   F  L     S         ++S  F  +S   V   V Y     T + Q 
Sbjct: 540 TSQIKSIQNIFHSLASEINSQKLNNEQNSEKSVLFNGISNLDVNTAVRYTPKTRTLIPQH 599

Query: 594 VLESRSKQFNEYM-KAFGDIEYKIPSIVEPVMDLPIPSGTTSTESADSKTVEKPPK-NIK 651
            L  R  +    + + + D + +  SIV P  +   P+  ++ E+ +      P +  I+
Sbjct: 600 ELLKRQHEITRTLEQEYTDRQAQ--SIVLPSNEDEAPTQVSNDENRNEVITSDPSQEEIE 657

Query: 652 EDMDEIVVLKKVKREL-PKPKGNDEDAEREIVDYSKEDKVLVQRQFDXXXXXXXXXXRFD 710
           E+ DE++ L+K + +   K K     A  EI+DY+    +L   + +          RFD
Sbjct: 658 ENKDEVITLRKRQSQSNNKRKTISPPASHEIMDYAAGSDLLNSTK-NNTNSQKHKKRRFD 716

Query: 711 PFSAISEGPKAPKKRKAVTKGKNASFKR 738
           P+S    GP+  KK+    KGKN SFKR
Sbjct: 717 PYSVEHVGPQPIKKKSKPAKGKNVSFKR 744

>ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR001W
           (RRP6)
          Length = 745

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/756 (48%), Positives = 490/756 (64%), Gaps = 30/756 (3%)

Query: 1   MDSEEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSI 60
           M S ++  L  + V T+RA+++L  QD+ F+ +L  +V   + +    V+ +IN++L S+
Sbjct: 1   MASTDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSV 60

Query: 61  DENSKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLV 120
           DEN+       +   +SW++ +N+ DN+FEKSD + D I  G+    + G  +QYL D  
Sbjct: 61  DENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNE-GVNMQYLADSS 119

Query: 121 GNDSSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHY 180
            +DS+  KRI KPQL F  PVDN+E  PFKPLL EKP+ALKPL+ESL + P  EN+P+HY
Sbjct: 120 HDDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHY 179

Query: 181 PNPYDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDL 240
           P+PY+YEI  Q YN+ +LE R  I   PW  +EP+WVD+ E L  +L +LK+ KELA+DL
Sbjct: 180 PHPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDL 239

Query: 241 EHHDYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIW 300
           EHHDYRSYYGIVCLMQIS+R  D+LVDTIALRD+LH+LN +  DP V KVFHGAFMD+IW
Sbjct: 240 EHHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIW 299

Query: 301 LQRDLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMS 360
           LQRDLGLY+VSLFDT+HAS+ALGFPKHSLAYLLET A FKTSKKYQLADWR+RPL KP+ 
Sbjct: 300 LQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLR 359

Query: 361 VYARADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPI 420
            YAR+DTHFLL+I+D +RN L+K  KLA VL  SR VAKRRFEY+ FRP++   +V++PI
Sbjct: 360 DYARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPI 419

Query: 421 EKESPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTD 480
           E   PWR LM+QYN+ P KE L+K LYEWRDT+ARRDDES RY+MPNQLL+SL + +P++
Sbjct: 420 ESTEPWRKLMYQYNLPPSKEPLLKKLYEWRDTVARRDDESVRYVMPNQLLVSLVSLSPSE 479

Query: 481 PVSLVSVNSYVTDCVRSNSKVLANLIKSFVESSKLGPQS--SYTPNTENTSTPFV-LTLS 537
              ++SV++YVTD VRSN++ LANLIK  +E+ K G  S   ++ +    S P   L+L 
Sbjct: 480 TAGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAGTASVAEFSSSERALSNPAATLSLH 539

Query: 538 QIKDIGMRFTKLTENFQSSSCQKISPLQRSSFFG-DLSKGKVTVSYNDAKTTPVSQSVLE 596
            I+++   F  L    Q  S    S    S  F  DL+ G   V Y + +   +  +VL+
Sbjct: 540 MIQNLDDHFRSLLMEAQKQSGSICSQHSSSLLFNSDLATGPSAVEYTNGQKHVIGDNVLQ 599

Query: 597 SRSKQFNEYMKAFGDIEYKIPSIVEPVMDLPIPSGTTSTES---ADSKTVEKPPKNIKE- 652
           +R       ++ F          VEPV D+  PS  +S+E+   ++  +  +P ++  E 
Sbjct: 600 TRKHAL---LQKFTS------QPVEPVTDIEAPSHQSSSENPQVSEDISPSEPQESQNEV 650

Query: 653 -------DMDEIVVLKKVKR-ELPKPKGNDEDAEREIVDYSKEDKVLVQRQFDXXXXXXX 704
                  +  EIVVL+K K+    KPKG    +  E VDYS   +VL +           
Sbjct: 651 QKDEPDFEKSEIVVLRKKKKAHAQKPKGT-SSSPTETVDYSNAKEVLGKGTSSTAKRGDK 709

Query: 705 XXXR---FDPFSAISEGPKAPKKRKAVTKGKNASFK 737
              R   FDP+   +  P   KK+   +KGK+ SFK
Sbjct: 710 DRPRKRKFDPYGQDNNAPSGVKKKNKPSKGKSISFK 745

>Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001W
           (RRP6) - involved in 5.8S rRNA processing [contig 185]
           FULL
          Length = 735

 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/744 (47%), Positives = 485/744 (65%), Gaps = 25/744 (3%)

Query: 4   EEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSIDEN 63
           +++  +L++ VGT+RASS++  QDV F+ +LD+ ++ S+ E   ++L +IND++ SID+N
Sbjct: 7   DKRSSILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLSLINDVVISIDDN 66

Query: 64  SKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLVGND 123
           +         +  SW +   + D LFEKS+ ++   A   + +   G+ +QYLDD     
Sbjct: 67  NDLIEPGRAGLENSWNNIGEVMDLLFEKSEHAL--AAMKKKGSNIIGNNLQYLDDSQPLT 124

Query: 124 SSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHYPNP 183
            ++  +ITKPQ  FSRPVDN+ES PFKPLL +KPNAL+PL + LQ+    E IP+HYP+P
Sbjct: 125 DTTLTKITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAHYPHP 184

Query: 184 YDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDLEHH 243
           Y+YEI +QEY+  +LE R PIPS PW E++  WVD+   L  ++++L K KELAIDLEHH
Sbjct: 185 YEYEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAIDLEHH 244

Query: 244 DYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIWLQR 303
           DYR+YYGI CLMQISTR+ D+LVDTIALRD L +LN++FT+P V KVFHGAFMD+IWLQR
Sbjct: 245 DYRTYYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVIWLQR 304

Query: 304 DLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMSVYA 363
           DLGLY+VSLFDTFHAS+ LGFPKHSLAYLLE  A+FKTSKKYQLADWRIRPLSKP+  YA
Sbjct: 305 DLGLYLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPLKAYA 364

Query: 364 RADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPIEKE 423
           RADTHFLLNI+DQMRN LI+  KLA  L  SR VAKRRFEY+KFRP +   +V++P+E+E
Sbjct: 365 RADTHFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSPVERE 424

Query: 424 SPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTDPVS 483
            PWR+L+F YN+   K  L+K LYEWRDTIARRDDESPRY+MPNQLL++L    PTD   
Sbjct: 425 DPWRSLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPTDTYG 484

Query: 484 LVSVNSYVTDCVRSNSKVLANLIKSFVESSKLGPQSSYTP--NTENTSTPFV---LTLSQ 538
           L+SV S+VT+ VRSN+K L+ LIK  + S    PQ  +T   N  +++   V   L+   
Sbjct: 485 LLSVTSFVTEHVRSNAKSLSQLIKKTLAS----PQDLFTDQINHMDSNKSMVDSKLSPGD 540

Query: 539 IKDIGMRFTKLTENFQSSSCQKISPLQRSSFF-GDLSKGKVTVSYNDAKTTPVSQSVLES 597
           +K     F + T   +       + ++  S F G     +  VSY   +   +  +VL+ 
Sbjct: 541 VKANHQNFDQYTRKSRELVIHGPTVVRGCSLFPGKPLPNEAYVSYQGTQVHHIEPTVLDD 600

Query: 598 RSKQFNEYMKAFGDIEYKIPSIVEPVMDLPIPSGTTSTESADSKTV-EKPPKNIKEDMDE 656
           R +   + +    ++  K+   VE     P P  +   +  ++K + +     +KED DE
Sbjct: 601 RRELVAQNITTTANVTEKLQVAVEKT---PAPEVSDELDEGEAKELSDDTVSQLKEDKDE 657

Query: 657 IVVLKKVKRELPK---PKGNDEDAEREIVDYSKEDKVLVQRQFDXXXXXXXXXXRFDPFS 713
           IVVLK+ ++ LP+   P  N E   +EI+D+    K++                RFDP++
Sbjct: 658 IVVLKR-RKALPQSSSPPKNAEGNPKEILDFKNNKKIMTA----TASVPRKSTKRFDPYA 712

Query: 714 AISEGPKAPKKRKAVTKGKNASFK 737
             + GP   K+RK  T+G   SFK
Sbjct: 713 IQASGPDGVKRRKK-TRGIQKSFK 735

>Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to
           Ashbya gossypii ACL001C
          Length = 747

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/751 (47%), Positives = 489/751 (65%), Gaps = 17/751 (2%)

Query: 1   MDSEEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSI 60
           M S+ +  LL+K +GTVRA+SSL  QD+ F  +LDA+V   + E    ++ ++N+++ S 
Sbjct: 1   MSSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILST 60

Query: 61  DENSKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQA-GSEVQYLDDL 119
            + +       + +  +W+D +N+ DNLFEKSD S+D++ +    +     + +QYL+  
Sbjct: 61  SKANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHSLDVLQKLLSSSSSQLDTNMQYLNVD 120

Query: 120 VGNDSSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSH 179
              D    +RI KPQL F  PVDNSE  PFKPLL  KP+ALKPL+E   +   TE +P+H
Sbjct: 121 SQRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAH 180

Query: 180 YPNPYDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAID 239
           YP+PY+YEI NQ Y++ +L  + PI  + W E+EP+WVD+   L  +L  LK  KE+A+D
Sbjct: 181 YPHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVD 240

Query: 240 LEHHDYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDII 299
           LEHHDYRSYYG+VCLMQISTR++D+LVDTIALR +L +LN++FTDP + KVFHGAFMDII
Sbjct: 241 LEHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDII 300

Query: 300 WLQRDLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPM 359
           WLQRDLGLY+VSLFDT+HAS+ALGFPKHSLAYLLET ANFKTSKKYQLADWRIRPLSKPM
Sbjct: 301 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPM 360

Query: 360 SVYARADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTP 419
             YARADTHFLLNI+D++RN LIK++KL+GVL  SR VAKRRFEY+ FRPK+  P VF+P
Sbjct: 361 KTYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSP 420

Query: 420 IEKESPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPT 479
           IEK+ PWRTLM QYNV   KE L++ LY+WRD +AR+DDES RY+MPNQLL+SL    P+
Sbjct: 421 IEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPS 480

Query: 480 DPVSLVSVNSYVTDCVRSNSKVLANLIKSFVESSKLGPQSSYTPNTENTSTPFV------ 533
           DP  L++V SY+ D VR+N++VL N+I   +E  K G     +   EN +T +V      
Sbjct: 481 DPSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQS--IENVTTTYVSAQDPE 538

Query: 534 LTLSQIKDIGMRFTKLTENFQSSSCQKISPLQRSSFF-GDLSKGKVTVSYNDAKTTPVS- 591
           +++S IK +   F  L +  QS + +  S  + S  F G L      V+YN      V+ 
Sbjct: 539 MSVSLIKTMDRHFKFLLDEVQSHAVEPSSVCEDSLLFKGFLFDKPKAVAYNSVGKRLVND 598

Query: 592 QSVLESRSKQFNEYMKAFGDIEYKIPSIVEPV-MDLPIPSGTTSTESADSKTVEK-PPKN 649
           + +L+ +S    ++ K F      I S +E +  +  +P+ TTS   + SK   K    +
Sbjct: 599 RELLDRKSDLSQKFSKVFKAAGIAIGSHIEKLSSNSELPADTTSNVESPSKEESKNNSDD 658

Query: 650 IKEDMDEIVVLKKVKRELPKPKGNDEDAEREIVDYSKEDKVL--VQRQFDXXXXXXXXXX 707
           +KED  EI+VLK+ +      K   +  ++E VDY+  + +L    +Q            
Sbjct: 659 LKEDKHEIIVLKRKRDYGSNTKSTSKQPKKEHVDYNNVNSILDNTSQQDKPNSGRHVDKR 718

Query: 708 RFDPFSAISEGPKAPKKRKAVTKGKNASFKR 738
           +F      S G  A KK +  +KGK  S+K+
Sbjct: 719 KFHSDLQGSIGAAAIKKPR--SKGKTVSYKK 747

>KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {ON}
           similar to uniprot|Q12149 Saccharomyces cerevisiae
           YOR001W RRP6 Exonuclease component of the nuclear
           exosome contributes to the quality-control system that
           retains and degrades aberrant mRNAs in the nucleus
          Length = 735

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/744 (48%), Positives = 489/744 (65%), Gaps = 28/744 (3%)

Query: 5   EQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSIDENS 64
           E   +L++ + T+RASS++  QDV F+ NLD ++A+SV  +   +L +INDIL S+DEN+
Sbjct: 8   EDGSVLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLSVDENN 67

Query: 65  KPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLVGNDS 124
               + +E +  +W +   + D LFEKS+ ++   A   R NG+    VQYLDD      
Sbjct: 68  DIIEQGSEGLESAWSNVGEVMDLLFEKSEHAL--AAGEKRDNGELSKTVQYLDDSPSLHD 125

Query: 125 SSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHYPNPY 184
            + K+I KPQL F RP+DNSES PFKPLL +KP+AL+ L ESL++    E++P+HYP PY
Sbjct: 126 GAPKKILKPQLLFKRPIDNSESHPFKPLLKKKPHALRSLDESLRLTAEQEDVPAHYPQPY 185

Query: 185 DYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDLEHHD 244
           +YEI +QEYN  +L+   P+PS PW E+E  WVD+T+ L+ +L +L    E+AIDLEHHD
Sbjct: 186 EYEIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDALKLMLNELLLANEIAIDLEHHD 245

Query: 245 YRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIWLQRD 304
           YR+YYGI CLMQISTR+ D+L+DTIALRD+L ILN+VFTDP +TKV HGAFMDIIWLQRD
Sbjct: 246 YRTYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDIIWLQRD 305

Query: 305 LGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMSVYAR 364
           LGLYIVSLFDT+HAS+ LG PKHSLAYLLE  A+FKTSKKYQL+DWR+RPL K +  YAR
Sbjct: 306 LGLYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKALKAYAR 365

Query: 365 ADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPIEKES 424
           ADTHFLLNI+D MRN LI+ NKL+ VL +SR VAKRRFE++ FRPK+    VF+PIE+E 
Sbjct: 366 ADTHFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSPIERED 425

Query: 425 PWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTDPVSL 484
           PWRTLMFQYN+   K  LV+ LYEWRD +ARRDDESPRY++PNQLL+SL+   PT P  +
Sbjct: 426 PWRTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPTTPALI 485

Query: 485 VSVNSYVTDCVRSNSKVLANLIKSFVESS--KLGPQSSYTPNTENTSTPFVLTLSQIKDI 542
           ++ +++VT+ +R N+K LA LIK  +ESS  + G Q   + NT   S+P  ++   I+  
Sbjct: 486 MATSTFVTEHIRQNAKSLALLIKKSLESSSNEFG-QLLNSANTVQNSSPTKMSSEDIEKN 544

Query: 543 GMRFTKLTENF---QSSSCQKISPLQRSSFFGDLSKGKVTVSYNDAKTTPVSQSVLESRS 599
              F K  E+F   +++ C  IS L  S F       +  VSY +++ + V  + LE+R 
Sbjct: 545 SRMFEKFLEDFSYEKAADC-GIS-LGSSLFQKKFVPCEEYVSYQESRASLVDHNSLENRR 602

Query: 600 KQFNEYMKAFGDIEYKIPSIVEPVMDLPIPSGTTSTE----SADSKTVEKPPKNIKEDMD 655
            Q ++  +A  D       I  P + +   S     +    + D+++ E+  K  KE+MD
Sbjct: 603 HQVSKKYEAERD-------IARPQVHIRAASSHAVCDKEAGAEDNESAEEENKARKEEMD 655

Query: 656 EIVVLKKVKRELPKPKGNDEDAEREI--VDYSKEDKVLVQRQFDXXXXXXXXXXRFDPFS 713
           E++VLK+ K    K +   + A   I  +D     K+L                RFDP++
Sbjct: 656 EVIVLKQRKTLADKEQRAVDKATPSIEPLDLQSARKILEA----PSNNVRRPKKRFDPYA 711

Query: 714 AISEGPKAPKKRKAVTKGKNASFK 737
            ++ GP + KKRK  TKG   SF+
Sbjct: 712 TLAAGPPSVKKRKK-TKGLQKSFR 734

>KAFR0G00420 Chr7 (122124..123248) [1125 bp, 374 aa] {ON} Anc_8.860
          Length = 374

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%)

Query: 326 KHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMSVYARADTHFLLNIF 374
           K  L  L     NF  + +YQ+A W+ R  ++  S +   D HF  NIF
Sbjct: 114 KGDLMNLFSEDTNFIENSRYQVALWKYRKRNRQSSCFGLNDIHFCRNIF 162

>Ecym_7151 Chr7 complement(311699..313309) [1611 bp, 536 aa] {ON}
           similar to Ashbya gossypii AGL303W
          Length = 536

 Score = 32.3 bits (72), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 42/79 (53%), Gaps = 3/79 (3%)

Query: 58  FSIDENSKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLD 117
           + I ++ KPFA+  + +   +RD  N+ D + ++ +     I Q T ++  AGSE   L 
Sbjct: 113 YQITQHYKPFAKGGQLI--MYRDLDNI-DEVMKRIEIVQIQIEQDTGRSLYAGSETGTLI 169

Query: 118 DLVGNDSSSGKRITKPQLH 136
           DL  ++    + +TKPQ +
Sbjct: 170 DLNRSNVPLIELVTKPQFN 188

>KLLA0F24244g Chr6 complement(2261810..2264593) [2784 bp, 927 aa]
           {ON} similar to uniprot|P53917 Saccharomyces cerevisiae
           YNL127W FAR11 Protein involved in G1 cell cycle arrest
           in response to pheromone in a pathway different from the
           Far1p-dependent pathway interacts with Far3p Far7p Far8p
           Far9p and Far10p
          Length = 927

 Score = 32.0 bits (71), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 9/92 (9%)

Query: 124 SSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHYPNP 183
           SSS   + +PQ+H + P   + SQP  P  T  PN LK  ++S Q   A  + P+ +P+ 
Sbjct: 488 SSSNMSLGEPQVHMATP---APSQPASP--TSSPNGLKT-RKSFQ---ANLSYPAFFPSS 538

Query: 184 YDYEISNQEYNNDILETRAPIPSTPWHESEPV 215
            DY+    +  ++ L    P    P++  E +
Sbjct: 539 GDYDTGVVDELSNKLSIAVPETVLPYNMQEAI 570

>TPHA0B03350 Chr2 complement(771611..773683) [2073 bp, 690 aa] {ON}
           Anc_8.239 YER173W
          Length = 690

 Score = 32.0 bits (71), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 3/46 (6%)

Query: 302 QRDLGLYIVSLFDTFHA---SKALGFPKHSLAYLLETLANFKTSKK 344
           Q    +Y   L+D++++    K   F K SLAY LETL++ K S++
Sbjct: 487 QESKSMYNTILYDSYYSPYIKKIRNFKKKSLAYYLETLSDSKASRR 532

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 81,698,792
Number of extensions: 3858082
Number of successful extensions: 12320
Number of sequences better than 10.0: 116
Number of HSP's gapped: 12804
Number of HSP's successfully gapped: 118
Length of query: 738
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 621
Effective length of database: 40,065,477
Effective search space: 24880661217
Effective search space used: 24880661217
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 70 (31.6 bits)