Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0M012206.24ON20720710221e-143
ZYRO0C07700g6.24ON2072079531e-132
Kpol_1037.286.24ON2082089341e-129
Smik_13.1586.24ON2082089341e-129
Ecym_30286.24ON2082089321e-129
YML001W (YPT7)6.24ON2082089311e-129
Suva_13.1616.24ON2082089301e-129
Skud_13.1536.24ON2082089301e-129
TDEL0G044506.24ON2082089291e-128
SAKL0E01386g6.24ON2082089291e-128
NCAS0H008506.24ON2082089261e-128
KLTH0C11132g6.24ON2082089231e-128
ACR003C6.24ON2082089191e-127
Kwal_56.224406.24ON2082089151e-126
CAGL0E02607g6.24ON2082089141e-126
NDAI0D008406.24ON2082089111e-126
KAFR0G026706.24ON2082089021e-124
KLLA0D01265g6.24ON2072058951e-123
TBLA0A071806.24ON2082088891e-122
TPHA0J003606.24ON2092098661e-119
ABR220W8.25ON2041663569e-42
Ecym_15188.25ON2041663491e-40
SAKL0B01012g8.25ON2041663472e-40
KNAG0D026508.70ON2112053447e-40
Kpol_1011.38.70ON2141663431e-39
KAFR0B016608.70ON2061763421e-39
KLLA0D05313g8.25ON2041773402e-39
TBLA0D026508.70ON2171613403e-39
Kwal_14.11168.25ON2041773393e-39
Suva_6.548.70ON2151673394e-39
KLTH0G18788g8.25ON2041773394e-39
NCAS0J006308.70ON2181993404e-39
YFL005W (SEC4)8.70ON2151673394e-39
KLLA0F20471g6.49ON2121653395e-39
CAGL0F02123g8.70ON2151663386e-39
AGL021W8.70ON2121673386e-39
TPHA0P003608.70ON2141673378e-39
TDEL0C009808.70ON2151663361e-38
Smik_6.738.70ON2151673351e-38
Ecym_73058.70ON2131673352e-38
Kwal_23.50588.70ON2131673352e-38
NDAI0G033408.70ON2071673342e-38
NDAI0G030508.25ON2101663333e-38
NCAS0C040208.70ON2101663324e-38
KLTH0A02662g8.70ON2131673324e-38
ZYRO0F03872g8.70ON2171673325e-38
SAKL0B02332g8.70ON2132003325e-38
KLLA0E12079g8.70ON2141673325e-38
Smik_12.3366.49ON2161653325e-38
Skud_12.3416.49ON2161653316e-38
KAFR0C035808.25ON2121663308e-38
TBLA0C004508.25ON2101763308e-38
KNAG0E031008.25ON2121663301e-37
Skud_6.668.70ON2151673272e-37
CAGL0K06017g6.49ON2191773273e-37
YLR262C (YPT6)6.49ON2151653263e-37
Suva_10.3596.49ON2151653263e-37
KAFR0C033308.70ON2101673264e-37
CAGL0K12672g8.25ON2061763254e-37
Suva_6.198.25ON2061763254e-37
Skud_6.328.25ON2061763245e-37
Smik_6.408.25ON2061763245e-37
YFL038C (YPT1)8.25ON2061763245e-37
AGR257C6.49ON2201653257e-37
TPHA0F025006.49ON2151653247e-37
TDEL0C004908.25ON2081663238e-37
ZYRO0F02816g8.25ON2091983231e-36
KAFR0A052606.49ON2351653241e-36
KNAG0G009308.70ON2131613231e-36
Kpol_1023.218.25ON2071773212e-36
KNAG0E027206.49ON2311653222e-36
SAKL0E02090g6.49ON2141663212e-36
Kwal_56.225556.49ON2121663212e-36
ZYRO0C07062g6.49ON2141653212e-36
TPHA0D002708.25ON2071663202e-36
NCAS0C037108.25ON2111663203e-36
Ecym_31376.49ON2211653204e-36
KLTH0C10384g6.49ON2341663197e-36
NCAS0D025006.49ON2221653187e-36
TBLA0E031906.49ON2072113177e-36
TDEL0G042106.49ON2221653179e-36
Kpol_1042.26.49ON2141653142e-35
NDAI0I023806.49ON2221653118e-35
KLLA0D02376g1.289ON2072063046e-34
AER434C3.521ON2191713022e-33
TBLA0C027801.289ON2201683022e-33
Ecym_12073.521ON2171742995e-33
Smik_5.1543.521ON2231752995e-33
Kpol_423.123.521ON2201742987e-33
KAFR0A035601.289ON2071732977e-33
Suva_7.513.521ON2211712988e-33
YOR089C (VPS21)2.196ON2102082969e-33
Suva_5.1283.521ON2231752961e-32
Skud_5.1403.521ON2231752961e-32
YER031C (YPT31)3.521ON2231752962e-32
SAKL0F01914g3.521ON2211742943e-32
KLTH0G01760g3.521ON2181742933e-32
YGL210W (YPT32)3.521ON2221712934e-32
Smik_7.533.521ON2221712934e-32
Skud_7.583.521ON2221712934e-32
TPHA0D034303.521ON2231742934e-32
CAGL0C02453g3.521ON2181722916e-32
TPHA0P009502.196ON2131642908e-32
Kpol_1029.162.196ON2111622881e-31
CAGL0K09394g3.521ON2211662892e-31
TBLA0C049103.521ON2311742892e-31
KLLA0C13728g2.196ON2082072872e-31
Suva_8.1422.196ON2091622863e-31
Smik_14.2342.196ON2201702864e-31
Skud_15.2532.196ON2091622854e-31
ZYRO0E08492g3.521ON2181742864e-31
Ecym_53622.196ON2091622846e-31
CAGL0J08635g2.196ON2081652846e-31
KLLA0B00671g3.521ON2191742847e-31
NCAS0B067202.196ON2121682847e-31
Smik_15.2692.196ON2101622847e-31
NDAI0I029103.521ON2191712847e-31
KNAG0B005803.521ON2251742849e-31
Skud_14.2382.196ON2201692821e-30
KLTH0G08206g2.196ON2121672821e-30
Suva_14.2472.196ON2181672822e-30
Kwal_23.29782.196ON2111782812e-30
YNL093W (YPT53)2.196ON2201692813e-30
NCAS0E006003.521ON2191712803e-30
KAFR0F041603.521ON2451712823e-30
Kpol_1016.241.289ON2111712793e-30
KAFR0J018502.196ON2092072793e-30
TPHA0I027801.289ON2081702768e-30
TDEL0D058903.521ON2291752771e-29
TDEL0C046602.196ON2111652742e-29
KNAG0I010802.196ON2531672754e-29
CAGL0G07689g1.289ON2151712715e-29
KLTH0H09768g1.289ON2291762726e-29
KNAG0C018401.338ON2121762707e-29
KNAG0C016001.289ON2141752708e-29
Ecym_63281.289ON2051772691e-28
Kwal_14.23941.289ON2071762681e-28
TBLA0B018202.196ON2122092682e-28
TDEL0D015701.289ON2171802682e-28
SAKL0D05940g1.289ON2071782662e-28
AAL176C1.289ON2051782662e-28
ZYRO0C15554g2.196ON2111612645e-28
ACL084C2.196ON2071652637e-28
SAKL0E09922g2.196ON2131802639e-28
Skud_11.2471.289ON2341912641e-27
Smik_11.2711.289ON2341912641e-27
ZYRO0G21384g1.289ON2181782621e-27
YKR014C (YPT52)1.289ON2341292631e-27
Suva_11.2461.289ON2361932632e-27
NCAS0B076301.289ON2161732612e-27
TPHA0I025901.338ON2251712594e-27
NDAI0B049801.289ON2272262595e-27
KAFR0C043101.338ON1991222575e-27
ZYRO0B09152g1.338ON2231762587e-27
NCAS0B073601.338ON2251692587e-27
Smik_2.4081.338ON1991662523e-26
TDEL0D020601.338ON2021682514e-26
AEL187C1.338ON2081762506e-26
Suva_4.5261.338ON1981812462e-25
YBR264C (YPT10)1.338ON1991672445e-25
CAGL0I09306g1.338ON2061702411e-24
Skud_2.3971.338ON1992082401e-24
KAFR0D020402.182ON2741632442e-24
Ecym_63091.338ON2081372402e-24
KLTH0G14850g6.90ON2141652393e-24
Kwal_56.233616.90ON2141652394e-24
SAKL0D06490g1.338ON2181852385e-24
Skud_15.3526.90ON2201652378e-24
Smik_15.3706.90ON2201652369e-24
YOR185C (GSP2)6.90ON2201652369e-24
Suva_8.2416.90ON2201652361e-23
Suva_10.3896.90ON2191652361e-23
Skud_12.3756.90ON2191652361e-23
Smik_12.3716.90ON2191652361e-23
YLR293C (GSP1)6.90ON2191652361e-23
ZYRO0D14784g6.90ON2141652342e-23
CAGL0I00594g6.90ON2141652342e-23
Ecym_30976.90ON2141652342e-23
AGR294C6.90ON2141652342e-23
TDEL0G038106.90ON2221652342e-23
KLLA0A04499gsingletonON2141652332e-23
KLLA0C05126g6.90ON2141652332e-23
SAKL0A07744g6.90ON2141652332e-23
NDAI0D026706.90ON2201652307e-23
NCAS0F004406.90ON2191652308e-23
TBLA0E009806.90ON2211652309e-23
KAFR0A048006.90ON2191652299e-23
TPHA0K010606.90ON2131652291e-22
KNAG0F031806.90ON2941652331e-22
Kpol_1009.96.90ON2131652291e-22
NDAI0B041802.182ON3291752332e-22
Kpol_1066.111.338ON2421482265e-22
KAFR0J019702.182ON3181752295e-22
CAGL0J05632g2.200ON1881762226e-22
NDAI0F025602.200ON1901782217e-22
KLTH0H10274g1.338ON2011692211e-21
Kwal_47.190553.521ON1791442191e-21
NDAI0B046801.338ON2231782202e-21
KAFR0J012402.200ON1871702155e-21
NCAS0B068502.182ON3241752225e-21
NCAS0G027302.200ON1871752157e-21
KNAG0M018302.200ON1861702131e-20
TDEL0F027704.73ON2381682161e-20
KLTH0G08294g2.200ON1871752112e-20
Kwal_14.24841.338ON2031692113e-20
YOR101W (RAS1)2.182ON3091532155e-20
Kwal_14.22444.73ON2441682116e-20
ZYRO0G07018g4.73ON2501682126e-20
CAGL0B04521g2.182ON3391532157e-20
SAKL0E09834g2.200ON1901762061e-19
Skud_15.2662.182ON3131532121e-19
Suva_7.4434.73ON2711682102e-19
ZYRO0C15466g2.200ON1891772052e-19
Skud_7.4764.73ON2721682092e-19
TDEL0C046302.200ON1911792042e-19
Suva_14.2502.200ON1921762042e-19
ZYRO0D03146g1.215ON2771722092e-19
KLLA0F01232g1.338ON2101712053e-19
KAFR0F036704.73ON2631682083e-19
Smik_15.2812.182ON3121532103e-19
KLTH0D08932g2.182ON2921782093e-19
KLTH0H09042g4.73ON2421682063e-19
KLLA0C13816g2.200ON1871752033e-19
NDAI0D038204.73ON2681682083e-19
Smik_6.2574.73ON2711682073e-19
NCAS0B080901.215ON2891732083e-19
Ecym_53652.200ON1891762034e-19
YKR055W (RHO4)1.215ON2911712084e-19
SAKL0C06424g1.215ON2871722084e-19
Suva_11.2891.215ON2911722075e-19
YGR152C (RSR1)4.73ON2721682065e-19
Kpol_1029.82.182ON3051532085e-19
SAKL0E10252g2.182ON2681762065e-19
TPHA0P009202.200ON1881732016e-19
Suva_8.1552.182ON3161532077e-19
KLLA0C13387g2.182ON2841752058e-19
ACL087C2.200ON1871742009e-19
YNL090W (RHO2)2.200ON1921762009e-19
NCAS0A018904.73ON2711682041e-18
AFR464W4.73ON2641682041e-18
Skud_14.2322.182ON3231532061e-18
YNL098C (RAS2)2.182ON3221532061e-18
Kwal_26.83872.182ON2921562051e-18
TBLA0B01750singletonON3731752071e-18
Smik_14.2372.200ON1921761991e-18
Skud_11.2911.215ON2911712041e-18
KNAG0C012601.215ON2991652042e-18
Smik_14.2272.182ON3221532042e-18
Suva_14.2412.182ON3221752042e-18
Kpol_1029.182.200ON1881761982e-18
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0M01220
         (207 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0M01220 Chr13 (222591..223214) [624 bp, 207 aa] {ON} Anc_6.2...   398   e-143
ZYRO0C07700g Chr3 complement(584547..585170) [624 bp, 207 aa] {O...   371   e-132
Kpol_1037.28 s1037 (68071..68697) [627 bp, 208 aa] {ON} (68071.....   364   e-129
Smik_13.158 Chr13 (258333..258959) [627 bp, 208 aa] {ON} YML001W...   364   e-129
Ecym_3028 Chr3 (54759..55385) [627 bp, 208 aa] {ON} similar to A...   363   e-129
YML001W Chr13 (267174..267800) [627 bp, 208 aa] {ON}  YPT7Rab fa...   363   e-129
Suva_13.161 Chr13 (257150..257776) [627 bp, 208 aa] {ON} YML001W...   362   e-129
Skud_13.153 Chr13 (253075..253701) [627 bp, 208 aa] {ON} YML001W...   362   e-129
TDEL0G04450 Chr7 complement(808210..808836) [627 bp, 208 aa] {ON...   362   e-128
SAKL0E01386g Chr5 (105246..105872) [627 bp, 208 aa] {ON} highly ...   362   e-128
NCAS0H00850 Chr8 (155266..155892) [627 bp, 208 aa] {ON} Anc_6.24      361   e-128
KLTH0C11132g Chr3 complement(915337..915963) [627 bp, 208 aa] {O...   360   e-128
ACR003C Chr3 complement(359762..360388) [627 bp, 208 aa] {ON} Sy...   358   e-127
Kwal_56.22440 s56 (130574..131200) [627 bp, 208 aa] {ON} YML001W...   357   e-126
CAGL0E02607g Chr5 complement(248998..249624) [627 bp, 208 aa] {O...   356   e-126
NDAI0D00840 Chr4 (189925..190551) [627 bp, 208 aa] {ON} Anc_6.24      355   e-126
KAFR0G02670 Chr7 complement(552130..552756) [627 bp, 208 aa] {ON...   352   e-124
KLLA0D01265g Chr4 (110784..111407) [624 bp, 207 aa] {ON} highly ...   349   e-123
TBLA0A07180 Chr1 complement(1787774..1788400) [627 bp, 208 aa] {...   347   e-122
TPHA0J00360 Chr10 (80553..81182) [630 bp, 209 aa] {ON} Anc_6.24 ...   338   e-119
ABR220W Chr2 (817292..817906) [615 bp, 204 aa] {ON} Syntenic hom...   141   9e-42
Ecym_1518 Chr1 (1069582..1070196) [615 bp, 204 aa] {ON} similar ...   139   1e-40
SAKL0B01012g Chr2 complement(92466..93080) [615 bp, 204 aa] {ON}...   138   2e-40
KNAG0D02650 Chr4 (474662..475297) [636 bp, 211 aa] {ON} Anc_8.70...   137   7e-40
Kpol_1011.3 s1011 complement(4828..5472) [645 bp, 214 aa] {ON} c...   136   1e-39
KAFR0B01660 Chr2 complement(318959..319579) [621 bp, 206 aa] {ON...   136   1e-39
KLLA0D05313g Chr4 (459496..460110) [615 bp, 204 aa] {ON} highly ...   135   2e-39
TBLA0D02650 Chr4 (655924..656577) [654 bp, 217 aa] {ON} Anc_8.70...   135   3e-39
Kwal_14.1116 s14 complement(202534..203148) [615 bp, 204 aa] {ON...   135   3e-39
Suva_6.54 Chr6 (102191..102838) [648 bp, 215 aa] {ON} YFL005W (R...   135   4e-39
KLTH0G18788g Chr7 (1624218..1624832) [615 bp, 204 aa] {ON} highl...   135   4e-39
NCAS0J00630 Chr10 complement(95335..95991) [657 bp, 218 aa] {ON}...   135   4e-39
YFL005W Chr6 (130334..130981) [648 bp, 215 aa] {ON}  SEC4Rab fam...   135   4e-39
KLLA0F20471g Chr6 (1901749..1902387) [639 bp, 212 aa] {ON} highl...   135   5e-39
CAGL0F02123g Chr6 (212117..212764) [648 bp, 215 aa] {ON} highly ...   134   6e-39
AGL021W Chr7 (681754..682392) [639 bp, 212 aa] {ON} Syntenic hom...   134   6e-39
TPHA0P00360 Chr16 (76379..77023) [645 bp, 214 aa] {ON} Anc_8.70 ...   134   8e-39
TDEL0C00980 Chr3 (164219..164866) [648 bp, 215 aa] {ON} Anc_8.70...   134   1e-38
Smik_6.73 Chr6 (143556..144203) [648 bp, 215 aa] {ON} YFL005W (R...   133   1e-38
Ecym_7305 Chr7 (650045..650686) [642 bp, 213 aa] {ON} similar to...   133   2e-38
Kwal_23.5058 s23 (989533..990174) [642 bp, 213 aa] {ON} YFL005W ...   133   2e-38
NDAI0G03340 Chr7 (792718..793341) [624 bp, 207 aa] {ON} Anc_8.70      133   2e-38
NDAI0G03050 Chr7 complement(711396..712028) [633 bp, 210 aa] {ON...   132   3e-38
NCAS0C04020 Chr3 (817944..818576) [633 bp, 210 aa] {ON} Anc_1.21...   132   4e-38
KLTH0A02662g Chr1 complement(226313..226954) [642 bp, 213 aa] {O...   132   4e-38
ZYRO0F03872g Chr6 (329213..329866) [654 bp, 217 aa] {ON} highly ...   132   5e-38
SAKL0B02332g Chr2 (227078..227719) [642 bp, 213 aa] {ON} highly ...   132   5e-38
KLLA0E12079g Chr5 (1075299..1075943) [645 bp, 214 aa] {ON} highl...   132   5e-38
Smik_12.336 Chr12 complement(606255..606905) [651 bp, 216 aa] {O...   132   5e-38
Skud_12.341 Chr12 complement(609187..609837) [651 bp, 216 aa] {O...   132   6e-38
KAFR0C03580 Chr3 (733658..734296) [639 bp, 212 aa] {ON} Anc_8.25...   131   8e-38
TBLA0C00450 Chr3 complement(84352..84984) [633 bp, 210 aa] {ON} ...   131   8e-38
KNAG0E03100 Chr5 complement(618438..619076) [639 bp, 212 aa] {ON...   131   1e-37
Skud_6.66 Chr6 (132521..133168) [648 bp, 215 aa] {ON} YFL005W (R...   130   2e-37
CAGL0K06017g Chr11 complement(586922..587581) [660 bp, 219 aa] {...   130   3e-37
YLR262C Chr12 complement(668244..668891) [648 bp, 215 aa] {ON}  ...   130   3e-37
Suva_10.359 Chr10 complement(629445..630092) [648 bp, 215 aa] {O...   130   3e-37
KAFR0C03330 Chr3 (679443..680075) [633 bp, 210 aa] {ON} Anc_8.70...   130   4e-37
CAGL0K12672g Chr11 (1256370..1256990) [621 bp, 206 aa] {ON} high...   129   4e-37
Suva_6.19 Chr6 complement(28872..29492) [621 bp, 206 aa] {ON} YF...   129   4e-37
Skud_6.32 Chr6 complement(58531..59151) [621 bp, 206 aa] {ON} YF...   129   5e-37
Smik_6.40 Chr6 complement(70749..71369) [621 bp, 206 aa] {ON} YF...   129   5e-37
YFL038C Chr6 complement(55366..55986) [621 bp, 206 aa] {ON}  YPT...   129   5e-37
AGR257C Chr7 complement(1225880..1226542) [663 bp, 220 aa] {ON} ...   129   7e-37
TPHA0F02500 Chr6 complement(551815..552462) [648 bp, 215 aa] {ON...   129   7e-37
TDEL0C00490 Chr3 complement(75792..76418) [627 bp, 208 aa] {ON} ...   129   8e-37
ZYRO0F02816g Chr6 complement(237904..238533) [630 bp, 209 aa] {O...   129   1e-36
KAFR0A05260 Chr1 complement(1040753..1041460) [708 bp, 235 aa] {...   129   1e-36
KNAG0G00930 Chr7 (183672..184313) [642 bp, 213 aa] {ON} Anc_8.70...   129   1e-36
Kpol_1023.21 s1023 complement(39597..40220) [624 bp, 207 aa] {ON...   128   2e-36
KNAG0E02720 Chr5 (541478..542173) [696 bp, 231 aa] {ON}               128   2e-36
SAKL0E02090g Chr5 complement(160194..160838) [645 bp, 214 aa] {O...   128   2e-36
Kwal_56.22555 s56 complement(178575..179213) [639 bp, 212 aa] {O...   128   2e-36
ZYRO0C07062g Chr3 (532175..532819) [645 bp, 214 aa] {ON} highly ...   128   2e-36
TPHA0D00270 Chr4 complement(37369..37992) [624 bp, 207 aa] {ON} ...   127   2e-36
NCAS0C03710 Chr3 complement(747168..747803) [636 bp, 211 aa] {ON...   127   3e-36
Ecym_3137 Chr3 (254058..254723) [666 bp, 221 aa] {ON} similar to...   127   4e-36
KLTH0C10384g Chr3 (861122..861826) [705 bp, 234 aa] {ON} highly ...   127   7e-36
NCAS0D02500 Chr4 (474037..474705) [669 bp, 222 aa] {ON} Anc_6.49      127   7e-36
TBLA0E03190 Chr5 complement(803935..804558) [624 bp, 207 aa] {ON...   126   7e-36
TDEL0G04210 Chr7 (764766..765434) [669 bp, 222 aa] {ON} Anc_6.49...   126   9e-36
Kpol_1042.2 s1042 complement(4659..5303) [645 bp, 214 aa] {ON} c...   125   2e-35
NDAI0I02380 Chr9 complement(542975..543643) [669 bp, 222 aa] {ON}     124   8e-35
KLLA0D02376g Chr4 (201512..202135) [624 bp, 207 aa] {ON} similar...   121   6e-34
AER434C Chr5 complement(1466442..1467052,1467106..1467154) [660 ...   120   2e-33
TBLA0C02780 Chr3 complement(668605..669267) [663 bp, 220 aa] {ON...   120   2e-33
Ecym_1207 Chr1 (420728..420773,421159..421766) [654 bp, 217 aa] ...   119   5e-33
Smik_5.154 Chr5 complement(218975..219646) [672 bp, 223 aa] {ON}...   119   5e-33
Kpol_423.12 s423 (26761..27423) [663 bp, 220 aa] {ON} (26761..27...   119   7e-33
KAFR0A03560 Chr1 (729254..729877) [624 bp, 207 aa] {ON} Anc_1.28...   119   7e-33
Suva_7.51 Chr7 (90232..90897) [666 bp, 221 aa] {ON} YGL210W (REAL)    119   8e-33
YOR089C Chr15 complement(490196..490828) [633 bp, 210 aa] {ON}  ...   118   9e-33
Suva_5.128 Chr5 complement(190103..190774) [672 bp, 223 aa] {ON}...   118   1e-32
Skud_5.140 Chr5 complement(211975..212646) [672 bp, 223 aa] {ON}...   118   1e-32
YER031C Chr5 complement(214076..214747) [672 bp, 223 aa] {ON}  Y...   118   2e-32
SAKL0F01914g Chr6 (162387..162432,162627..163246) [666 bp, 221 a...   117   3e-32
KLTH0G01760g Chr7 (132121..132166,132307..132917) [657 bp, 218 a...   117   3e-32
YGL210W Chr7 (93792..94460) [669 bp, 222 aa] {ON}  YPT32Rab fami...   117   4e-32
Smik_7.53 Chr7 (88592..89260) [669 bp, 222 aa] {ON} YGL210W (REAL)    117   4e-32
Skud_7.58 Chr7 (99129..99797) [669 bp, 222 aa] {ON} YGL210W (REAL)    117   4e-32
TPHA0D03430 Chr4 complement(719751..720422) [672 bp, 223 aa] {ON...   117   4e-32
CAGL0C02453g Chr3 (247493..248149) [657 bp, 218 aa] {ON} highly ...   116   6e-32
TPHA0P00950 Chr16 complement(193256..193897) [642 bp, 213 aa] {O...   116   8e-32
Kpol_1029.16 s1029 (30724..31359) [636 bp, 211 aa] {ON} (30724.....   115   1e-31
CAGL0K09394g Chr11 complement(930063..930728) [666 bp, 221 aa] {...   115   2e-31
TBLA0C04910 Chr3 complement(1193590..1194285) [696 bp, 231 aa] {...   115   2e-31
KLLA0C13728g Chr3 (1173329..1173955) [627 bp, 208 aa] {ON} highl...   115   2e-31
Suva_8.142 Chr8 complement(247554..248183) [630 bp, 209 aa] {ON}...   114   3e-31
Smik_14.234 Chr14 (430086..430748) [663 bp, 220 aa] {ON} YNL093W...   114   4e-31
Skud_15.253 Chr15 complement(446672..447301) [630 bp, 209 aa] {O...   114   4e-31
ZYRO0E08492g Chr5 complement(676074..676684,676766..676811) [657...   114   4e-31
Ecym_5362 Chr5 (735204..735833) [630 bp, 209 aa] {ON} similar to...   114   6e-31
CAGL0J08635g Chr10 complement(856102..856728) [627 bp, 208 aa] {...   114   6e-31
KLLA0B00671g Chr2 complement(50393..51006,51417..51462) [660 bp,...   114   7e-31
NCAS0B06720 Chr2 complement(1278798..1279436) [639 bp, 212 aa] {...   114   7e-31
Smik_15.269 Chr15 complement(451402..452034) [633 bp, 210 aa] {O...   114   7e-31
NDAI0I02910 Chr9 complement(688721..689380) [660 bp, 219 aa] {ON...   114   7e-31
KNAG0B00580 Chr2 (94797..95474) [678 bp, 225 aa] {ON} Anc_3.521 ...   114   9e-31
Skud_14.238 Chr14 (440139..440801) [663 bp, 220 aa] {ON} YNL093W...   113   1e-30
KLTH0G08206g Chr7 (666127..666765) [639 bp, 212 aa] {ON} highly ...   113   1e-30
Suva_14.247 Chr14 (448490..449146) [657 bp, 218 aa] {ON} YNL093W...   113   2e-30
Kwal_23.2978 s23 (97956..98591) [636 bp, 211 aa] {ON} YOR089C (V...   112   2e-30
YNL093W Chr14 (449868..450530) [663 bp, 220 aa] {ON}  YPT53Rab f...   112   3e-30
NCAS0E00600 Chr5 (102956..103615) [660 bp, 219 aa] {ON} Anc_3.521     112   3e-30
KAFR0F04160 Chr6 complement(819022..819759) [738 bp, 245 aa] {ON...   113   3e-30
Kpol_1016.24 s1016 (61782..62417) [636 bp, 211 aa] {ON} (61782.....   112   3e-30
KAFR0J01850 Chr10 complement(356911..357540) [630 bp, 209 aa] {O...   112   3e-30
TPHA0I02780 Chr9 complement(614605..615231) [627 bp, 208 aa] {ON...   110   8e-30
TDEL0D05890 Chr4 complement(1067167..1067856) [690 bp, 229 aa] {...   111   1e-29
TDEL0C04660 Chr3 complement(845203..845838) [636 bp, 211 aa] {ON...   110   2e-29
KNAG0I01080 Chr9 (207327..208088) [762 bp, 253 aa] {ON} Anc_2.19...   110   4e-29
CAGL0G07689g Chr7 complement(729919..730566) [648 bp, 215 aa] {O...   108   5e-29
KLTH0H09768g Chr8 (840625..841314) [690 bp, 229 aa] {ON} similar...   109   6e-29
KNAG0C01840 Chr3 (363258..363896) [639 bp, 212 aa] {ON} Anc_1.33...   108   7e-29
KNAG0C01600 Chr3 (317298..317942) [645 bp, 214 aa] {ON} Anc_1.28...   108   8e-29
Ecym_6328 Chr6 complement(629586..630203) [618 bp, 205 aa] {ON} ...   108   1e-28
Kwal_14.2394 s14 (738645..739268) [624 bp, 207 aa] {ON} YKR014C ...   107   1e-28
TBLA0B01820 Chr2 complement(415800..416438) [639 bp, 212 aa] {ON...   107   2e-28
TDEL0D01570 Chr4 (310454..311107) [654 bp, 217 aa] {ON} Anc_1.28...   107   2e-28
SAKL0D05940g Chr4 (485575..486198) [624 bp, 207 aa] {ON} highly ...   107   2e-28
AAL176C Chr1 complement(31588..32205) [618 bp, 205 aa] {ON} Synt...   107   2e-28
ZYRO0C15554g Chr3 complement(1218190..1218825) [636 bp, 211 aa] ...   106   5e-28
ACL084C Chr3 complement(199020..199643) [624 bp, 207 aa] {ON} Sy...   105   7e-28
SAKL0E09922g Chr5 complement(829249..829890) [642 bp, 213 aa] {O...   105   9e-28
Skud_11.247 Chr11 complement(445982..446686) [705 bp, 234 aa] {O...   106   1e-27
Smik_11.271 Chr11 complement(452840..453544) [705 bp, 234 aa] {O...   106   1e-27
ZYRO0G21384g Chr7 complement(1763055..1763711) [657 bp, 218 aa] ...   105   1e-27
YKR014C Chr11 complement(465367..466071) [705 bp, 234 aa] {ON}  ...   105   1e-27
Suva_11.246 Chr11 complement(449412..450122) [711 bp, 236 aa] {O...   105   2e-27
NCAS0B07630 Chr2 complement(1443664..1444314) [651 bp, 216 aa] {...   105   2e-27
TPHA0I02590 Chr9 complement(571327..572004) [678 bp, 225 aa] {ON...   104   4e-27
NDAI0B04980 Chr2 complement(1216833..1217516) [684 bp, 227 aa] {...   104   5e-27
KAFR0C04310 Chr3 (855871..856470) [600 bp, 199 aa] {ON} Anc_1.33...   103   5e-27
ZYRO0B09152g Chr2 complement(714608..715279) [672 bp, 223 aa] {O...   103   7e-27
NCAS0B07360 Chr2 complement(1389230..1389907) [678 bp, 225 aa] {...   103   7e-27
Smik_2.408 Chr2 complement(723817..724416) [600 bp, 199 aa] {ON}...   101   3e-26
TDEL0D02060 Chr4 (403098..403706) [609 bp, 202 aa] {ON} Anc_1.33...   101   4e-26
AEL187C Chr5 complement(284984..285610) [627 bp, 208 aa] {ON} Sy...   100   6e-26
Suva_4.526 Chr4 complement(909423..910019) [597 bp, 198 aa] {ON}...    99   2e-25
YBR264C Chr2 complement(737770..738369) [600 bp, 199 aa] {ON}  Y...    99   5e-25
CAGL0I09306g Chr9 complement(897357..897977) [621 bp, 206 aa] {O...    97   1e-24
Skud_2.397 Chr2 complement(706771..707370) [600 bp, 199 aa] {ON}...    97   1e-24
KAFR0D02040 Chr4 complement(412576..413382,413464..413481) [825 ...    99   2e-24
Ecym_6309 Chr6 (585998..586624) [627 bp, 208 aa] {ON} similar to...    97   2e-24
KLTH0G14850g Chr7 (1304240..1304884) [645 bp, 214 aa] {ON} highl...    97   3e-24
Kwal_56.23361 s56 complement(508046..508690) [645 bp, 214 aa] {O...    97   4e-24
SAKL0D06490g Chr4 complement(531028..531684) [657 bp, 218 aa] {O...    96   5e-24
Skud_15.352 Chr15 complement(632241..632903) [663 bp, 220 aa] {O...    96   8e-24
Smik_15.370 Chr15 complement(637457..638119) [663 bp, 220 aa] {O...    96   9e-24
YOR185C Chr15 complement(681444..682106) [663 bp, 220 aa] {ON}  ...    96   9e-24
Suva_8.241 Chr8 complement(432445..433107) [663 bp, 220 aa] {ON}...    96   1e-23
Suva_10.389 Chr10 complement(681930..682589) [660 bp, 219 aa] {O...    96   1e-23
Skud_12.375 Chr12 complement(661797..662456) [660 bp, 219 aa] {O...    96   1e-23
Smik_12.371 Chr12 complement(658971..659630) [660 bp, 219 aa] {O...    96   1e-23
YLR293C Chr12 complement(720771..721430) [660 bp, 219 aa] {ON}  ...    96   1e-23
ZYRO0D14784g Chr4 complement(1247520..1248164) [645 bp, 214 aa] ...    95   2e-23
CAGL0I00594g Chr9 (44835..45479) [645 bp, 214 aa] {ON} highly si...    95   2e-23
Ecym_3097 Chr3 (181482..182126) [645 bp, 214 aa] {ON} similar to...    95   2e-23
AGR294C Chr7 complement(1287036..1287680) [645 bp, 214 aa] {ON} ...    95   2e-23
TDEL0G03810 Chr7 (699414..700082) [669 bp, 222 aa] {ON} Anc_6.90...    95   2e-23
KLLA0A04499g Chr1 complement(404732..405376) [645 bp, 214 aa] {O...    94   2e-23
KLLA0C05126g Chr3 complement(463657..464301) [645 bp, 214 aa] {O...    94   2e-23
SAKL0A07744g Chr1 (688406..689050) [645 bp, 214 aa] {ON} highly ...    94   2e-23
NDAI0D02670 Chr4 (618909..619571) [663 bp, 220 aa] {ON} Anc_6.90       93   7e-23
NCAS0F00440 Chr6 complement(79004..79663) [660 bp, 219 aa] {ON} ...    93   8e-23
TBLA0E00980 Chr5 (224289..224954) [666 bp, 221 aa] {ON} Anc_6.90...    93   9e-23
KAFR0A04800 Chr1 (954630..955289) [660 bp, 219 aa] {ON} Anc_6.90...    93   9e-23
TPHA0K01060 Chr11 (219078..219719) [642 bp, 213 aa] {ON} Anc_6.9...    93   1e-22
KNAG0F03180 Chr6 complement(598089..598973) [885 bp, 294 aa] {ON...    94   1e-22
Kpol_1009.9 s1009 complement(23990..24631) [642 bp, 213 aa] {ON}...    93   1e-22
NDAI0B04180 Chr2 (1055285..1056274) [990 bp, 329 aa] {ON} Anc_2....    94   2e-22
Kpol_1066.11 s1066 complement(18137..18865) [729 bp, 242 aa] {ON...    92   5e-22
KAFR0J01970 Chr10 (379033..379989) [957 bp, 318 aa] {ON} Anc_2.1...    93   5e-22
CAGL0J05632g Chr10 complement(539466..540032) [567 bp, 188 aa] {...    90   6e-22
NDAI0F02560 Chr6 complement(629428..630000) [573 bp, 190 aa] {ON}      90   7e-22
KLTH0H10274g Chr8 complement(882443..883048) [606 bp, 201 aa] {O...    90   1e-21
Kwal_47.19055 s47 complement(1078494..1079033) [540 bp, 179 aa] ...    89   1e-21
NDAI0B04680 Chr2 complement(1157279..1157950) [672 bp, 223 aa] {...    89   2e-21
KAFR0J01240 Chr10 complement(229638..230201) [564 bp, 187 aa] {O...    87   5e-21
NCAS0B06850 Chr2 (1305199..1306173) [975 bp, 324 aa] {ON} Anc_2....    90   5e-21
NCAS0G02730 Chr7 (491357..491920) [564 bp, 187 aa] {ON}                87   7e-21
KNAG0M01830 Chr13 complement(339904..340464) [561 bp, 186 aa] {O...    87   1e-20
TDEL0F02770 Chr6 complement(507090..507806) [717 bp, 238 aa] {ON...    88   1e-20
KLTH0G08294g Chr7 (678358..678921) [564 bp, 187 aa] {ON} highly ...    86   2e-20
Kwal_14.2484 s14 complement(777938..778549) [612 bp, 203 aa] {ON...    86   3e-20
YOR101W Chr15 (515244..516173) [930 bp, 309 aa] {ON}  RAS1GTPase...    87   5e-20
Kwal_14.2244 s14 (671441..672175) [735 bp, 244 aa] {ON} YGR152C ...    86   6e-20
ZYRO0G07018g Chr7 complement(559273..560025) [753 bp, 250 aa] {O...    86   6e-20
CAGL0B04521g Chr2 complement(439732..440751) [1020 bp, 339 aa] {...    87   7e-20
SAKL0E09834g Chr5 complement(819736..820308) [573 bp, 190 aa] {O...    84   1e-19
Skud_15.266 Chr15 (471563..472504) [942 bp, 313 aa] {ON} YOR101W...    86   1e-19
Suva_7.443 Chr7 complement(764401..765216) [816 bp, 271 aa] {ON}...    86   2e-19
ZYRO0C15466g Chr3 complement(1208350..1208919) [570 bp, 189 aa] ...    84   2e-19
Skud_7.476 Chr7 complement(778308..779126) [819 bp, 272 aa] {ON}...    85   2e-19
TDEL0C04630 Chr3 complement(837302..837877) [576 bp, 191 aa] {ON...    83   2e-19
Suva_14.250 Chr14 (455251..455829) [579 bp, 192 aa] {ON} YNL090W...    83   2e-19
ZYRO0D03146g Chr4 complement(244206..245039) [834 bp, 277 aa] {O...    85   2e-19
KLLA0F01232g Chr6 complement(114430..115062) [633 bp, 210 aa] {O...    84   3e-19
KAFR0F03670 Chr6 complement(726736..727527) [792 bp, 263 aa] {ON...    85   3e-19
Smik_15.281 Chr15 (476294..477232) [939 bp, 312 aa] {ON} YOR101W...    86   3e-19
KLTH0D08932g Chr4 (742772..742786,742899..743762) [879 bp, 292 a...    85   3e-19
KLTH0H09042g Chr8 (776732..777460) [729 bp, 242 aa] {ON} similar...    84   3e-19
KLLA0C13816g Chr3 (1183412..1183975) [564 bp, 187 aa] {ON} highl...    83   3e-19
NDAI0D03820 Chr4 complement(908209..909015) [807 bp, 268 aa] {ON...    85   3e-19
Smik_6.257 Chr6 complement(414005..414820) [816 bp, 271 aa] {ON}...    84   3e-19
NCAS0B08090 Chr2 (1545134..1546003) [870 bp, 289 aa] {ON} Anc_1....    85   3e-19
Ecym_5365 Chr5 (743477..744046) [570 bp, 189 aa] {ON} similar to...    83   4e-19
YKR055W Chr11 (548216..549091) [876 bp, 291 aa] {ON}  RHO4Non-es...    85   4e-19
SAKL0C06424g Chr3 complement(591532..592395) [864 bp, 287 aa] {O...    85   4e-19
Suva_11.289 Chr11 (531935..532810) [876 bp, 291 aa] {ON} YKR055W...    84   5e-19
YGR152C Chr7 complement(794674..795492) [819 bp, 272 aa] {ON}  R...    84   5e-19
Kpol_1029.8 s1029 complement(15899..16816) [918 bp, 305 aa] {ON}...    85   5e-19
SAKL0E10252g Chr5 (855721..855735,855900..856691) [807 bp, 268 a...    84   5e-19
TPHA0P00920 Chr16 complement(185904..186470) [567 bp, 188 aa] {O...    82   6e-19
Suva_8.155 Chr8 (272370..273320) [951 bp, 316 aa] {ON} YOR101W (...    84   7e-19
KLLA0C13387g Chr3 complement(1142002..1142841,1143162..1143176) ...    84   8e-19
ACL087C Chr3 complement(191573..192136) [564 bp, 187 aa] {ON} Sy...    82   9e-19
YNL090W Chr14 (456565..457143) [579 bp, 192 aa] {ON}  RHO2Non-es...    82   9e-19
NCAS0A01890 Chr1 complement(364746..365561) [816 bp, 271 aa] {ON...    83   1e-18
AFR464W Chr6 (1274600..1275394) [795 bp, 264 aa] {ON} Syntenic h...    83   1e-18
Skud_14.232 Chr14 complement(429739..430710) [972 bp, 323 aa] {O...    84   1e-18
YNL098C Chr14 complement(439602..440570) [969 bp, 322 aa] {ON}  ...    84   1e-18
Kwal_26.8387 s26 (763564..764442) [879 bp, 292 aa] {ON} YNL098C ...    84   1e-18
TBLA0B01750 Chr2 complement(392769..393890) [1122 bp, 373 aa] {O...    84   1e-18
Smik_14.237 Chr14 (436872..437450) [579 bp, 192 aa] {ON} YNL090W...    81   1e-18
Skud_11.291 Chr11 (529726..530601) [876 bp, 291 aa] {ON} YKR055W...    83   1e-18
KNAG0C01260 Chr3 complement(243934..244833) [900 bp, 299 aa] {ON...    83   2e-18
Smik_14.227 Chr14 complement(419257..420225) [969 bp, 322 aa] {O...    83   2e-18
Suva_14.241 Chr14 complement(437053..438021) [969 bp, 322 aa] {O...    83   2e-18
Kpol_1029.18 s1029 (37197..37763) [567 bp, 188 aa] {ON} (37197.....    81   2e-18
ADL262W Chr4 (243996..244010,244072..244869) [813 bp, 270 aa] {O...    82   2e-18
SAKL0H20746g Chr8 (1817259..1818014) [756 bp, 251 aa] {ON} simil...    82   2e-18
ZYRO0B09438g Chr2 (738659..739555) [897 bp, 298 aa] {ON} similar...    82   3e-18
Ecym_1407 Chr1 (846135..846941) [807 bp, 268 aa] {ON} similar to...    82   3e-18
Kpol_1026.12 s1026 complement(27073..28062) [990 bp, 329 aa] {ON...    83   3e-18
Smik_11.317 Chr11 (538087..539016) [930 bp, 309 aa] {ON} YKR055W...    82   3e-18
Skud_14.241 Chr14 (446886..447464) [579 bp, 192 aa] {ON} YNL090W...    80   3e-18
KNAG0H03380 Chr8 (632140..633114) [975 bp, 324 aa] {ON} Anc_2.18...    82   4e-18
ZYRO0E03608g Chr5 complement(279670..280272) [603 bp, 200 aa] {O...    80   5e-18
KLLA0C12001g Chr3 complement(1029092..1029871) [780 bp, 259 aa] ...    80   1e-17
TBLA0B01800 Chr2 complement(408546..409136) [591 bp, 196 aa] {ON...    79   1e-17
KAFR0G00680 Chr7 complement(170317..171210) [894 bp, 297 aa] {ON...    81   1e-17
ABR183W Chr2 (755915..756538) [624 bp, 207 aa] {ON} Rho1b; Synte...    79   1e-17
KLTH0F05698g Chr6 complement(489561..490376) [816 bp, 271 aa] {O...    80   1e-17
Kwal_55.21941 s55 (1048693..1049322) [630 bp, 209 aa] {ON} YPR16...    79   1e-17
KLTH0F18612g Chr6 (1513182..1513811) [630 bp, 209 aa] {ON} simil...    79   2e-17
Ecym_7212 Chr7 (444427..445050) [624 bp, 207 aa] {ON} similar to...    79   2e-17
CAGL0E03113g Chr5 complement(289401..290372) [972 bp, 323 aa] {O...    80   2e-17
SAKL0F15642g Chr6 (1273987..1274616) [630 bp, 209 aa] {ON} highl...    78   3e-17
KNAG0D03780 Chr4 complement(688854..689768) [915 bp, 304 aa] {ON...    80   3e-17
Ecym_5349 Chr5 complement(708225..709076,709277..709288) [864 bp...    79   3e-17
ZYRO0D01452g Chr4 complement(104471..105133) [663 bp, 220 aa] {O...    78   4e-17
TDEL0B05600 Chr2 complement(991741..992346) [606 bp, 201 aa] {ON...    77   6e-17
Kpol_520.36 s520 complement(90395..91072) [678 bp, 225 aa] {ON} ...    77   8e-17
TBLA0B00370 Chr2 (68828..69868) [1041 bp, 346 aa] {ON}                 79   8e-17
NDAI0B05400 Chr2 (1326549..1327436) [888 bp, 295 aa] {ON} Anc_1....    79   8e-17
Kpol_1039.20 s1039 (65494..66126) [633 bp, 210 aa] {ON} (65494.....    77   1e-16
Kwal_34.16142 s34 complement(220030..220608) [579 bp, 192 aa] {O...    76   1e-16
KAFR0J01600 Chr10 complement(290538..291206) [669 bp, 222 aa] {O...    77   1e-16
Kwal_33.14015 s33 complement(484017..484832) [816 bp, 271 aa] {O...    78   1e-16
TPHA0B03000 Chr2 complement(683258..684175) [918 bp, 305 aa] {ON...    78   1e-16
Ecym_3286 Chr3 (542469..543143) [675 bp, 224 aa] {ON} similar to...    77   1e-16
KNAG0E01840 Chr5 (380757..381419) [663 bp, 220 aa] {ON} Anc_2.24...    77   1e-16
Suva_3.60 Chr3 (81874..82491) [618 bp, 205 aa] {ON} YCR027C (REAL)     76   1e-16
ADL252W Chr4 (258347..259021) [675 bp, 224 aa] {ON} Syntenic hom...    77   2e-16
Ecym_4146 Chr4 complement(312161..312736) [576 bp, 191 aa] {ON} ...    76   2e-16
AGL093W Chr7 (532002..532577) [576 bp, 191 aa] {ON} Syntenic hom...    76   2e-16
TDEL0F01360 Chr6 complement(241607..242470) [864 bp, 287 aa] {ON...    77   2e-16
KLLA0B10626g Chr2 (936497..937123) [627 bp, 208 aa] {ON} uniprot...    76   2e-16
KLLA0A04213g Chr1 complement(382243..382818) [576 bp, 191 aa] {O...    75   2e-16
YIL118W Chr9 (139752..140447) [696 bp, 231 aa] {ON}  RHO3Non-ess...    76   3e-16
TPHA0K01820 Chr11 complement(385771..386733) [963 bp, 320 aa] {O...    77   3e-16
Smik_9.51 Chr9 (117526..118221) [696 bp, 231 aa] {ON} YIL118W (R...    76   3e-16
KLLA0A05643g Chr1 (528976..529632) [657 bp, 218 aa] {ON} similar...    75   3e-16
ZYRO0C09680g Chr3 (735760..736698) [939 bp, 312 aa] {ON} similar...    77   3e-16
CAGL0G08558g Chr7 complement(804969..805652) [684 bp, 227 aa] {O...    75   4e-16
Suva_9.76 Chr9 (134573..135271) [699 bp, 232 aa] {ON} YIL118W (R...    75   4e-16
CAGL0L11242g Chr12 (1199371..1200135) [765 bp, 254 aa] {ON} high...    76   5e-16
Skud_9.53 Chr9 (116575..117270) [696 bp, 231 aa] {ON} YIL118W (R...    75   5e-16
KLTH0F18590g Chr6 (1511729..1512355) [627 bp, 208 aa] {ON} highl...    75   5e-16
SAKL0E08558g Chr5 complement(695313..695990) [678 bp, 225 aa] {O...    75   6e-16
TBLA0B01410 Chr2 complement(304771..306687) [1917 bp, 638 aa] {O...    77   7e-16
Kpol_529.16 s529 complement(43810..44385) [576 bp, 191 aa] {ON} ...    74   7e-16
TPHA0F01280 Chr6 complement(293022..293657) [636 bp, 211 aa] {ON...    74   7e-16
SAKL0H13068g Chr8 complement(1125095..1125670) [576 bp, 191 aa] ...    74   1e-15
Suva_10.324 Chr10 complement(570500..571075) [576 bp, 191 aa] {O...    74   1e-15
Skud_12.297 Chr12 complement(544541..545116) [576 bp, 191 aa] {O...    74   1e-15
KLLA0F03443g Chr6 (324020..324691) [672 bp, 223 aa] {ON} highly ...    74   1e-15
SAKL0F15620g Chr6 (1272848..1273471) [624 bp, 207 aa] {ON} highl...    74   1e-15
TBLA0J00210 Chr10 complement(27395..28039) [645 bp, 214 aa] {ON}...    74   2e-15
CAGL0K08316g Chr11 (839222..840193) [972 bp, 323 aa] {ON} some s...    75   2e-15
KAFR0B06320 Chr2 (1307235..1307810) [576 bp, 191 aa] {ON} Anc_8....    73   2e-15
Suva_16.495 Chr16 (859802..860431) [630 bp, 209 aa] {ON} YPR165W...    73   2e-15
Skud_16.464 Chr16 (818093..818722) [630 bp, 209 aa] {ON} YPR165W...    73   2e-15
Smik_16.424 Chr16 (736628..737257) [630 bp, 209 aa] {ON} YPR165W...    73   2e-15
YPR165W Chr16 (875368..875997) [630 bp, 209 aa] {ON}  RHO1GTP-bi...    73   2e-15
KNAG0K02400 Chr11 complement(482842..483861) [1020 bp, 339 aa] {...    75   3e-15
KAFR0A03120 Chr1 complement(636653..637282) [630 bp, 209 aa] {ON}      73   3e-15
NDAI0C04820 Chr3 (1113624..1114199) [576 bp, 191 aa] {ON} Anc_8....    72   4e-15
KLTH0H13970g Chr8 (1217045..1217623) [579 bp, 192 aa] {ON} simil...    72   5e-15
NCAS0A15070 Chr1 (2971104..2971739) [636 bp, 211 aa] {ON}              72   6e-15
NCAS0A08470 Chr1 complement(1678221..1678847) [627 bp, 208 aa] {...    72   7e-15
SAKL0E12848g Chr5 (1060050..1060835) [786 bp, 261 aa] {ON} simil...    72   8e-15
KNAG0I01930 Chr9 (376663..377622) [960 bp, 319 aa] {ON}                73   9e-15
Kpol_1008.17 s1008 (34952..35581) [630 bp, 209 aa] {ON} (34952.....    71   1e-14
TDEL0F05450 Chr6 (1014759..1015334) [576 bp, 191 aa] {ON} Anc_8....    71   1e-14
Kwal_55.21937 s55 (1047204..1047830) [627 bp, 208 aa] {ON} YPR16...    71   1e-14
Kpol_1013.49 s1013 complement(108782..109414) [633 bp, 210 aa] {...    71   1e-14
CAGL0F05269g Chr6 complement(533759..534334) [576 bp, 191 aa] {O...    70   1e-14
KAFR0B00480 Chr2 complement(98402..99040) [639 bp, 212 aa] {ON} ...    71   2e-14
Kwal_23.3135 s23 complement(172095..172670) [576 bp, 191 aa] {ON...    70   2e-14
KLTH0F07920g Chr6 complement(687410..687985) [576 bp, 191 aa] {O...    70   2e-14
TPHA0I03130 Chr9 (696033..696662) [630 bp, 209 aa] {ON}                71   2e-14
ACR257C Chr3 complement(808667..809446) [780 bp, 259 aa] {ON} Sy...    72   2e-14
TBLA0H03330 Chr8 (817665..818243) [579 bp, 192 aa] {ON} Anc_8.42...    70   2e-14
TPHA0C02190 Chr3 complement(498886..499461) [576 bp, 191 aa] {ON...    70   2e-14
KLLA0B05038g Chr2 complement(457608..458279) [672 bp, 223 aa] {O...    71   2e-14
Kwal_33.14452 s33 complement(679084..679866) [783 bp, 260 aa] {O...    71   2e-14
Kwal_47.16983 s47 complement(197253..197924) [672 bp, 223 aa] {O...    70   2e-14
KLLA0A11330g Chr1 (982552..983124) [573 bp, 190 aa] {ON} similar...    70   3e-14
KLTH0D16236g Chr4 (1344371..1345048) [678 bp, 225 aa] {ON} simil...    70   3e-14
ZYRO0D01474g Chr4 complement(105651..106289) [639 bp, 212 aa] {O...    70   3e-14
TBLA0H00690 Chr8 complement(148963..149622) [660 bp, 219 aa] {ON...    70   3e-14
Skud_3.103 Chr3 complement(150880..151509) [630 bp, 209 aa] {ON}...    70   4e-14
Smik_12.290 Chr12 complement(544884..545459) [576 bp, 191 aa] {O...    69   4e-14
YLR229C Chr12 complement(604212..604787) [576 bp, 191 aa] {ON}  ...    69   4e-14
Smik_3.126 Chr3 complement(166497..167126) [630 bp, 209 aa] {ON}...    70   4e-14
TDEL0H00500 Chr8 complement(74047..74679) [633 bp, 210 aa] {ON} ...    70   4e-14
NDAI0D00180 Chr4 complement(26285..26926) [642 bp, 213 aa] {ON}        70   4e-14
TPHA0B01720 Chr2 complement(384530..385420) [891 bp, 296 aa] {ON...    71   5e-14
ZYRO0A09306g Chr1 (745829..746404) [576 bp, 191 aa] {ON} highly ...    69   5e-14
KAFR0I00390 Chr9 complement(84398..85093) [696 bp, 231 aa] {ON} ...    70   5e-14
NCAS0B02880 Chr2 complement(494164..494739) [576 bp, 191 aa] {ON...    69   5e-14
KLLA0D08327g Chr4 (708240..709004) [765 bp, 254 aa] {ON} similar...    70   6e-14
ZYRO0B14256g Chr2 (1160536..1161219) [684 bp, 227 aa] {ON} simil...    70   6e-14
KNAG0A04510 Chr1 complement(632334..632939) [606 bp, 201 aa] {ON...    69   7e-14
YML064C Chr13 complement(145139..145876) [738 bp, 245 aa] {ON}  ...    70   7e-14
Suva_13.93 Chr13 complement(147850..148587) [738 bp, 245 aa] {ON...    70   8e-14
SAKL0D10780g Chr4 (896563..897222) [660 bp, 219 aa] {ON} similar...    69   8e-14
TBLA0E03870 Chr5 (972894..973580) [687 bp, 228 aa] {ON} Anc_2.24...    69   9e-14
Skud_13.80 Chr13 complement(143292..144029) [738 bp, 245 aa] {ON...    69   9e-14
NCAS0G01910 Chr7 complement(342761..343636) [876 bp, 291 aa] {ON...    70   1e-13
TBLA0F02960 Chr6 (719060..719707) [648 bp, 215 aa] {ON} Anc_7.52...    69   1e-13
Smik_13.80 Chr13 complement(142681..143418) [738 bp, 245 aa] {ON...    69   1e-13
Kwal_23.4875 s23 (904790..905482) [693 bp, 230 aa] {ON} YIL118W ...    69   1e-13
NCAS0A06070 Chr1 (1197908..1198585) [678 bp, 225 aa] {ON} Anc_4....    69   1e-13
NCAS0H00220 Chr8 complement(29761..30399) [639 bp, 212 aa] {ON}        68   1e-13
KNAG0D05300 Chr4 (974092..974730) [639 bp, 212 aa] {ON}                68   2e-13
KLTH0B06996g Chr2 (565363..566142) [780 bp, 259 aa] {ON} weakly ...    69   2e-13
CAGL0I08459g Chr9 (829562..830194) [633 bp, 210 aa] {ON} highly ...    68   2e-13
TDEL0D00920 Chr4 complement(167879..168568) [690 bp, 229 aa] {ON...    68   3e-13
TDEL0C04120 Chr3 complement(725595..726290) [696 bp, 231 aa] {ON...    68   3e-13
Kpol_1013.48 s1013 complement(107294..107959) [666 bp, 221 aa] {...    67   3e-13
YCR027C Chr3 complement(167370..167999) [630 bp, 209 aa] {ON}  R...    67   3e-13
KLTH0G09548g Chr7 (802001..802696) [696 bp, 231 aa] {ON} highly ...    68   3e-13
Ecym_2048 Chr2 (75961..77217) [1257 bp, 418 aa] {ON} similar to ...    69   3e-13
SAKL0G17424g Chr7 (1508263..1508913) [651 bp, 216 aa] {ON} simil...    67   5e-13
KNAG0F01270 Chr6 complement(229391..230398) [1008 bp, 335 aa] {O...    68   5e-13
Kpol_1041.7 s1041 (25272..26135) [864 bp, 287 aa] {ON} (25272..2...    67   6e-13
NDAI0G04930 Chr7 complement(1191671..1192303) [633 bp, 210 aa] {...    66   7e-13
NDAI0J00230 Chr10 (38760..39515) [756 bp, 251 aa] {ON}                 67   8e-13
NCAS0B06460 Chr2 complement(1221860..1222564) [705 bp, 234 aa] {...    66   1e-12
TDEL0H00970 Chr8 complement(158769..159638) [870 bp, 289 aa] {ON...    67   1e-12
TDEL0A01170 Chr1 complement(198136..198957) [822 bp, 273 aa] {ON...    66   2e-12
ABR182W Chr2 (754518..755147) [630 bp, 209 aa] {ON} Rho1a; Synte...    65   2e-12
TPHA0F02330 Chr6 (513129..514112) [984 bp, 327 aa] {ON} Anc_2.75...    67   2e-12
Suva_14.35 Chr14 (56635..57891) [1257 bp, 418 aa] {ON} YNL304W (...    67   2e-12
ZYRO0A01606g Chr1 (133530..134252) [723 bp, 240 aa] {ON} highly ...    65   2e-12
KNAG0E03990 Chr5 (788341..789045) [705 bp, 234 aa] {ON} Anc_4.32...    65   2e-12
KAFR0A08400 Chr1 complement(1686919..1688154) [1236 bp, 411 aa] ...    67   2e-12
AER132W Chr5 (888052..888750) [699 bp, 232 aa] {ON} Syntenic hom...    65   2e-12
Ecym_1155 Chr1 complement(318859..319560) [702 bp, 233 aa] {ON} ...    65   3e-12
KAFR0F00400 Chr6 complement(94002..94754) [753 bp, 250 aa] {ON} ...    65   3e-12
ABL139C Chr2 complement(134873..135757) [885 bp, 294 aa] {ON} Sy...    66   3e-12
TDEL0E00580 Chr5 (126371..127576) [1206 bp, 401 aa] {ON} Anc_3.4...    66   4e-12
NCAS0J02000 Chr10 (384676..385347) [672 bp, 223 aa] {ON} Anc_4.326     64   4e-12
NDAI0D03040 Chr4 (717810..718454) [645 bp, 214 aa] {ON} Anc_4.326      64   4e-12
Skud_14.35 Chr14 (53689..55065) [1377 bp, 458 aa] {ON} YNL304W (...    66   5e-12
Smik_14.27 Chr14 (44732..45976) [1245 bp, 414 aa] {ON} YNL304W (...    66   5e-12
Ecym_7211 Chr7 (442765..443412) [648 bp, 215 aa] {ON} similar to...    64   7e-12
NDAI0B03750 Chr2 complement(940372..941094) [723 bp, 240 aa] {ON...    64   8e-12
YNL304W Chr14 (60297..61550) [1254 bp, 417 aa] {ON}  YPT11Rab fa...    65   9e-12
ADL162W Chr4 (405599..406813) [1215 bp, 404 aa] {ON} Syntenic ho...    65   1e-11
Ecym_6421 Chr6 (820187..821071) [885 bp, 294 aa] {ON} similar to...    64   1e-11
CAGL0M03817g Chr13 complement(431237..432664) [1428 bp, 475 aa] ...    64   3e-11
Kwal_55.21971 s55 complement(1059877..1061142) [1266 bp, 421 aa]...    62   1e-10
NDAI0H03720 Chr8 (909855..910775) [921 bp, 306 aa] {ON} Anc_2.75       61   1e-10
SAKL0C12716g Chr3 complement(1135452..1136720) [1269 bp, 422 aa]...    61   2e-10
KAFR0A07530 Chr1 (1520661..1521554) [894 bp, 297 aa] {ON} Anc_2....    60   2e-10
KLTH0F18810g Chr6 complement(1525047..1526393) [1347 bp, 448 aa]...    60   3e-10
TBLA0D05710 Chr4 (1411089..1412231) [1143 bp, 380 aa] {ON} Anc_1...    60   3e-10
ZYRO0C02618g Chr3 complement(208102..209172) [1071 bp, 356 aa] {...    60   5e-10
NCAS0D00420 Chr4 complement(64888..65739) [852 bp, 283 aa] {ON} ...    59   6e-10
KLLA0C12881g Chr3 (1090895..1092016) [1122 bp, 373 aa] {ON} simi...    59   7e-10
YNL180C Chr14 complement(299654..300649) [996 bp, 331 aa] {ON}  ...    59   1e-09
Skud_14.154 Chr14 complement(290647..291642) [996 bp, 331 aa] {O...    58   1e-09
Smik_14.150 Chr14 complement(278905..279900) [996 bp, 331 aa] {O...    58   2e-09
TBLA0B08610 Chr2 complement(2057209..2059068) [1860 bp, 619 aa] ...    58   3e-09
TPHA0O00870 Chr15 complement(162632..163369) [738 bp, 245 aa] {O...    57   4e-09
TPHA0P01330 Chr16 complement(269708..271318) [1611 bp, 536 aa] {...    57   4e-09
NDAI0A06180 Chr1 complement(1405552..1407303) [1752 bp, 583 aa] ...    57   6e-09
NDAI0F03360 Chr6 (810071..811003) [933 bp, 310 aa] {ON} Anc_2.75       56   6e-09
TPHA0I03140 Chr9 (697331..697990) [660 bp, 219 aa] {ON} Anc_7.521      55   7e-09
Suva_14.161 Chr14 complement(295880..296878) [999 bp, 332 aa] {O...    55   2e-08
CAGL0G05764g Chr7 complement(552809..553681) [873 bp, 290 aa] {O...    54   3e-08
Kpol_1056.30 s1056 complement(68711..69394) [684 bp, 227 aa] {ON...    54   3e-08
NCAS0A10020 Chr1 complement(2005133..2006716) [1584 bp, 527 aa] ...    55   3e-08
Kpol_1076.2 s1076 complement(1580..3259) [1680 bp, 559 aa] {ON} ...    54   4e-08
TDEL0A04760 Chr1 complement(841005..841718) [714 bp, 237 aa] {ON}      53   8e-08
Kwal_47.18241 s47 (748088..748780) [693 bp, 230 aa] {ON} YOR089C...    52   1e-07
KLLA0F17072g Chr6 complement(1566668..1567240) [573 bp, 190 aa] ...    52   1e-07
Kpol_1060.60 s1060 complement(139699..140631) [933 bp, 310 aa] {...    50   6e-07
TBLA0B00790 Chr2 complement(171658..172677) [1020 bp, 339 aa] {O...    50   6e-07
KLTH0G05654g Chr7 complement(450410..451090,451167..451244) [759...    50   9e-07
KLLA0F02662g Chr6 (241804..242565) [762 bp, 253 aa] {ON} conserv...    49   2e-06
TPHA0C01660 Chr3 (384105..384704) [600 bp, 199 aa] {ON} Anc_8.50...    48   2e-06
SAKL0H11066g Chr8 (955148..955741) [594 bp, 197 aa] {ON} highly ...    47   8e-06
KAFR0H01380 Chr8 (258305..258901) [597 bp, 198 aa] {ON} Anc_8.50...    47   9e-06
Kpol_333.2 s333 (2276..2875) [600 bp, 199 aa] {ON} (2276..2875) ...    46   1e-05
NCAS0D01240 Chr4 complement(226870..227421) [552 bp, 183 aa] {ON...    45   2e-05
NDAI0B04050 Chr2 complement(1027616..1028029) [414 bp, 137 aa] {...    45   2e-05
Skud_16.231 Chr16 (424100..424696) [597 bp, 198 aa] {ON} YPL051W...    45   3e-05
Smik_4.98 Chr4 (193129..193674) [546 bp, 181 aa] {ON} YDL137W (R...    45   3e-05
YDL137W Chr4 (216529..217074) [546 bp, 181 aa] {ON}  ARF2ADP-rib...    45   3e-05
Suva_8.147 Chr8 (259965..260516) [552 bp, 183 aa] {ON} YOR094W (...    45   3e-05
Skud_4.66 Chr4 (113702..114247) [546 bp, 181 aa] {ON} YDL192W (R...    44   4e-05
Smik_4.48 Chr4 (94533..95078) [546 bp, 181 aa] {ON} YDL192W (REAL)     44   4e-05
YPL051W Chr16 (459963..460559) [597 bp, 198 aa] {ON}  ARL3GTPase...    45   4e-05
Skud_4.117 Chr4 (212154..212699) [546 bp, 181 aa] {ON} YDL137W (...    44   4e-05
YDL192W Chr4 (116321..116866) [546 bp, 181 aa] {ON}  ARF1ADP-rib...    44   4e-05
Kpol_1019.32 s1019 (66082..66627) [546 bp, 181 aa] {ON} (66082.....    44   4e-05
TPHA0P00900 Chr16 complement(180898..181443) [546 bp, 181 aa] {O...    44   4e-05
KAFR0B01090 Chr2 (206995..207540) [546 bp, 181 aa] {ON} Anc_7.30...    44   4e-05
Suva_4.56 Chr4 (104717..105262) [546 bp, 181 aa] {ON} YDL192W (R...    44   4e-05
TPHA0A03130 Chr1 (688097..688642) [546 bp, 181 aa] {ON} Anc_7.30...    44   4e-05
NDAI0A02910 Chr1 (653631..654176) [546 bp, 181 aa] {ON}                44   4e-05
TBLA0A05900 Chr1 (1456128..1456673) [546 bp, 181 aa] {ON} Anc_7....    44   4e-05
KAFR0L01290 Chr12 complement(239086..239631) [546 bp, 181 aa] {O...    44   4e-05
KNAG0C04000 Chr3 (788971..789546) [576 bp, 191 aa] {ON} Anc_7.30...    44   5e-05
YHR022C Chr8 complement(149575..150345) [771 bp, 256 aa] {ON} Pu...    45   5e-05
NCAS0C02320 Chr3 (436472..437071) [600 bp, 199 aa] {ON} Anc_8.502      44   5e-05
TBLA0A00450 Chr1 complement(83149..83760) [612 bp, 203 aa] {ON} ...    44   5e-05
NDAI0A02160 Chr1 (489919..490575) [657 bp, 218 aa] {ON} Anc_7.307      44   5e-05
Suva_4.107 Chr4 (204848..205393) [546 bp, 181 aa] {ON} YDL137W (...    44   6e-05
TBLA0F02110 Chr6 complement(518429..518974) [546 bp, 181 aa] {ON...    44   6e-05
ZYRO0F05742g Chr6 complement(473659..474204) [546 bp, 181 aa] {O...    44   7e-05
Suva_16.264 Chr16 (463019..463615) [597 bp, 198 aa] {ON} YPL051W...    44   8e-05
TDEL0C02390 Chr3 (420853..421398) [546 bp, 181 aa] {ON} Anc_7.30...    44   8e-05
NCAS0A13870 Chr1 complement(2722379..2722924) [546 bp, 181 aa] {...    43   9e-05
Kwal_27.11872 s27 complement(985259..985852) [594 bp, 197 aa] {O...    44   9e-05
Kpol_2000.16 s2000 complement(29208..29753) [546 bp, 181 aa] {ON...    43   9e-05
TBLA0A06090 Chr1 (1499665..1499689,1499931..1500475) [570 bp, 18...    43   1e-04
NCAS0E03720 Chr5 complement(731259..731804) [546 bp, 181 aa] {ON...    43   1e-04
KNAG0B02830 Chr2 (545859..546404) [546 bp, 181 aa] {ON} Anc_7.30...    43   1e-04
CAGL0J09064g Chr10 (894680..895225) [546 bp, 181 aa] {ON} highly...    43   1e-04
CAGL0I03916g Chr9 (343014..343559) [546 bp, 181 aa] {ON} highly ...    43   1e-04
AEL232C Chr5 complement(196356..197285) [930 bp, 309 aa] {ON} NO...    44   1e-04
AGL261W Chr7 (218211..218807) [597 bp, 198 aa] {ON} Syntenic hom...    43   1e-04
SAKL0G06908g Chr7 complement(568249..569100) [852 bp, 283 aa] {O...    43   2e-04
CAGL0J11242g Chr10 (1094754..1095908) [1155 bp, 384 aa] {ON} sim...    43   2e-04
Kpol_1002.39 s1002 (115751..116317) [567 bp, 188 aa] {ON} (11575...    42   2e-04
TDEL0E05440 Chr5 complement(998317..998861,998933..998957) [570 ...    42   3e-04
Ecym_2552 Chr2 complement(1071072..1071668) [597 bp, 198 aa] {ON...    42   3e-04
KAFR0E01740 Chr5 complement(352927..353958) [1032 bp, 343 aa] {O...    43   3e-04
AFL114W Chr6 (222754..223326) [573 bp, 190 aa] {ON} Syntenic hom...    42   3e-04
KAFR0J01900 Chr10 (369226..369768) [543 bp, 180 aa] {ON} Anc_2.1...    42   3e-04
ZYRO0F08536g Chr6 complement(687627..688223) [597 bp, 198 aa] {O...    42   3e-04
KNAG0D01000 Chr4 (164190..164217,164460..165004) [573 bp, 190 aa...    42   3e-04
Smik_16.185 Chr16 (335352..335948) [597 bp, 198 aa] {ON} YPL051W...    42   3e-04
ZYRO0E07304g Chr5 complement(559169..559713,559791..559815) [570...    42   4e-04
Skud_16.61 Chr16 (112172..112199,112340..112884) [573 bp, 190 aa...    41   6e-04
Suva_16.88 Chr16 (148107..148134,148267..148811) [573 bp, 190 aa...    41   6e-04
Smik_6.423 Chr6 complement(684936..685480,685617..685644) [573 b...    41   6e-04
YPL218W Chr16 (138698..138725,138865..139409) [573 bp, 190 aa] {...    41   6e-04
TPHA0J02510 Chr10 complement(557245..557814) [570 bp, 189 aa] {O...    41   7e-04
NDAI0F01490 Chr6 (367903..367927,368225..368772) [573 bp, 190 aa...    41   7e-04
ZYRO0E02090g Chr5 complement(155560..156105) [546 bp, 181 aa] {O...    40   8e-04
Kwal_56.24462 s56 complement(1005762..1006307) [546 bp, 181 aa] ...    40   9e-04
Skud_15.259 Chr15 (459133..459684) [552 bp, 183 aa] {ON} YOR094W...    40   9e-04
CAGL0L12826g Chr12 complement(1373063..1373662) [600 bp, 199 aa]...    40   9e-04
KLTH0E11660g Chr5 complement(1038583..1039245) [663 bp, 220 aa] ...    40   0.001
SAKL0E10054g Chr5 (843076..843621) [546 bp, 181 aa] {ON} highly ...    40   0.001
KLTH0G07172g Chr7 (578557..579714) [1158 bp, 385 aa] {ON} some s...    41   0.001
KAFR0K00190 Chr11 (47432..47459,47605..48149) [573 bp, 190 aa] {...    40   0.001
Smik_15.274 Chr15 (463883..464434) [552 bp, 183 aa] {ON} YOR094W...    40   0.001
SAKL0A03960g Chr1 (368829..368850,368923..369467) [567 bp, 188 a...    40   0.001
YOR094W Chr15 (502795..503346) [552 bp, 183 aa] {ON}  ARF3Glucos...    40   0.001
CAGL0E05896g Chr5 complement(584585..585129,585415..585439) [570...    40   0.002
NCAS0B06760 Chr2 (1290711..1291256) [546 bp, 181 aa] {ON} Anc_2....    39   0.002
NDAI0E03010 Chr5 (642507..643181) [675 bp, 224 aa] {ON} Anc_8.502      40   0.002
TDEL0B01350 Chr2 (239829..240425) [597 bp, 198 aa] {ON} Anc_8.50...    39   0.002
KLTH0H02200g Chr8 (199831..200376) [546 bp, 181 aa] {ON} highly ...    39   0.003
KNAG0A02140 Chr1 (186453..187052) [600 bp, 199 aa] {ON} Anc_8.50...    39   0.004
TPHA0F01600 Chr6 (371312..371857) [546 bp, 181 aa] {ON} Anc_2.19...    39   0.004
Ecym_2181 Chr2 (354573..355145) [573 bp, 190 aa] {ON} similar to...    39   0.005
KLTH0H03696g Chr8 (335581..335602,335689..336233) [567 bp, 188 a...    38   0.006
KLLA0C13563g Chr3 complement(1157278..1157826) [549 bp, 182 aa] ...    38   0.006
ZYRO0A05500g Chr1 complement(448060..448785) [726 bp, 241 aa] {O...    38   0.007
Kwal_23.2944 s23 complement(84192..84746) [555 bp, 184 aa] {ON} ...    38   0.008
YAL048C Chr1 complement(52801..54789) [1989 bp, 662 aa] {ON}  GE...    39   0.009
TPHA0B03060 Chr2 complement(695421..696458) [1038 bp, 345 aa] {O...    38   0.009
Skud_1.12 Chr1 complement(28719..30704) [1986 bp, 661 aa] {ON} Y...    38   0.010
CAGL0E06292g Chr5 (633372..634598) [1227 bp, 408 aa] {ON} some s...    38   0.012
Kpol_1020.46 s1020 (107506..108051) [546 bp, 181 aa] {ON} (10750...    37   0.012
Suva_1.16 Chr1 complement(29877..31853) [1977 bp, 658 aa] {ON} Y...    38   0.012
Ecym_5356 Chr5 complement(720805..721350) [546 bp, 181 aa] {ON} ...    37   0.014
TBLA0B01480 Chr2 complement(320668..321213) [546 bp, 181 aa] {ON...    37   0.014
Kwal_56.24453 s56 complement(1004296..1004841) [546 bp, 181 aa] ...    37   0.015
TPHA0H02990 Chr8 (715815..717776) [1962 bp, 653 aa] {ON} Anc_7.1...    38   0.015
KAFR0B05110 Chr2 complement(1051041..1051583) [543 bp, 180 aa] {...    37   0.015
KLTH0H02222g Chr8 (201281..201826) [546 bp, 181 aa] {ON} highly ...    37   0.016
SAKL0F10296g Chr6 complement(791446..791991) [546 bp, 181 aa] {O...    37   0.017
Smik_1.15 Chr1 complement(35773..37758) [1986 bp, 661 aa] {ON} Y...    37   0.018
KLTH0G08074g Chr7 complement(651983..652537) [555 bp, 184 aa] {O...    37   0.019
NDAI0B04110 Chr2 (1042191..1042736) [546 bp, 181 aa] {ON} Anc_6....    37   0.020
KLLA0E24773g Chr5 (2194554..2195105) [552 bp, 183 aa] {ON} highl...    37   0.020
Ecym_8057 Chr8 complement(123686..124231) [546 bp, 181 aa] {ON} ...    37   0.021
ADR094W Chr4 (878121..878666) [546 bp, 181 aa] {ON} Syntenic hom...    37   0.021
ACL078W Chr3 (212664..213209) [546 bp, 181 aa] {ON} Syntenic hom...    36   0.021
TDEL0F01430 Chr6 complement(253231..253776) [546 bp, 181 aa] {ON...    36   0.023
KNAG0H03300 Chr8 (620438..620983) [546 bp, 181 aa] {ON} Anc_2.19...    36   0.027
KLLA0B02046g Chr2 (178646..179218) [573 bp, 190 aa] {ON} highly ...    36   0.033
Suva_4.416 Chr4 complement(737342..737893) [552 bp, 183 aa] {ON}...    36   0.035
SAKL0F10318g Chr6 complement(793294..793782) [489 bp, 162 aa] {O...    35   0.036
SAKL0H08624g Chr8 complement(744555..745106) [552 bp, 183 aa] {O...    36   0.036
TDEL0G03240 Chr7 complement(603053..603583) [531 bp, 176 aa] {ON...    36   0.037
KLLA0F05225g Chr6 (515391..515936) [546 bp, 181 aa] {ON} highly ...    36   0.039
Skud_2.292 Chr2 complement(535291..535842) [552 bp, 183 aa] {ON}...    35   0.040
Ecym_7092 Chr7 (177595..178146) [552 bp, 183 aa] {ON} similar to...    35   0.042
KNAG0A01690 Chr1 complement(99320..99871) [552 bp, 183 aa] {ON} ...    35   0.042
TPHA0A01165 Chr1 complement(228734..229285) [552 bp, 183 aa] {ON}      35   0.043
Smik_2.305 Chr2 complement(554080..554631) [552 bp, 183 aa] {ON}...    35   0.046
YBR164C Chr2 complement(567875..568426) [552 bp, 183 aa] {ON}  A...    35   0.046
ZYRO0A10340g Chr1 complement(841263..841814) [552 bp, 183 aa] {O...    35   0.052
KAFR0E00655 Chr5 complement(145183..145734) [552 bp, 183 aa] {ON}      35   0.056
Suva_16.203 Chr16 complement(356955..357512) [558 bp, 185 aa] {O...    35   0.057
KLLA0A03465g Chr1 complement(314573..316552) [1980 bp, 659 aa] {...    36   0.060
CAGL0I10835g Chr9 (1071206..1071757) [552 bp, 183 aa] {ON} highl...    35   0.068
NDAI0E02560 Chr5 complement(533331..533882) [552 bp, 183 aa] {ON...    35   0.068
Skud_13.177 Chr13 complement(306114..307697) [1584 bp, 527 aa] {...    35   0.068
CAGL0M12144g Chr13 (1212803..1215718) [2916 bp, 971 aa] {ON} hig...    35   0.076
NCAS0C01840 Chr3 complement(342241..342792) [552 bp, 183 aa] {ON...    35   0.079
TDEL0E03600 Chr5 (677077..677943) [867 bp, 288 aa] {ON} Anc_5.26...    35   0.089
AGR221W Chr7 (1164825..1165376) [552 bp, 183 aa] {ON} Syntenic h...    34   0.10 
TDEL0A05420 Chr1 (950041..950592) [552 bp, 183 aa] {ON} Anc_8.59...    34   0.11 
TBLA0B09230 Chr2 complement(2184288..2184752) [465 bp, 154 aa] {...    34   0.12 
TBLA0E04020 Chr5 (1011363..1011914) [552 bp, 183 aa] {ON} Anc_8....    34   0.12 
KAFR0I00240 Chr9 complement(51330..53309) [1980 bp, 659 aa] {ON}...    35   0.15 
KLTH0E13838g Chr5 (1219497..1220048) [552 bp, 183 aa] {ON} highl...    34   0.16 
Smik_13.187 Chr13 complement(311260..312843) [1584 bp, 527 aa] {...    34   0.22 
KAFR0A02180 Chr1 complement(455809..457344) [1536 bp, 511 aa] {O...    33   0.29 
SAKL0G11154g Chr7 (951384..952457) [1074 bp, 357 aa] {ON} weakly...    33   0.35 
KLTH0D00880g Chr4 complement(84021..86015) [1995 bp, 664 aa] {ON...    33   0.38 
KNAG0F02740 Chr6 (519000..519956) [957 bp, 318 aa] {ON} Anc_5.26...    33   0.41 
NDAI0D01840 Chr4 (432480..433610) [1131 bp, 376 aa] {ON} Anc_5.2...    33   0.47 
SAKL0D14498g Chr4 (1190537..1190579,1190642..1192623) [2025 bp, ...    33   0.47 
Ecym_5018 Chr5 complement(39804..41783) [1980 bp, 659 aa] {ON} s...    33   0.48 
ZYRO0E06446g Chr5 complement(488300..489820) [1521 bp, 506 aa] {...    33   0.53 
YMR023C Chr13 complement(319437..321017) [1581 bp, 526 aa] {ON} ...    33   0.53 
Kpol_1049.6 s1049 (13314..15272) [1959 bp, 652 aa] {ON} (13314.....    33   0.57 
TBLA0A10480 Chr1 (2580976..2582211) [1236 bp, 411 aa] {ON} Anc_5...    32   0.69 
Kwal_26.6810 s26 complement(74581..76575) [1995 bp, 664 aa] {ON}...    33   0.70 
NCAS0A07490 Chr1 complement(1488151..1490121) [1971 bp, 656 aa] ...    32   0.75 
CAGL0M12276g Chr13 (1225135..1227084) [1950 bp, 649 aa] {ON} hig...    32   1.4  
TBLA0A01350 Chr1 (320382..321452) [1071 bp, 356 aa] {ON} Anc_1.4...    31   1.6  
TDEL0H04320 Chr8 (743371..745332) [1962 bp, 653 aa] {ON} Anc_7.1...    32   1.6  
TBLA0I01600 Chr9 complement(348934..351318) [2385 bp, 794 aa] {O...    32   1.7  
TBLA0A04400 Chr1 complement(1082864..1084813) [1950 bp, 649 aa] ...    31   1.8  
YMR138W Chr13 (545155..545730) [576 bp, 191 aa] {ON}  CIN4GTP-bi...    31   1.8  
KLTH0D08074g Chr4 complement(684208..685701) [1494 bp, 497 aa] {...    31   1.9  
CAGL0E03564g Chr5 complement(329297..330934) [1638 bp, 545 aa] {...    31   2.1  
KNAG0D00560 Chr4 (78466..81108) [2643 bp, 880 aa] {ON} Anc_6.306...    31   2.3  
KLLA0E12805g Chr5 (1135181..1135780) [600 bp, 199 aa] {ON} simil...    30   2.3  
NDAI0H01980 Chr8 (479594..481675) [2082 bp, 693 aa] {ON} Anc_7.1...    31   2.5  
Ecym_8058 Chr8 complement(125461..126084) [624 bp, 207 aa] {ON} ...    30   3.0  
Skud_8.77 Chr8 complement(130068..130850) [783 bp, 261 aa] {ON} ...    30   3.1  
Skud_11.323 Chr11 (581375..584587) [3213 bp, 1070 aa] {ON} YKR08...    30   3.3  
Suva_13.190 Chr13 complement(310063..311646) [1584 bp, 527 aa] {...    30   3.4  
ADR402W Chr4 (1426897..1428882) [1986 bp, 661 aa] {ON} Syntenic ...    30   3.4  
SAKL0E04906g Chr5 (398680..399306) [627 bp, 208 aa] {ON} similar...    29   5.7  
NCAS0A07600 Chr1 (1510813..1512783) [1971 bp, 656 aa] {ON}             30   5.8  
ZYRO0C00770g Chr3 complement(58234..60192) [1959 bp, 652 aa] {ON...    30   6.3  
KNAG0E04140 Chr5 (820949..822970) [2022 bp, 673 aa] {ON} Anc_7.1...    30   6.5  
AEL034W Chr5 (568246..570261) [2016 bp, 671 aa] {ON} Syntenic ho...    29   8.2  
KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} simila...    29   9.2  

>KNAG0M01220 Chr13 (222591..223214) [624 bp, 207 aa] {ON} Anc_6.24
           YML001W
          Length = 207

 Score =  398 bits (1022), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 194/207 (93%), Positives = 194/207 (93%)

Query: 1   MSFRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQ 60
           MSFRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQ
Sbjct: 1   MSFRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQ 60

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPF 120
           VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPF
Sbjct: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPF 120

Query: 121 VILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQNQ 180
           VILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQNQ
Sbjct: 121 VILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQNQ 180

Query: 181 XXXXXXXXXXXXXINIQLDGEPNSCSC 207
                        INIQLDGEPNSCSC
Sbjct: 181 NDADAFEEDFNDAINIQLDGEPNSCSC 207

>ZYRO0C07700g Chr3 complement(584547..585170) [624 bp, 207 aa] {ON}
           highly similar to uniprot|P32939 Saccharomyces
           cerevisiae YML001W YPT7 Gtp-binding protein of the rab
           family required for homotypic fusion event in vacuole
           inheritance for endosome-endosome fusion and for fusion
           of endosomes to vacuoles when expressed from high copy
           plasmid GTP-binding protein rab family
          Length = 207

 Score =  371 bits (953), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 180/207 (86%), Positives = 188/207 (90%)

Query: 1   MSFRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQ 60
           MS RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQ
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQ 60

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPF 120
           VWDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSFENIK+W+DEFLVHANV SPETFPF
Sbjct: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVLSPETFPF 120

Query: 121 VILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQNQ 180
           VILGNKVDVEESKK V+ K+AQELA SLGN+PLFLTSAK+AINVDTAFEEIARSALQQNQ
Sbjct: 121 VILGNKVDVEESKKTVSVKSAQELAKSLGNVPLFLTSAKNAINVDTAFEEIARSALQQNQ 180

Query: 181 XXXXXXXXXXXXXINIQLDGEPNSCSC 207
                        INIQLDGEP++CSC
Sbjct: 181 ADADAFEEDFNDAINIQLDGEPSACSC 207

>Kpol_1037.28 s1037 (68071..68697) [627 bp, 208 aa] {ON}
           (68071..68697) [627 nt, 209 aa]
          Length = 208

 Score =  364 bits (934), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 175/208 (84%), Positives = 188/208 (90%), Gaps = 1/208 (0%)

Query: 1   MSFRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDD-KVATM 59
           MS RKKNILKVI+LGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDD K ATM
Sbjct: 1   MSSRKKNILKVIVLGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDDKAATM 60

Query: 60  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFP 119
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTN+KSFENIK+W+DEFL+HANVSSPETFP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNSKSFENIKSWRDEFLIHANVSSPETFP 120

Query: 120 FVILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQN 179
           FVILGNK+DVE+SKK+VT K+AQELA  LG++PLFLTSAK+AINVD AFEEIARSALQQN
Sbjct: 121 FVILGNKIDVEDSKKIVTQKSAQELAKELGDVPLFLTSAKNAINVDQAFEEIARSALQQN 180

Query: 180 QXXXXXXXXXXXXXINIQLDGEPNSCSC 207
           Q             INIQLDGEP+SCSC
Sbjct: 181 QADADAFEDDFNDAINIQLDGEPSSCSC 208

>Smik_13.158 Chr13 (258333..258959) [627 bp, 208 aa] {ON} YML001W
           (REAL)
          Length = 208

 Score =  364 bits (934), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 178/208 (85%), Positives = 187/208 (89%), Gaps = 1/208 (0%)

Query: 1   MSFRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD-DKVATM 59
           MS RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD DKVATM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATM 60

Query: 60  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFP 119
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTN  SFENIK+W+DEFLVHANVSSPETFP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVSSPETFP 120

Query: 120 FVILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQN 179
           FVILGNK+D EESKK+V+ K+AQELA SLG+IPLFLTSAK+AINVDTAFEEIARSALQQN
Sbjct: 121 FVILGNKIDAEESKKVVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQN 180

Query: 180 QXXXXXXXXXXXXXINIQLDGEPNSCSC 207
           Q             INI+LDGE NSCSC
Sbjct: 181 QADTEAFEDDYNDAINIRLDGENNSCSC 208

>Ecym_3028 Chr3 (54759..55385) [627 bp, 208 aa] {ON} similar to
           Ashbya gossypii ACR003C
          Length = 208

 Score =  363 bits (932), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 177/208 (85%), Positives = 187/208 (89%), Gaps = 1/208 (0%)

Query: 1   MSFRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD-DKVATM 59
           MS RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD DKVATM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATM 60

Query: 60  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFP 119
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTN+KSFENIK W+DEFLVHANV SPETFP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNSKSFENIKAWRDEFLVHANVPSPETFP 120

Query: 120 FVILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQN 179
           FVILGNK+DVEESKK+VT +++QELA SLGNIP FLTSAK+AINVD AFEEIARSALQQ+
Sbjct: 121 FVILGNKIDVEESKKVVTTRSSQELAKSLGNIPFFLTSAKNAINVDDAFEEIARSALQQS 180

Query: 180 QXXXXXXXXXXXXXINIQLDGEPNSCSC 207
           Q             INIQLDGEP+SCSC
Sbjct: 181 QADADAYEDDFNDAINIQLDGEPSSCSC 208

>YML001W Chr13 (267174..267800) [627 bp, 208 aa] {ON}  YPT7Rab
           family GTPase; GTP-binding protein of the rab family;
           required for homotypic fusion event in vacuole
           inheritance, for endosome-endosome fusion, similar to
           mammalian Rab7
          Length = 208

 Score =  363 bits (931), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 177/208 (85%), Positives = 187/208 (89%), Gaps = 1/208 (0%)

Query: 1   MSFRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD-DKVATM 59
           MS RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD DKVATM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATM 60

Query: 60  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFP 119
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTN  SFENIK+W+DEFLVHANV+SPETFP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFP 120

Query: 120 FVILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQN 179
           FVILGNK+D EESKK+V+ K+AQELA SLG+IPLFLTSAK+AINVDTAFEEIARSALQQN
Sbjct: 121 FVILGNKIDAEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQN 180

Query: 180 QXXXXXXXXXXXXXINIQLDGEPNSCSC 207
           Q             INI+LDGE NSCSC
Sbjct: 181 QADTEAFEDDYNDAINIRLDGENNSCSC 208

>Suva_13.161 Chr13 (257150..257776) [627 bp, 208 aa] {ON} YML001W
           (REAL)
          Length = 208

 Score =  362 bits (930), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 177/208 (85%), Positives = 187/208 (89%), Gaps = 1/208 (0%)

Query: 1   MSFRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD-DKVATM 59
           MS RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD DKVATM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATM 60

Query: 60  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFP 119
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTN  SFENIK+W+DEFLVHANV+SPETFP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFP 120

Query: 120 FVILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQN 179
           FVILGNK+D EESKK+V+ K+AQELA SLG+IPLFLTSAK+AINVDTAFEEIARSALQQN
Sbjct: 121 FVILGNKIDAEESKKVVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQN 180

Query: 180 QXXXXXXXXXXXXXINIQLDGEPNSCSC 207
           Q             INI+LDGE NSCSC
Sbjct: 181 QADTEAFEDDYNDAINIRLDGENNSCSC 208

>Skud_13.153 Chr13 (253075..253701) [627 bp, 208 aa] {ON} YML001W
           (REAL)
          Length = 208

 Score =  362 bits (930), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 177/208 (85%), Positives = 187/208 (89%), Gaps = 1/208 (0%)

Query: 1   MSFRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD-DKVATM 59
           MS RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD DKVATM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATM 60

Query: 60  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFP 119
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTN  SFENIK+W+DEFLVHANV+SPETFP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFP 120

Query: 120 FVILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQN 179
           FVILGNK+D EESKK+V+ K+AQELA SLG+IPLFLTSAK+AINVDTAFEEIARSALQQN
Sbjct: 121 FVILGNKIDAEESKKVVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQN 180

Query: 180 QXXXXXXXXXXXXXINIQLDGEPNSCSC 207
           Q             INI+LDGE NSCSC
Sbjct: 181 QADTEAFEDDYNDAINIRLDGENNSCSC 208

>TDEL0G04450 Chr7 complement(808210..808836) [627 bp, 208 aa] {ON}
           Anc_6.24 YML001W
          Length = 208

 Score =  362 bits (929), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 176/208 (84%), Positives = 186/208 (89%), Gaps = 1/208 (0%)

Query: 1   MSFRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDD-KVATM 59
           MS RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV +DD KVATM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVATM 60

Query: 60  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFP 119
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSFENIK+W+DEFLVHANVSSPETFP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNVKSFENIKSWRDEFLVHANVSSPETFP 120

Query: 120 FVILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQN 179
           FVILGNK+DVEESKK+V  K+AQ+LA SLGN+PLF TSAK+AINVDTAFEEI RSALQQN
Sbjct: 121 FVILGNKIDVEESKKVVNTKSAQDLAKSLGNVPLFFTSAKNAINVDTAFEEIGRSALQQN 180

Query: 180 QXXXXXXXXXXXXXINIQLDGEPNSCSC 207
           Q             INIQLDGEP+SCSC
Sbjct: 181 QADADAFEEDFNDAINIQLDGEPSSCSC 208

>SAKL0E01386g Chr5 (105246..105872) [627 bp, 208 aa] {ON} highly
           similar to uniprot|P32939 Saccharomyces cerevisiae
           YML001W YPT7 Gtp-binding protein of the rab family
           required for homotypic fusion event in vacuole
           inheritance for endosome-endosome fusion and for fusion
           of endosomes to vacuoles when expressed from high copy
           plasmid GTP-binding protein rab family
          Length = 208

 Score =  362 bits (929), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 175/208 (84%), Positives = 188/208 (90%), Gaps = 1/208 (0%)

Query: 1   MSFRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD-DKVATM 59
           MS RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD DKVATM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDEDKVATM 60

Query: 60  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFP 119
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSFENIK+W+DEFLVHANVSSPE+FP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPESFP 120

Query: 120 FVILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQN 179
           FVILGNK+DVEESKK+V  ++AQELA SLGN+PLFLTSAK +INV+TAFEEIARSALQQ+
Sbjct: 121 FVILGNKIDVEESKKVVNTRSAQELAKSLGNVPLFLTSAKGSINVETAFEEIARSALQQS 180

Query: 180 QXXXXXXXXXXXXXINIQLDGEPNSCSC 207
           Q             INIQLDGEP+SC+C
Sbjct: 181 QADADAFEDDFNDAINIQLDGEPSSCNC 208

>NCAS0H00850 Chr8 (155266..155892) [627 bp, 208 aa] {ON} Anc_6.24
          Length = 208

 Score =  361 bits (926), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 174/208 (83%), Positives = 185/208 (88%), Gaps = 1/208 (0%)

Query: 1   MSFRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDD-KVATM 59
           MS RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVT+DD KVATM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATM 60

Query: 60  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFP 119
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSFENIK+W+DEFLVHANVSSPETFP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120

Query: 120 FVILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQN 179
           FVILGNKVD++E+KK+V+  AAQELA SLGN PLF+TSAK +IN+D AFEEIARSALQQN
Sbjct: 121 FVILGNKVDIDETKKVVSANAAQELAKSLGNTPLFMTSAKDSINIDNAFEEIARSALQQN 180

Query: 180 QXXXXXXXXXXXXXINIQLDGEPNSCSC 207
           Q             INIQLD EPNSCSC
Sbjct: 181 QSDADAFDDDFNDAINIQLDDEPNSCSC 208

>KLTH0C11132g Chr3 complement(915337..915963) [627 bp, 208 aa] {ON}
           highly similar to uniprot|P32939 Saccharomyces
           cerevisiae YML001W YPT7 Gtp-binding protein of the rab
           family required for homotypic fusion event in vacuole
           inheritance for endosome-endosome fusion and for fusion
           of endosomes to vacuoles when expressed from high copy
           plasmid GTP-binding protein rab family
          Length = 208

 Score =  360 bits (923), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 174/208 (83%), Positives = 189/208 (90%), Gaps = 1/208 (0%)

Query: 1   MSFRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD-DKVATM 59
           MS RKKNILKVIILGDSGVGKTSLMHRYVNDK+SQQYKATIGADFLTKEVT+D DKVATM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKFSQQYKATIGADFLTKEVTMDGDKVATM 60

Query: 60  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFP 119
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSFENIK+W+DEFLVHANVSSPETFP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120

Query: 120 FVILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQN 179
           FVILGNK+DVEESKK+V+ ++AQ++A SLGNIPLFLTSAK +INVDTAFEEIAR+ALQQ+
Sbjct: 121 FVILGNKLDVEESKKVVSNRSAQDMAKSLGNIPLFLTSAKGSINVDTAFEEIARNALQQS 180

Query: 180 QXXXXXXXXXXXXXINIQLDGEPNSCSC 207
           Q             INIQLDGEP+SCSC
Sbjct: 181 QADADAFEDDFNDAINIQLDGEPSSCSC 208

>ACR003C Chr3 complement(359762..360388) [627 bp, 208 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML001W
           (YPT7)
          Length = 208

 Score =  358 bits (919), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 174/208 (83%), Positives = 186/208 (89%), Gaps = 1/208 (0%)

Query: 1   MSFRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD-DKVATM 59
           MS RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD DKVATM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATM 60

Query: 60  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFP 119
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSFEN+K+W+DEFLVHANV SPE+FP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENVKSWRDEFLVHANVPSPESFP 120

Query: 120 FVILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQN 179
           FVILGNK+DVEESKK+VT + +QELA SLGNIP FLTSAK+AINVD AFEEIARSALQQ+
Sbjct: 121 FVILGNKIDVEESKKVVTTRTSQELAKSLGNIPFFLTSAKNAINVDDAFEEIARSALQQS 180

Query: 180 QXXXXXXXXXXXXXINIQLDGEPNSCSC 207
           Q             INIQLDGEP+SC+C
Sbjct: 181 QADAGAYEDDFNDAINIQLDGEPSSCNC 208

>Kwal_56.22440 s56 (130574..131200) [627 bp, 208 aa] {ON} YML001W
           (YPT7) - GTP-binding protein, rab family [contig 185]
           FULL
          Length = 208

 Score =  357 bits (915), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 172/208 (82%), Positives = 189/208 (90%), Gaps = 1/208 (0%)

Query: 1   MSFRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD-DKVATM 59
           MS RKKNILKVIILGDSGVGKTSLMHRYV+DK+SQQYKATIGADFLTKEV++D DKVATM
Sbjct: 1   MSARKKNILKVIILGDSGVGKTSLMHRYVSDKFSQQYKATIGADFLTKEVSMDGDKVATM 60

Query: 60  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFP 119
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSFENIK+W+DEFLVHANVSSPETFP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFP 120

Query: 120 FVILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQN 179
           FVILGNK+DVEESKK+V+ ++AQ++A SLGNIPLFLTSAK +INVDTAFEEIAR+ALQQ+
Sbjct: 121 FVILGNKLDVEESKKVVSNRSAQDMAKSLGNIPLFLTSAKGSINVDTAFEEIARNALQQS 180

Query: 180 QXXXXXXXXXXXXXINIQLDGEPNSCSC 207
           Q             INIQLDGEP+SCSC
Sbjct: 181 QADADAFEDDFNDAINIQLDGEPSSCSC 208

>CAGL0E02607g Chr5 complement(248998..249624) [627 bp, 208 aa] {ON}
           highly similar to uniprot|P32939 Saccharomyces
           cerevisiae YML001w YPT7 GTP-binding protein of the RAB
           family
          Length = 208

 Score =  356 bits (914), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 185/208 (88%), Gaps = 1/208 (0%)

Query: 1   MSFRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDD-KVATM 59
           M  RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV +DD KV TM
Sbjct: 1   MIARKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTM 60

Query: 60  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFP 119
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSFENIK+WKDEFLVHAN+SSPE+FP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFP 120

Query: 120 FVILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQN 179
           FVILGNKVD+E+SKK+V+ KA QELA SLG++PLFLTSAKSAINVDTAFEEIA+SALQQN
Sbjct: 121 FVILGNKVDIEDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQN 180

Query: 180 QXXXXXXXXXXXXXINIQLDGEPNSCSC 207
           Q             INIQL+GE NSCSC
Sbjct: 181 QNDAHAFEDDFNDAINIQLEGESNSCSC 208

>NDAI0D00840 Chr4 (189925..190551) [627 bp, 208 aa] {ON} Anc_6.24
          Length = 208

 Score =  355 bits (911), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 185/208 (88%), Gaps = 1/208 (0%)

Query: 1   MSFRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDD-KVATM 59
           MS RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVT+DD K+ATM
Sbjct: 1   MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKIATM 60

Query: 60  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFP 119
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSFENIK+W+DEFL+HAN+S+PETFP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLIHANISTPETFP 120

Query: 120 FVILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQN 179
           FVILGNK+DVEESKK+V+  +A ELA SLG+IPLF TSAK +IN++ AFEEIARSALQQN
Sbjct: 121 FVILGNKIDVEESKKIVSSNSATELAKSLGDIPLFFTSAKDSINIENAFEEIARSALQQN 180

Query: 180 QXXXXXXXXXXXXXINIQLDGEPNSCSC 207
           Q             INI+LDGEPNSCSC
Sbjct: 181 QNDVDAFDEDFNDAINIRLDGEPNSCSC 208

>KAFR0G02670 Chr7 complement(552130..552756) [627 bp, 208 aa] {ON}
           Anc_6.24 YML001W
          Length = 208

 Score =  352 bits (902), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 168/208 (80%), Positives = 185/208 (88%), Gaps = 1/208 (0%)

Query: 1   MSFRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD-DKVATM 59
           MS +KK ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKE+ VD D+ ATM
Sbjct: 1   MSSKKKTILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEINVDGDRTATM 60

Query: 60  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFP 119
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSFENIK+W+DEFLVHANVSSPE+FP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNTKSFENIKSWRDEFLVHANVSSPESFP 120

Query: 120 FVILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQN 179
           FVILGNK+D+EE+KK+++ K+AQ+LA SLGNIPLFLTSAKS+INVD AFEEIARSALQQN
Sbjct: 121 FVILGNKIDIEETKKVISVKSAQDLAKSLGNIPLFLTSAKSSINVDPAFEEIARSALQQN 180

Query: 180 QXXXXXXXXXXXXXINIQLDGEPNSCSC 207
           Q             INIQLDGE +SC+C
Sbjct: 181 QNDADAFEEDFNDAINIQLDGEADSCAC 208

>KLLA0D01265g Chr4 (110784..111407) [624 bp, 207 aa] {ON} highly
           similar to uniprot|P32939 Saccharomyces cerevisiae
           YML001W YPT7 Gtp-binding protein of the rab family
           required for homotypic fusion event in vacuole
           inheritance for endosome-endosome fusion and for fusion
           of endosomes to vacuoles when expressed from high copy
           plasmid GTP-binding protein rab family
          Length = 207

 Score =  349 bits (895), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 168/205 (81%), Positives = 181/205 (88%), Gaps = 1/205 (0%)

Query: 4   RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV-DDKVATMQVW 62
           RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV V DDKVATMQVW
Sbjct: 3   RKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQVW 62

Query: 63  DTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVI 122
           DTAGQERFQSLGVAFYRGADCCVLVYDVTN KSF+N+K+W+DEFLVHANVSSPETFPFVI
Sbjct: 63  DTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVI 122

Query: 123 LGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQNQXX 182
           L NKVDVEESKK+V+ ++AQE A SLGN+PLF TSAK +INV  AFEEIARSALQQ+Q  
Sbjct: 123 LANKVDVEESKKVVSSRSAQEQAKSLGNVPLFFTSAKDSINVQDAFEEIARSALQQSQSD 182

Query: 183 XXXXXXXXXXXINIQLDGEPNSCSC 207
                      INIQLDGEP+SC+C
Sbjct: 183 ADAYEDDLSEAINIQLDGEPSSCNC 207

>TBLA0A07180 Chr1 complement(1787774..1788400) [627 bp, 208 aa] {ON}
           Anc_6.24 YML001W
          Length = 208

 Score =  347 bits (889), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 168/208 (80%), Positives = 182/208 (87%), Gaps = 1/208 (0%)

Query: 1   MSFRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD-DKVATM 59
           MS RKK ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV +D D  ATM
Sbjct: 1   MSTRKKQILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVAIDNDTTATM 60

Query: 60  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFP 119
           QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSFENIK+W+DEFL+HANVSSPETFP
Sbjct: 61  QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNPKSFENIKSWRDEFLIHANVSSPETFP 120

Query: 120 FVILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQN 179
           FVILGNKVD ++SKK VT KAAQEL+ SLGNIPLF TSAK++INVD+AFEEIAR AL+QN
Sbjct: 121 FVILGNKVDTKDSKKSVTLKAAQELSKSLGNIPLFQTSAKNSINVDSAFEEIARGALEQN 180

Query: 180 QXXXXXXXXXXXXXINIQLDGEPNSCSC 207
           +             INIQLDGEP+SC+C
Sbjct: 181 KADADAYEDDFNDAINIQLDGEPSSCAC 208

>TPHA0J00360 Chr10 (80553..81182) [630 bp, 209 aa] {ON} Anc_6.24
           YML001W
          Length = 209

 Score =  338 bits (866), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 160/209 (76%), Positives = 178/209 (85%), Gaps = 2/209 (0%)

Query: 1   MSFRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDD--KVAT 58
           MS RKKN+LKVI+LGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV +DD  + AT
Sbjct: 1   MSSRKKNLLKVIVLGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVIDDGSQAAT 60

Query: 59  MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETF 118
           MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTN KSF+NIK+W+DEFL+HANVSSPETF
Sbjct: 61  MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNPKSFDNIKSWRDEFLIHANVSSPETF 120

Query: 119 PFVILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQ 178
           PFVILGNK+D+E+SK+ ++ K  QE+A  LGNIPLFLTSAK +INVD AFEEI R ALQQ
Sbjct: 121 PFVILGNKIDIEDSKQKISAKQGQEMAKELGNIPLFLTSAKDSINVDVAFEEITRGALQQ 180

Query: 179 NQXXXXXXXXXXXXXINIQLDGEPNSCSC 207
           NQ             INIQLD E +SC+C
Sbjct: 181 NQNDADAFKDDFNDAINIQLDDESSSCAC 209

>ABR220W Chr2 (817292..817906) [615 bp, 204 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL038C (YPT1)
          Length = 204

 Score =  141 bits (356), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 112/166 (67%), Gaps = 6/166 (3%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++GDSGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D K   +Q+WDTAGQ
Sbjct: 8   LFKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQ 67

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ERF+++  ++YRGA   ++VYDVT+ +SF+N+KTW  E   +      +    +++GNK 
Sbjct: 68  ERFRTITSSYYRGAHGIIIVYDVTDQESFDNMKTWLQEIDRYGTAGVVK----LLVGNKN 123

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           D+++ KK+V  + A+E A SL NIP+  TSA  + NV+ AF  +AR
Sbjct: 124 DLKD-KKVVDFEVAREFADSL-NIPVLETSALDSSNVEEAFLTMAR 167

>Ecym_1518 Chr1 (1069582..1070196) [615 bp, 204 aa] {ON} similar to
           Ashbya gossypii ABR220W
          Length = 204

 Score =  139 bits (349), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 71/166 (42%), Positives = 111/166 (66%), Gaps = 6/166 (3%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++GDSGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D K   +Q+WDTAGQ
Sbjct: 8   LFKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQ 67

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ERF+++  ++YRGA   ++VYDVT+ +SF N+KTW  E   +      +    +++GNK 
Sbjct: 68  ERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKTWLQEIDRYGTAGVVK----LLVGNKN 123

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           D+++ KK+V  + A+E A SL +IP+  TSA  + NV+ AF  +AR
Sbjct: 124 DLKD-KKVVDFEVAKEFADSL-SIPVLETSALDSSNVEEAFLTMAR 167

>SAKL0B01012g Chr2 complement(92466..93080) [615 bp, 204 aa] {ON}
           highly similar to uniprot|P01123 Saccharomyces
           cerevisiae YFL038C YPT1 Ras-like small GTPase involved
           in the ER-to-Golgi step of the secretory pathway complex
           formation with the Rab escort protein Mrs6p is required
           for prenylation of Ypt1p by protein
           geranylgeranyltransferase type II (Bet2p-Bet4p)
          Length = 204

 Score =  138 bits (347), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 71/166 (42%), Positives = 109/166 (65%), Gaps = 6/166 (3%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++GDSGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D K   +Q+WDTAGQ
Sbjct: 8   LFKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVDLDGKTVKLQIWDTAGQ 67

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ERF+++  ++YRGA   ++VYDVT+ +SF N+KTW  E   +      +    +++GNK 
Sbjct: 68  ERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKTWLQEIDRYGTAGVLK----LLVGNKN 123

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           D+ + KK+V  + A+E A SL  IP+  TSA  + NV+ AF  +AR
Sbjct: 124 DLTD-KKVVEYEVAKEFADSL-QIPVLETSALDSSNVEEAFLTMAR 167

>KNAG0D02650 Chr4 (474662..475297) [636 bp, 211 aa] {ON} Anc_8.70
           YFL005W
          Length = 211

 Score =  137 bits (344), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 77/205 (37%), Positives = 118/205 (57%), Gaps = 11/205 (5%)

Query: 7   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAG 66
           +I+KV+++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V ++ K   +Q+WDTAG
Sbjct: 13  SIMKVLLIGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDINGKKIKLQLWDTAG 72

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNK 126
           QERF+++  A+YRGA   +LVYDVT+ ++FEN+K W      HA     +    +++GNK
Sbjct: 73  QERFRTITTAYYRGAMGIILVYDVTDERTFENVKNWFKTVSDHA----TDDAQLLLVGNK 128

Query: 127 VDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR----SALQQNQXX 182
            D++   +LVT +  + L   LG IP    SAK   NV+  F  +A+        Q+   
Sbjct: 129 CDMD--TRLVTHEQGEALGKELG-IPFVEASAKDDTNVNEVFFTLAKLIQGRLDSQSAAD 185

Query: 183 XXXXXXXXXXXINIQLDGEPNSCSC 207
                      +NI  +G+ +S +C
Sbjct: 186 STAGRGNSKGGVNINENGKKSSSNC 210

>Kpol_1011.3 s1011 complement(4828..5472) [645 bp, 214 aa] {ON}
           complement(4828..5472) [645 nt, 215 aa]
          Length = 214

 Score =  136 bits (343), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 109/166 (65%), Gaps = 7/166 (4%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           I+K++++GDSGVGK+ L+ R+V+DK++  +  TIG DF  K V ++ K   +Q+WDTAGQ
Sbjct: 19  IMKILLIGDSGVGKSCLLVRFVDDKFNPSFITTIGIDFKIKTVEINGKKIKLQLWDTAGQ 78

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ERF+++  A+YRGA   +LVYDVT+ K+F NI+ W      HAN    +    +++GNK 
Sbjct: 79  ERFRTITTAYYRGAMGIILVYDVTDEKTFANIRQWFKTVTEHAN----DEAQLLLVGNKS 134

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           D++   + VT +  +EL+  LG IP   +SAK+  NV+  F  +A+
Sbjct: 135 DMD--TRAVTYEQGEELSKELG-IPFIESSAKNDENVNEIFSTLAK 177

>KAFR0B01660 Chr2 complement(318959..319579) [621 bp, 206 aa] {ON}
           Anc_8.70 YFL005W
          Length = 206

 Score =  136 bits (342), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 111/176 (63%), Gaps = 10/176 (5%)

Query: 1   MSFRKKN---ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVA 57
           MS   KN   I+K++++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V ++ K  
Sbjct: 1   MSGNGKNYDSIMKILLIGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDINGKKV 60

Query: 58  TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPET 117
            +Q+WDTAGQERF+++  A+YRGA   +LVYDVT+ ++F NIK W      HAN    + 
Sbjct: 61  KLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNDHAN----DD 116

Query: 118 FPFVILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
              +++GNK D++   +LVT +  + LA  LG +P   +SAK   NV+  F  +AR
Sbjct: 117 AQLLLVGNKSDMDT--RLVTYEQGEALAKELG-LPFVESSAKDDQNVNEIFFTLAR 169

>KLLA0D05313g Chr4 (459496..460110) [615 bp, 204 aa] {ON} highly
           similar to uniprot|P01123 Saccharomyces cerevisiae
           YFL038C YPT1 Ras-like small GTPase involved in the
           ER-to-Golgi step of the secretory pathway complex
           formation with the Rab escort protein Mrs6p is required
           for prenylation of Ypt1p by protein
           geranylgeranyltransferase type II (Bet2p-Bet4p)
          Length = 204

 Score =  135 bits (340), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 72/177 (40%), Positives = 112/177 (63%), Gaps = 10/177 (5%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++GDSGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D K   +Q+WDTAGQ
Sbjct: 8   LFKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQ 67

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ERF+++  ++YRGA   ++VYDVT+ +SF N+KTW  E          +    +++GNK 
Sbjct: 68  ERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKTWLQEIDRFGTAGVLK----LLVGNKN 123

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAF----EEIARSALQQNQ 180
           D+ + KK+V  + A+E A S+G IP   TSA  + NV+ AF    ++I  S  +Q +
Sbjct: 124 DLTD-KKVVDTEVAKEFADSIG-IPFIETSALDSSNVEEAFLIMTKQIKESVAKQQK 178

>TBLA0D02650 Chr4 (655924..656577) [654 bp, 217 aa] {ON} Anc_8.70
           YFL005W
          Length = 217

 Score =  135 bits (340), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 105/161 (65%), Gaps = 7/161 (4%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           I+K++++GDSGVGK+ L+ R+V+DK++  +  TIG DF  K + ++ K   +Q+WDTAGQ
Sbjct: 20  IMKILLIGDSGVGKSCLLVRFVDDKFNPSFITTIGIDFKIKTIDINGKKIKLQLWDTAGQ 79

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ERF+++  A+YRGA   +LVYDVT+  +FENI+TW      HAN  +      +++GNK 
Sbjct: 80  ERFRTITTAYYRGAMGIILVYDVTDENTFENIRTWFKTVNEHANGEA----QLLLVGNKS 135

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAF 168
           D+E   + VT +  + LA  LG IP   +SAK   NV+  F
Sbjct: 136 DME--TRTVTYEQGESLAKELG-IPFIESSAKDDKNVNEIF 173

>Kwal_14.1116 s14 complement(202534..203148) [615 bp, 204 aa] {ON}
           YFL038C (YPT1) - Ras-like GTP-binding protein; most
           similar to mammalian Rab1A protein [contig 244] FULL
          Length = 204

 Score =  135 bits (339), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 113/177 (63%), Gaps = 10/177 (5%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++GDSGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D K   +Q+WDTAGQ
Sbjct: 8   LFKLLLIGDSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQ 67

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ERF+++  ++YRGA   ++VYDVT++ SF ++K W  E   +A     +    +++GNK 
Sbjct: 68  ERFRTITSSYYRGAHGIIIVYDVTDHDSFNDVKMWLQEIDRYATAGVLK----LMVGNKS 123

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAF----EEIARSALQQNQ 180
           D+++ K++V    A+E A SL  IP   TSA  + NV+ AF    ++I  S  QQ++
Sbjct: 124 DLQD-KRMVEYDVAKEFADSL-QIPFLETSALDSSNVEEAFLTMAKQIKESMAQQHR 178

>Suva_6.54 Chr6 (102191..102838) [648 bp, 215 aa] {ON} YFL005W
           (REAL)
          Length = 215

 Score =  135 bits (339), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 71/167 (42%), Positives = 108/167 (64%), Gaps = 7/167 (4%)

Query: 7   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAG 66
           +I+K++++GDSGVGK+ L+ R+V DK++  +  TIG DF  K V ++ K   +Q+WDTAG
Sbjct: 19  SIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAG 78

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNK 126
           QERF+++  A+YRGA   +LVYDVT+ ++F NIK W      HAN    +    +++GNK
Sbjct: 79  QERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHAN----DEAQLLLVGNK 134

Query: 127 VDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
            D++   ++VT    + LA  LG IP   +SAK+  NV+  F  +AR
Sbjct: 135 SDMD--TRVVTADQGEALAKELG-IPFIESSAKNDDNVNEIFFTLAR 178

>KLTH0G18788g Chr7 (1624218..1624832) [615 bp, 204 aa] {ON} highly
           similar to uniprot|P01123 Saccharomyces cerevisiae
           YFL038C YPT1 Ras-like small GTPase involved in the
           ER-to-Golgi step of the secretory pathway complex
           formation with the Rab escort protein Mrs6p is required
           for prenylation of Ypt1p by protein
           geranylgeranyltransferase type II (Bet2p-Bet4p)
          Length = 204

 Score =  135 bits (339), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 113/177 (63%), Gaps = 10/177 (5%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++GDSGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D K   +Q+WDTAGQ
Sbjct: 8   LFKLLLIGDSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQ 67

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ERF+++  ++YRGA   ++VYDVT++ SF ++K W  E   +A     +    +++GNK 
Sbjct: 68  ERFRTITSSYYRGAHGIIIVYDVTDHDSFNDVKMWLQEIDRYATAGVLK----LMVGNKS 123

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAF----EEIARSALQQNQ 180
           D+++ K++V    A+E A SL  IP   TSA  + NV+ AF    ++I  S  QQ++
Sbjct: 124 DLQD-KRMVEYDVAKEFADSL-QIPFLETSALDSSNVEEAFLTMAKQIKESMAQQHK 178

>NCAS0J00630 Chr10 complement(95335..95991) [657 bp, 218 aa] {ON}
           Anc_8.70
          Length = 218

 Score =  135 bits (340), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 119/199 (59%), Gaps = 8/199 (4%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           ++K++++GDSGVGK+ L+ R+V +K++  +  TIG DF  K + +  +   +Q+WDTAGQ
Sbjct: 26  VMKILLIGDSGVGKSCLLVRFVENKFNPSFITTIGIDFKIKTLDIQGRKIKLQLWDTAGQ 85

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ERF+++  A+YRGA   +LVYDVT+ ++F+NI+ W      HAN    E    +++GNK 
Sbjct: 86  ERFRTITTAYYRGAMGIILVYDVTDERTFQNIRQWYSTVNEHAN----EQVQLLLVGNKS 141

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQNQXXXXXXX 187
           D+    + VT +  +ELA  LG +P    SAK+  NV+  F ++A+   ++         
Sbjct: 142 DL--GNRQVTKEQGEELARELG-LPFMEASAKNDDNVNDLFLQLAKLIQEKIDNDEMGEP 198

Query: 188 XXXXXXINIQ-LDGEPNSC 205
                 +NI+  DG+ +SC
Sbjct: 199 RTAKKNVNIKSKDGKTSSC 217

>YFL005W Chr6 (130334..130981) [648 bp, 215 aa] {ON}  SEC4Rab family
           GTPase essential for vesicle-mediated exocytic secretion
           and autophagy; associates with the exocyst component
           Sec15p and may regulate polarized delivery of transport
           vesicles to the exocyst at the plasma membrane
          Length = 215

 Score =  135 bits (339), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 71/167 (42%), Positives = 108/167 (64%), Gaps = 7/167 (4%)

Query: 7   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAG 66
           +I+K++++GDSGVGK+ L+ R+V DK++  +  TIG DF  K V ++ K   +Q+WDTAG
Sbjct: 19  SIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAG 78

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNK 126
           QERF+++  A+YRGA   +LVYDVT+ ++F NIK W      HAN    +    +++GNK
Sbjct: 79  QERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHAN----DEAQLLLVGNK 134

Query: 127 VDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
            D+E   ++VT    + LA  LG IP   +SAK+  NV+  F  +A+
Sbjct: 135 SDME--TRVVTADQGEALAKELG-IPFIESSAKNDDNVNEIFFTLAK 178

>KLLA0F20471g Chr6 (1901749..1902387) [639 bp, 212 aa] {ON} highly
           similar to uniprot|Q99260 Saccharomyces cerevisiae
           YLR262C YPT6 Ras-like GTP binding protein involved in
           the secretory pathway, required for fusion of
           endosome-derived vesicles with the late Golgi; has
           similarity to the human GTPase, Rab6
          Length = 212

 Score =  135 bits (339), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 107/165 (64%), Gaps = 6/165 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DDK   +Q+WDTAGQER
Sbjct: 13  KIVFLGEQGVGKTSLITRFMYDTFDDNYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQER 72

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           F+SL  ++ R +   ++VYDVTN KSFE I  W ++  +       E    VI+GNK D+
Sbjct: 73  FRSLIPSYIRDSHVAIVVYDVTNRKSFEYIDKWIEDVKME---RGEENVILVIVGNKSDL 129

Query: 130 EESKKLVTPKAAQELATSLGNIPLFL-TSAKSAINVDTAFEEIAR 173
            E +++ T +   E  +++ N  LF+ TS K+  NV T F++IA+
Sbjct: 130 VEERQVSTEEG--ERKSTVLNAKLFIETSTKAGFNVKTLFKKIAK 172

>CAGL0F02123g Chr6 (212117..212764) [648 bp, 215 aa] {ON} highly
           similar to uniprot|P07560 Saccharomyces cerevisiae
           YFL005w SEC4
          Length = 215

 Score =  134 bits (338), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 108/166 (65%), Gaps = 7/166 (4%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           I+K++++GDSGVGK+ L+ R+V DK++  +  TIG DF  K V ++ K   +Q+WDTAGQ
Sbjct: 20  IMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQ 79

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ERF+++  A+YRGA   +LVYDVT+ ++F NIK W      HAN    +    +++GNK 
Sbjct: 80  ERFRTITTAYYRGAMGIILVYDVTDERTFANIKQWFKTVNEHAN----DEAQLLLVGNKS 135

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           D++   ++VT +  + LA  LG +P   +SAK+  NV+  F  +AR
Sbjct: 136 DMDT--RVVTYEQGEALAKELG-LPFIESSAKNDDNVNEIFFTLAR 178

>AGL021W Chr7 (681754..682392) [639 bp, 212 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL005W (SEC4)
          Length = 212

 Score =  134 bits (338), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 71/167 (42%), Positives = 106/167 (63%), Gaps = 7/167 (4%)

Query: 7   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAG 66
           +I+K++++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V ++ K   +Q+WDTAG
Sbjct: 18  SIMKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKAVDINGKKIKLQLWDTAG 77

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNK 126
           QERF+++  A+YRGA   +LVYDVT+ ++FENI+ W      HAN    E    +++GNK
Sbjct: 78  QERFRTITTAYYRGAMGIILVYDVTDERTFENIRQWFTTVNQHAN----EEAQLLLVGNK 133

Query: 127 VDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
            D++   + VT +  + LA  LG +P    SAK   NV   F  +A+
Sbjct: 134 KDMD--TRAVTYEQGESLAKELG-VPFIEASAKDDENVSDIFFTLAK 177

>TPHA0P00360 Chr16 (76379..77023) [645 bp, 214 aa] {ON} Anc_8.70
           YFL005W
          Length = 214

 Score =  134 bits (337), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 70/167 (41%), Positives = 108/167 (64%), Gaps = 7/167 (4%)

Query: 7   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAG 66
           +I+K++++GDSGVGK+ L+ R+V+DK++  +  TIG DF  K V ++ +   +Q+WDTAG
Sbjct: 18  SIMKILLIGDSGVGKSCLLVRFVDDKFNPSFITTIGIDFKIKTVEINGRKIKLQLWDTAG 77

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNK 126
           QERF+++  A+YRGA   +LVYDVT+ K+F NI+ W      HAN    +    +++GNK
Sbjct: 78  QERFRTITTAYYRGAMGIILVYDVTDEKTFANIRQWFKTVTEHAN----DDAQLLLVGNK 133

Query: 127 VDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
            D+E   + VT +   EL+  LG IP    SAK+  NV+  F  +A+
Sbjct: 134 SDME--TRTVTHEQGDELSRELG-IPFVEASAKNDDNVNEIFFTLAK 177

>TDEL0C00980 Chr3 (164219..164866) [648 bp, 215 aa] {ON} Anc_8.70
           YFL005W
          Length = 215

 Score =  134 bits (336), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 108/166 (65%), Gaps = 7/166 (4%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           I+K++++GDSGVGK+ L+ R+V+DK++  +  TIG DF  K V ++ K   +Q+WDTAGQ
Sbjct: 20  IMKILLIGDSGVGKSCLLVRFVDDKFNPSFITTIGIDFKIKTVDINGKKTKLQLWDTAGQ 79

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ERF+++  A+YRGA   +LVYDVT+ ++F NI+ W      HAN    +    +++GNK 
Sbjct: 80  ERFRTITTAYYRGAMGIILVYDVTDERTFTNIRQWFKTVNEHAN----DDAQLLLVGNKS 135

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           D++   + VT +  + LA  LG IP   +SAK+  NV+  F  +AR
Sbjct: 136 DMD--TRTVTYEQGETLAKELG-IPFVESSAKNDDNVNEIFFTLAR 178

>Smik_6.73 Chr6 (143556..144203) [648 bp, 215 aa] {ON} YFL005W
           (REAL)
          Length = 215

 Score =  133 bits (335), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 70/167 (41%), Positives = 108/167 (64%), Gaps = 7/167 (4%)

Query: 7   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAG 66
           +I+K++++GDSGVGK+ L+ R+V DK++  +  TIG DF  K V ++ K   +Q+WDTAG
Sbjct: 19  SIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAG 78

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNK 126
           QERF+++  A+YRGA   +LVYDVT+ ++F NIK W      HAN    +    +++GNK
Sbjct: 79  QERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHAN----DEAQLLLVGNK 134

Query: 127 VDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
            D++   ++VT    + LA  LG IP   +SAK+  NV+  F  +A+
Sbjct: 135 SDMD--TRVVTADQGEALAKELG-IPFIESSAKNDDNVNEIFFTLAK 178

>Ecym_7305 Chr7 (650045..650686) [642 bp, 213 aa] {ON} similar to
           Ashbya gossypii AGL021W
          Length = 213

 Score =  133 bits (335), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 71/167 (42%), Positives = 105/167 (62%), Gaps = 7/167 (4%)

Query: 7   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAG 66
           +I+KV+++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V +D K   +Q+WDTAG
Sbjct: 19  SIMKVLLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDIDGKKIKLQLWDTAG 78

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNK 126
           QERF+++  A+YRGA   +LVYDVT+ ++FENI+ W        N  + E    +++GNK
Sbjct: 79  QERFRTITTAYYRGAMGIILVYDVTDERTFENIRQW----FSTVNQHATEDAQILLVGNK 134

Query: 127 VDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
            D++   + VT +  + LA  LG +P    SAK   NV   F  +A+
Sbjct: 135 KDMD--TRAVTYEQGESLAKELG-VPFIEASAKDDENVSDIFFTLAK 178

>Kwal_23.5058 s23 (989533..990174) [642 bp, 213 aa] {ON} YFL005W
           (SEC4) - Ras-like small GTP-binding protein [contig 7]
           FULL
          Length = 213

 Score =  133 bits (335), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 106/167 (63%), Gaps = 7/167 (4%)

Query: 7   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAG 66
           +I+K++++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V ++ K   +Q+WDTAG
Sbjct: 19  SIMKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDINGKKVKLQLWDTAG 78

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNK 126
           QERF+++  A+YRGA   +LVYDVT+ ++F N+K W      HAN    +    +++GNK
Sbjct: 79  QERFRTITTAYYRGAMGIILVYDVTDERTFANVKQWFSTVNQHAN----DEAQLLLVGNK 134

Query: 127 VDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
            D++   + V+    + LA  LG IP    SAK   NV+  F ++A+
Sbjct: 135 SDMDT--RAVSTDQGESLAKELG-IPFVEASAKDDTNVNDIFFQLAK 178

>NDAI0G03340 Chr7 (792718..793341) [624 bp, 207 aa] {ON} Anc_8.70
          Length = 207

 Score =  133 bits (334), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 109/167 (65%), Gaps = 7/167 (4%)

Query: 7   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAG 66
           +I+K++++GDSGVGK+ L+ R+V DK++  +  TIG DF  K V ++ K   +Q+WDTAG
Sbjct: 12  SIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAG 71

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNK 126
           QERF+++  A+YRGA   +LVYDVT+ ++F NIK W      HAN    +    +++GNK
Sbjct: 72  QERFRTITTAYYRGAMGIILVYDVTDERTFSNIKQWFKTVNEHAN----DEAQLLLVGNK 127

Query: 127 VDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
            D++   ++VT +  + LA  LG +P   +SAK+  NV+  F  +A+
Sbjct: 128 SDMD--TRVVTYEQGESLAKELG-LPFVESSAKNDDNVNEIFFTLAK 171

>NDAI0G03050 Chr7 complement(711396..712028) [633 bp, 210 aa] {ON}
           Anc_8.25
          Length = 210

 Score =  132 bits (333), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 107/166 (64%), Gaps = 6/166 (3%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D K   +Q+WDTAGQ
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQ 67

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ERF+++  ++YRG+   ++VYDVT+  SF+ +K W  E   +A      T   +++GNK 
Sbjct: 68  ERFRTITSSYYRGSHGIIIVYDVTDQDSFDGVKMWLQEIDRYA----TSTVLKLLVGNKC 123

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           D+E+ K++V    A+E A S   +P   TSA ++ NV+ AF  +AR
Sbjct: 124 DLED-KRVVEYDVAKEFADS-NKMPFLETSALNSTNVEEAFLTMAR 167

>NCAS0C04020 Chr3 (817944..818576) [633 bp, 210 aa] {ON} Anc_1.215
           YKR055W
          Length = 210

 Score =  132 bits (332), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 68/166 (40%), Positives = 108/166 (65%), Gaps = 7/166 (4%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           I+K++++GDSGVGK+ L+ R+V DK++  +  TIG DF  K V ++ K   +Q+WDTAGQ
Sbjct: 16  IMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQ 75

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ERF+++  A+YRGA   +LVYDVT+ ++F N+K W      HAN    +    +++GNK 
Sbjct: 76  ERFRTITTAYYRGAMGIILVYDVTDERTFSNVKQWFKTVNEHAN----DEAQLLLVGNKS 131

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           D++   ++VT +  + LA  LG +P   +SAK+  NV+  F  +A+
Sbjct: 132 DMDT--RVVTYEQGESLAKELG-LPFIESSAKNDDNVNEIFFTLAK 174

>KLTH0A02662g Chr1 complement(226313..226954) [642 bp, 213 aa] {ON}
           highly similar to uniprot|P07560 Saccharomyces
           cerevisiae YFL005W SEC4 Secretory vesicle-associated Rab
           GTPase essential for exocytosis associates with the
           exocyst component Sec15p and may regulate polarized
           delivery of transport vesicles to the exocyst at the
           plasma membrane
          Length = 213

 Score =  132 bits (332), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 70/167 (41%), Positives = 105/167 (62%), Gaps = 7/167 (4%)

Query: 7   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAG 66
           +I+K++++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V ++ K   +Q+WDTAG
Sbjct: 19  SIMKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDINGKKVKLQLWDTAG 78

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNK 126
           QERF+++  A+YRGA   +LVYDVT+ ++F NIK W      HAN    +    +++GNK
Sbjct: 79  QERFRTITTAYYRGAMGIILVYDVTDERTFSNIKQWFSTVNQHAN----DEAQLLLVGNK 134

Query: 127 VDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
            D++   + V+    + LA  LG IP    SAK   NV+  F  +A+
Sbjct: 135 SDMDT--RAVSTDQGEALAKELG-IPFVEASAKDDTNVNDIFFLLAK 178

>ZYRO0F03872g Chr6 (329213..329866) [654 bp, 217 aa] {ON} highly
           similar to uniprot|P07560 Saccharomyces cerevisiae
           YFL005W SEC4 Secretory vesicle-associated Rab GTPase
           essential for exocytosis associates with the exocyst
           component Sec15p and may regulate polarized delivery of
           transport vesicles to the exocyst at the plasma membrane
          Length = 217

 Score =  132 bits (332), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 109/167 (65%), Gaps = 7/167 (4%)

Query: 7   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAG 66
           +I+K++++GDSGVGK+ L+ R+V+DK++  +  TIG DF  K V ++ K   +Q+WDTAG
Sbjct: 19  SIMKILLIGDSGVGKSCLLVRFVDDKFNPSFITTIGIDFKIKTVDINGKKIKLQLWDTAG 78

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNK 126
           QERF+++  A+YRGA   +LVYDVT+ ++F NI+ W      HAN    +    +++GNK
Sbjct: 79  QERFRTITTAYYRGAMGIILVYDVTDERTFSNIRQWFKTVNEHAN----DDAQLLLVGNK 134

Query: 127 VDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
            D++   + VT +  + LA  LG IP   +SAK+  NV+  F  +A+
Sbjct: 135 SDMDT--RTVTYEQGEALAKELG-IPFIESSAKNDDNVNEIFFTLAK 178

>SAKL0B02332g Chr2 (227078..227719) [642 bp, 213 aa] {ON} highly
           similar to uniprot|P07560 Saccharomyces cerevisiae
           YFL005W SEC4 Secretory vesicle-associated Rab GTPase
           essential for exocytosis associates with the exocyst
           component Sec15p and may regulate polarized delivery of
           transport vesicles to the exocyst at the plasma membrane
          Length = 213

 Score =  132 bits (332), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 73/200 (36%), Positives = 116/200 (58%), Gaps = 7/200 (3%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           I+K++++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V ++ K   +Q+WDTAGQ
Sbjct: 20  IMKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDINGKKIKLQLWDTAGQ 79

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ERF+++  A+YRGA   +LVYDVT+ ++F NIK W      HAN    +    +++GNK 
Sbjct: 80  ERFRTITTAYYRGAMGIILVYDVTDERTFSNIKQWLSTVNQHAN----DEAQLLLVGNKS 135

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQNQXXXXXXX 187
           D++   + VT +  + L+  LG +P    SAK+  NV+  F  +A+   ++         
Sbjct: 136 DMDT--RAVTYEQGEALSKELG-LPFVEASAKNDDNVNEIFFTLAKLIQEKIDNDKLVGN 192

Query: 188 XXXXXXINIQLDGEPNSCSC 207
                 +NI  +G  +  +C
Sbjct: 193 TNKDGSVNINSNGGGSKSNC 212

>KLLA0E12079g Chr5 (1075299..1075943) [645 bp, 214 aa] {ON} highly
           similar to uniprot|P07560 Saccharomyces cerevisiae
           YFL005W SEC4 Secretory vesicle-associated Rab GTPase
           essential for exocytosis associates with the exocyst
           component Sec15p and may regulate polarized delivery of
           transport vesicles to the exocyst at the plasma membrane
          Length = 214

 Score =  132 bits (332), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 68/167 (40%), Positives = 105/167 (62%), Gaps = 7/167 (4%)

Query: 7   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAG 66
           +++K+++LGDSGVGK+ L+ R+V DK++  +  TIG DF  K V ++ K   +Q+WDTAG
Sbjct: 19  SVMKILLLGDSGVGKSCLLVRFVEDKFTPTFITTIGIDFKIKTVDINGKRVKLQLWDTAG 78

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNK 126
           QERF+++  A+YRGA   VL+YDVT+ ++FENI+ W        N  + E    +++GNK
Sbjct: 79  QERFRTITTAYYRGAMGIVLIYDVTDERTFENIRQW----FSTVNQHASEDVVMLLVGNK 134

Query: 127 VDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
            D++   + V+ +  + LA  LG IP    SAK   NV   F  +A+
Sbjct: 135 KDMD--TRTVSYEQGEALAKELG-IPFIEASAKDDTNVSEIFFTLAK 178

>Smik_12.336 Chr12 complement(606255..606905) [651 bp, 216 aa] {ON}
           YLR262C (REAL)
          Length = 216

 Score =  132 bits (332), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 103/165 (62%), Gaps = 4/165 (2%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DDK   +Q+WDTAGQER
Sbjct: 12  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQER 71

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           F+SL  ++ R +   ++VYD+T  KSFE I  W ++     N    E     I+GNK D+
Sbjct: 72  FRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDV---KNERGEENVILCIVGNKSDL 128

Query: 130 EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARS 174
            + +++ T +  ++ A  LG      TS K+  NV T F++IA+S
Sbjct: 129 SDERQISTEEGEKK-AKLLGAKIFMETSTKAGYNVKTLFKKIAKS 172

>Skud_12.341 Chr12 complement(609187..609837) [651 bp, 216 aa] {ON}
           YLR262C (REAL)
          Length = 216

 Score =  132 bits (331), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 102/165 (61%), Gaps = 4/165 (2%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DDK   +Q+WDTAGQER
Sbjct: 12  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQER 71

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           F+SL  ++ R +   ++VYD+T  KSFE I  W ++     N    E     I+GNK D+
Sbjct: 72  FRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDV---KNERGEENVILCIVGNKSDL 128

Query: 130 EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARS 174
            + +++ T +  ++ A  LG      TS K+  NV T F+ IA+S
Sbjct: 129 SDERQISTEEGEKK-AKLLGAKIFMETSTKAGYNVKTLFKRIAKS 172

>KAFR0C03580 Chr3 (733658..734296) [639 bp, 212 aa] {ON} Anc_8.25
           YFL038C
          Length = 212

 Score =  131 bits (330), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 107/166 (64%), Gaps = 6/166 (3%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K + +D K   +Q+WDTAGQ
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTIELDGKTVKLQIWDTAGQ 67

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ERF+++  ++YRG+   ++VYDVT+ +SF  +K W  E   +A  +  +    +++GNK 
Sbjct: 68  ERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSAVLK----LLVGNKC 123

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           D+ + K++V    A+E A S  N+P   TSA  + NV+ AF  +AR
Sbjct: 124 DL-DGKRMVEYDVAKEFAES-NNMPFLETSALDSTNVEEAFLTMAR 167

>TBLA0C00450 Chr3 complement(84352..84984) [633 bp, 210 aa] {ON}
           Anc_8.25 YFL038C
          Length = 210

 Score =  131 bits (330), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 68/176 (38%), Positives = 112/176 (63%), Gaps = 9/176 (5%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++G+SGVGK+ L+ R+ +D YS  Y +TIG DF  K + +D K   +Q+WDTAGQ
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYSNDYISTIGVDFKIKTIEIDGKTVKLQIWDTAGQ 67

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ERF+++  ++YRG+   ++VYDVT+  SF ++K W  E   +A  S  +    +++GNK 
Sbjct: 68  ERFRTITSSYYRGSHGIIIVYDVTDQDSFNSVKMWLQEIDRYATSSVLK----LLVGNKS 123

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIA---RSALQQNQ 180
           D+++ K++V    A+E A +  N+P   TSA  + NV+ AF  +A   + +L Q Q
Sbjct: 124 DLKD-KRIVEYDVAKEFAET-NNMPFLETSALDSTNVEEAFLTMAKQIKESLSQQQ 177

>KNAG0E03100 Chr5 complement(618438..619076) [639 bp, 212 aa] {ON}
           Anc_8.25 YFL038C
          Length = 212

 Score =  131 bits (330), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 66/166 (39%), Positives = 106/166 (63%), Gaps = 6/166 (3%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D K   +Q+WDTAGQ
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQ 67

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ERF+++  ++YRG+   ++VYDVT+  SF+ +K W  E   +A      T   +++GNK 
Sbjct: 68  ERFRTITSSYYRGSHGIIIVYDVTDQDSFDGVKMWLQEIDRYA----TSTVLKLLVGNKC 123

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           D+ + K++V    A+E A +  N+P   TSA  + NV+ AF  +AR
Sbjct: 124 DLND-KRVVEYDVAKEFADA-NNMPFLETSALDSTNVEEAFLTMAR 167

>Skud_6.66 Chr6 (132521..133168) [648 bp, 215 aa] {ON} YFL005W
           (REAL)
          Length = 215

 Score =  130 bits (327), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 107/167 (64%), Gaps = 7/167 (4%)

Query: 7   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAG 66
           +I+K++++GDSGVGK+ L+ R+V DK++  +  TIG DF  K V ++ K   +Q+WDTAG
Sbjct: 19  SIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAG 78

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNK 126
           QERF+++  A+YRGA   +LVYDVT+ ++F NIK W      HA     +    +++GNK
Sbjct: 79  QERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHA----TDEAQLLLVGNK 134

Query: 127 VDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
            D++   ++VT    + LA  LG IP   +SAK+  NV+  F  +A+
Sbjct: 135 SDMD--TRVVTVDQGEALAKELG-IPFIESSAKNDDNVNEIFFTLAK 178

>CAGL0K06017g Chr11 complement(586922..587581) [660 bp, 219 aa] {ON}
           highly similar to uniprot|Q99260 Saccharomyces
           cerevisiae YLR262c GTP-binding protein
          Length = 219

 Score =  130 bits (327), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 107/177 (60%), Gaps = 7/177 (3%)

Query: 1   MSFRKKNIL---KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVA 57
           MS R+  +L   K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DDK  
Sbjct: 1   MSGRQDKLLTKYKIVFLGEQGVGKTSLITRFMYDTFDDNYQATIGIDFLSKTMYLDDKTI 60

Query: 58  TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPET 117
            +Q+WDTAGQERF+SL  ++ R +   ++VYD+T  KSFE I  W ++     N    E 
Sbjct: 61  RLQLWDTAGQERFRSLIPSYIRDSRVAIVVYDITKRKSFEFIDKWIEDV---KNERGAEN 117

Query: 118 FPFVILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARS 174
               ++GNK D+ + ++ VT +  ++ A  LG      TS K   NV   F++IA+S
Sbjct: 118 VILCVVGNKSDLADERQ-VTAEEGEKKAQDLGAKIFMQTSTKVGYNVKNLFKKIAKS 173

>YLR262C Chr12 complement(668244..668891) [648 bp, 215 aa] {ON}
           YPT6Rab family GTPase, Ras-like GTP binding protein
           involved in the secretory pathway, required for fusion
           of endosome-derived vesicles with the late Golgi,
           maturation of the vacuolar carboxypeptidase Y; has
           similarity to the human GTPase, Rab6
          Length = 215

 Score =  130 bits (326), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 67/165 (40%), Positives = 102/165 (61%), Gaps = 4/165 (2%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DDK   +Q+WDTAGQER
Sbjct: 12  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQER 71

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           F+SL  ++ R +   ++VYD+T  KSFE I  W ++     N    E     I+GNK D+
Sbjct: 72  FRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDV---KNERGDENVILCIVGNKSDL 128

Query: 130 EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARS 174
            + +++ T +  ++ A  LG      TS K+  NV   F++IA+S
Sbjct: 129 SDERQISTEEGEKK-AKLLGAKIFMETSTKAGYNVKALFKKIAKS 172

>Suva_10.359 Chr10 complement(629445..630092) [648 bp, 215 aa] {ON}
           YLR262C (REAL)
          Length = 215

 Score =  130 bits (326), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 67/165 (40%), Positives = 102/165 (61%), Gaps = 4/165 (2%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DDK   +Q+WDTAGQER
Sbjct: 12  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQER 71

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           F+SL  ++ R +   ++VYD+T  KSFE I  W ++     N    E     I+GNK D+
Sbjct: 72  FRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDV---KNERGEENVILCIVGNKSDL 128

Query: 130 EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARS 174
            + +++ T +  ++ A  LG      TS K+  NV   F++IA+S
Sbjct: 129 SDERQISTEEGEKK-AKLLGAKIFMETSTKAGYNVKNLFKKIAKS 172

>KAFR0C03330 Chr3 (679443..680075) [633 bp, 210 aa] {ON} Anc_8.70
           YFL005W
          Length = 210

 Score =  130 bits (326), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 106/167 (63%), Gaps = 7/167 (4%)

Query: 7   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAG 66
           +I+K++++GDSGVGK+ L+ R+V DK+S  +  TIG DF  K V ++ K   +Q+WDTAG
Sbjct: 15  SIMKILLIGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVEINGKKIKLQLWDTAG 74

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNK 126
           QERF+++  A+YRGA   +LVYDVT+ K+F NI  W      HAN    +    +++GNK
Sbjct: 75  QERFRTITTAYYRGAMGIILVYDVTDEKTFANINKWFKTVTEHAN----DDAQLLLVGNK 130

Query: 127 VDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
            D++   ++V+ +  + LA  LG +P   +SAK   NV   F  +A+
Sbjct: 131 NDMDT--RVVSCEQGEVLAKELG-LPFVESSAKDNNNVSDIFLSLAK 174

>CAGL0K12672g Chr11 (1256370..1256990) [621 bp, 206 aa] {ON} highly
           similar to uniprot|P01123 Saccharomyces cerevisiae
           YFL038c YPT1
          Length = 206

 Score =  129 bits (325), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 109/176 (61%), Gaps = 10/176 (5%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D K   +Q+WDTAGQ
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQ 67

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ERF+++  ++YRG+   ++VYDVT+ +SF  +K W  E   +A      T   +++GNK 
Sbjct: 68  ERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYA----TSTVLKLLVGNKC 123

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR----SALQQN 179
           D+ + K++V    A+E A +   +P   TSA  + NV+ AF  +AR    S  QQN
Sbjct: 124 DLAD-KRVVEYDVAKEFAEA-NKMPFLETSALDSTNVEEAFLTMARQIKESMTQQN 177

>Suva_6.19 Chr6 complement(28872..29492) [621 bp, 206 aa] {ON}
           YFL038C (REAL)
          Length = 206

 Score =  129 bits (325), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 110/176 (62%), Gaps = 10/176 (5%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D K   +Q+WDTAGQ
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQ 67

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ERF+++  ++YRG+   ++VYDVT+ +SF  +K W  E   +A      T   +++GNK 
Sbjct: 68  ERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYA----TSTVLKLLVGNKC 123

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR----SALQQN 179
           D+++ K++V    A+E A +   +P   TSA  + NV+ AF  +AR    S  QQN
Sbjct: 124 DLKD-KRVVEYDVAKEFADA-NKMPFLETSALDSTNVEDAFLTMARQIKESMSQQN 177

>Skud_6.32 Chr6 complement(58531..59151) [621 bp, 206 aa] {ON}
           YFL038C (REAL)
          Length = 206

 Score =  129 bits (324), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 110/176 (62%), Gaps = 10/176 (5%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D K   +Q+WDTAGQ
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQ 67

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ERF+++  ++YRG+   ++VYDVT+ +SF  +K W  E   +A      T   +++GNK 
Sbjct: 68  ERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYA----TSTVLKLLVGNKC 123

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR----SALQQN 179
           D+++ K++V    A+E A +   +P   TSA  + NV+ AF  +AR    S  QQN
Sbjct: 124 DLKD-KRVVEYDVAKEFADA-NKMPFLETSALDSTNVEDAFLTMARQIKESMSQQN 177

>Smik_6.40 Chr6 complement(70749..71369) [621 bp, 206 aa] {ON}
           YFL038C (REAL)
          Length = 206

 Score =  129 bits (324), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 110/176 (62%), Gaps = 10/176 (5%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D K   +Q+WDTAGQ
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQ 67

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ERF+++  ++YRG+   ++VYDVT+ +SF  +K W  E   +A      T   +++GNK 
Sbjct: 68  ERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYA----TSTVLKLLVGNKC 123

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR----SALQQN 179
           D+++ K++V    A+E A +   +P   TSA  + NV+ AF  +AR    S  QQN
Sbjct: 124 DLKD-KRVVEYDVAKEFADA-NKMPFLETSALDSTNVEDAFLTMARQIKESMSQQN 177

>YFL038C Chr6 complement(55366..55986) [621 bp, 206 aa] {ON}
           YPT1Rab family GTPase, involved in the ER-to-Golgi step
           of the secretory pathway; complex formation with the Rab
           escort protein Mrs6p is required for prenylation of
           Ypt1p by protein geranylgeranyltransferase type II
           (Bet2p-Bet4p)
          Length = 206

 Score =  129 bits (324), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 110/176 (62%), Gaps = 10/176 (5%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D K   +Q+WDTAGQ
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQ 67

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ERF+++  ++YRG+   ++VYDVT+ +SF  +K W  E   +A      T   +++GNK 
Sbjct: 68  ERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYA----TSTVLKLLVGNKC 123

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR----SALQQN 179
           D+++ K++V    A+E A +   +P   TSA  + NV+ AF  +AR    S  QQN
Sbjct: 124 DLKD-KRVVEYDVAKEFADA-NKMPFLETSALDSTNVEDAFLTMARQIKESMSQQN 177

>AGR257C Chr7 complement(1225880..1226542) [663 bp, 220 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR262C
           (YPT6)
          Length = 220

 Score =  129 bits (325), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 101/165 (61%), Gaps = 6/165 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K V +DD+   +Q+WDTAGQER
Sbjct: 14  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTVYLDDRTIRLQLWDTAGQER 73

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           F+SL  ++ R +   ++VYD+TN KSFE I  W ++     N    E     I+GNK D+
Sbjct: 74  FRSLIPSYIRDSHVAIVVYDITNKKSFEYIDKWVEDV---RNERGEENLILCIVGNKSDL 130

Query: 130 EESKKLVTPKAAQELATSLGNIPLFL-TSAKSAINVDTAFEEIAR 173
            + +K+   +   E    L N  +F+ TS K+  NV   F+ IA+
Sbjct: 131 VDERKVTVEEG--ENKAKLLNAKIFVETSTKAGFNVGALFKRIAK 173

>TPHA0F02500 Chr6 complement(551815..552462) [648 bp, 215 aa] {ON}
           Anc_6.49 YLR262C
          Length = 215

 Score =  129 bits (324), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 67/165 (40%), Positives = 100/165 (60%), Gaps = 4/165 (2%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DDK   +Q+WDTAGQER
Sbjct: 12  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQER 71

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           F+SL  ++ R +   ++VYD+T  KSFE I  W ++          E     I+GNK D+
Sbjct: 72  FRSLIPSYIRDSRVAIVVYDITKKKSFEYIDKWIEDVKTE---RGSENVILCIVGNKSDL 128

Query: 130 EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARS 174
            + ++ VT +  +  A  LG      TS K+  NV   F++IA+S
Sbjct: 129 SDERQ-VTTEEGEAKAKELGATIFMETSTKAGHNVKNLFKKIAKS 172

>TDEL0C00490 Chr3 complement(75792..76418) [627 bp, 208 aa] {ON}
           Anc_8.25 YFL038C
          Length = 208

 Score =  129 bits (323), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 106/166 (63%), Gaps = 6/166 (3%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D K   +Q+WDTAGQ
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQ 67

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ERF+++  ++YRG+   ++VYDVT+ +SF  +K W  E   +A      T   +++GNK 
Sbjct: 68  ERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYA----TSTVLKLLVGNKC 123

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           D+E+ K++V    A+E A +   +P   TSA  + NV+ AF  +A+
Sbjct: 124 DLED-KRVVEYDVAREFAEA-NKMPFLETSALDSTNVEQAFLTMAK 167

>ZYRO0F02816g Chr6 complement(237904..238533) [630 bp, 209 aa] {ON}
           highly similar to uniprot|P01123 Saccharomyces
           cerevisiae YFL038C YPT1 Ras-like small GTPase involved
           in the ER-to-Golgi step of the secretory pathway complex
           formation with the Rab escort protein Mrs6p is required
           for prenylation of Ypt1p by protein
           geranylgeranyltransferase type II (Bet2p-Bet4p)
          Length = 209

 Score =  129 bits (323), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 115/198 (58%), Gaps = 9/198 (4%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D K   +Q+WDTAGQ
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVDLDGKTVKLQIWDTAGQ 67

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ERF+++  ++YRG+   ++VYDVT+ +SF  +K W  E   +A      T   +++GNK 
Sbjct: 68  ERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYA----TSTVLKLLVGNKC 123

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR---SALQQNQXXXX 184
           D+++ K++V    A+E A +   +P   TSA  + NV+ AF  +AR    ++ Q Q    
Sbjct: 124 DLKD-KRVVEYDVAKEFADA-NKMPFIETSALDSTNVEEAFLTMARQIKDSMAQQQRHDG 181

Query: 185 XXXXXXXXXINIQLDGEP 202
                     N+ L G+ 
Sbjct: 182 GAANGQNENGNVNLKGQS 199

>KAFR0A05260 Chr1 complement(1040753..1041460) [708 bp, 235 aa] {ON}
           Anc_6.49 YLR262C
          Length = 235

 Score =  129 bits (324), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 100/165 (60%), Gaps = 4/165 (2%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DDK   +Q+WDTAGQER
Sbjct: 24  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQER 83

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           F+SL  ++ R +   ++VYD+T  KSFE I  W D+     N    E     I+GNK D+
Sbjct: 84  FRSLIPSYIRDSKVAIVVYDITKKKSFEFIDKWVDDV---KNERGEENVVLCIVGNKNDL 140

Query: 130 EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARS 174
            + ++ V+ +  +  A  LG      TS K+  NV   F+ IA+S
Sbjct: 141 GDERQ-VSTEEGEAKAKKLGAKIFMETSTKAGYNVKNLFKRIAKS 184

>KNAG0G00930 Chr7 (183672..184313) [642 bp, 213 aa] {ON} Anc_8.70
           YFL005W
          Length = 213

 Score =  129 bits (323), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 104/161 (64%), Gaps = 7/161 (4%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           I+K++++GDSGVGK+ L+ R+V D+++  +  TIG DF  K V ++ K   +Q+WDTAGQ
Sbjct: 18  IMKILLVGDSGVGKSCLLVRFVEDRFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQ 77

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ERF+++  A+YRGA   +LVYDVT+ ++F NI+ W      HAN    +    +++GNK 
Sbjct: 78  ERFRTITTAYYRGAMGIILVYDVTDERTFNNIRQWFTTVTEHAN----DDAQLLLVGNKS 133

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAF 168
           D++   ++V+ +  + LA  LG +P   +SAK   NV+  F
Sbjct: 134 DMD--TRVVSREQGETLAAELG-LPFVESSAKDDDNVNEIF 171

>Kpol_1023.21 s1023 complement(39597..40220) [624 bp, 207 aa] {ON}
           complement(39597..40220) [624 nt, 208 aa]
          Length = 207

 Score =  128 bits (321), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 109/177 (61%), Gaps = 10/177 (5%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D K   +Q+WDTAGQ
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVQLDGKTVKLQIWDTAGQ 67

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ERF+++  ++YRG+   ++VYD+T+ +SF  +K W  E   +A      T   +++GNK 
Sbjct: 68  ERFRTITSSYYRGSHGIIIVYDITDQESFNGVKMWLQEIDRYA----TSTVLKLLVGNKC 123

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR----SALQQNQ 180
           D+ + K++V    A+E A +   +P   TSA  + NV+ AF  +AR    S  QQ Q
Sbjct: 124 DLND-KRVVEYDVAKEFAEA-NKMPFLETSALDSTNVEEAFLTMARQIKESISQQQQ 178

>KNAG0E02720 Chr5 (541478..542173) [696 bp, 231 aa] {ON} 
          Length = 231

 Score =  128 bits (322), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 67/165 (40%), Positives = 101/165 (61%), Gaps = 4/165 (2%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DD     Q+WDTAGQER
Sbjct: 18  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDHTIRFQLWDTAGQER 77

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           F+SL  ++ R +   ++VYD+T  KSFE I  W ++     N  S +   F I+GNK D+
Sbjct: 78  FRSLIPSYIRDSRVAIVVYDITKKKSFEYIDKWVEDV---KNERSADNVIFCIVGNKSDL 134

Query: 130 EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARS 174
            + +++ T +  Q+    LG      TS K+  NV   F++IA+S
Sbjct: 135 TDERQVSTEEGEQKTKV-LGAQIFMETSTKAGYNVKNLFKKIAKS 178

>SAKL0E02090g Chr5 complement(160194..160838) [645 bp, 214 aa] {ON}
           highly similar to uniprot|Q99260 Saccharomyces
           cerevisiae YLR262C YPT6 Ras-like GTP binding protein
           involved in the secretory pathway, required for fusion
           of endosome-derived vesicles with the late Golgi; has
           similarity to the human GTPase, Rab6
          Length = 214

 Score =  128 bits (321), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 68/166 (40%), Positives = 104/166 (62%), Gaps = 6/166 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DDK   +Q+WDTAGQER
Sbjct: 14  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQER 73

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           F+SL  ++ R +   ++VYDVTN KSFE I  W ++     +    E     I+GNK D+
Sbjct: 74  FRSLIPSYIRDSHVAIVVYDVTNKKSFEYIDKWIEDV---KSERGEENVILCIVGNKNDL 130

Query: 130 EESKKLVTPKAAQELATSLGNIPLFL-TSAKSAINVDTAFEEIARS 174
            + +++ T +   E    + N  +F+ TS K+  NV   F++IA+S
Sbjct: 131 VDERQVSTEEG--ERKAQVLNAKIFMETSTKAGFNVKNLFKKIAKS 174

>Kwal_56.22555 s56 complement(178575..179213) [639 bp, 212 aa] {ON}
           YLR262C (YPT6) - highly homologous to the human GTPase,
           Rab6 [contig 185] FULL
          Length = 212

 Score =  128 bits (321), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 103/166 (62%), Gaps = 6/166 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DDK   +Q+WDTAGQER
Sbjct: 14  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQER 73

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           F+SL  ++ R +   ++VYDVTN KSFE I  W ++     +    E     I+GNK D+
Sbjct: 74  FRSLIPSYIRDSHVAIVVYDVTNKKSFEYIDKWVEDV---KSERGEENVVLCIVGNKNDL 130

Query: 130 EESKKLVTPKAAQELATSLGNIPLFL-TSAKSAINVDTAFEEIARS 174
            + +++ T +   E    + N  +F+ TS K+  NV   F +IA++
Sbjct: 131 SDERQVSTEEG--ERKAQVLNAKIFIETSTKAGFNVKNLFRKIAKT 174

>ZYRO0C07062g Chr3 (532175..532819) [645 bp, 214 aa] {ON} highly
           similar to uniprot|Q99260 Saccharomyces cerevisiae
           YLR262C YPT6 Ras-like GTP binding protein involved in
           the secretory pathway, required for fusion of
           endosome-derived vesicles with the late Golgi; has
           similarity to the human GTPase, Rab6
          Length = 214

 Score =  128 bits (321), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 67/165 (40%), Positives = 100/165 (60%), Gaps = 4/165 (2%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DDK   +Q+WDTAGQER
Sbjct: 14  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQER 73

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           F+SL  ++ R +   ++VYD+T  KSFE I  W ++     N    E     I+GNK D+
Sbjct: 74  FRSLIPSYIRDSRVAIVVYDITKRKSFEFIDKWIEDV---KNERGEENVILCIVGNKSDL 130

Query: 130 EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARS 174
            + +++ T +   + A  LG      TS K+  NV   F+ IA+S
Sbjct: 131 SDERQVSTEEGETK-AKVLGAKIFMETSTKAGYNVKNLFKRIAKS 174

>TPHA0D00270 Chr4 complement(37369..37992) [624 bp, 207 aa] {ON}
           Anc_8.25 YFL038C
          Length = 207

 Score =  127 bits (320), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 105/166 (63%), Gaps = 6/166 (3%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D K   +Q+WDTAGQ
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQ 67

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ERF+++  ++YRG+   ++VYDVT+ +SF ++K W  E   +A      T   +++GNK 
Sbjct: 68  ERFRTITSSYYRGSHGIIIVYDVTDQESFNSVKMWLQEIDRYA----TSTVLKLLVGNKS 123

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           D+ + K++V    A+E A     +P   TSA  + NV+ AF  +AR
Sbjct: 124 DMTD-KRVVEYDVAKEFAEQ-NKMPFLETSALDSTNVEEAFLTMAR 167

>NCAS0C03710 Chr3 complement(747168..747803) [636 bp, 211 aa] {ON}
           Anc_8.25
          Length = 211

 Score =  127 bits (320), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 105/166 (63%), Gaps = 6/166 (3%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++G+SGVGK+ L+ R+ +D Y+  Y +TIG DF  K V +D K   +Q+WDTAGQ
Sbjct: 8   LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQ 67

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ERF+++  ++YRG+   ++VYDVT+  SF  +K W  E   +A      T   +++GNK 
Sbjct: 68  ERFRTITSSYYRGSHGIIIVYDVTDQDSFNGVKMWLQEIDRYA----TSTVLKLLVGNKC 123

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           D+ + K++V    A+E A +   +P   TSA ++ NV+ AF  +AR
Sbjct: 124 DLTD-KRVVEYDVAKEFADA-NKMPFLETSALNSTNVEEAFLTMAR 167

>Ecym_3137 Chr3 (254058..254723) [666 bp, 221 aa] {ON} similar to
           Ashbya gossypii AGR257C
          Length = 221

 Score =  127 bits (320), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 67/165 (40%), Positives = 101/165 (61%), Gaps = 6/165 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K V +DD+   +Q+WDTAGQER
Sbjct: 14  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTVYLDDRNIRLQLWDTAGQER 73

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           F+SL  ++ R +   ++VYDVTN +SFE I  W ++          E     I+GNK D+
Sbjct: 74  FRSLIPSYIRDSHVAIVVYDVTNKRSFEYIDKWVEDVKTE---RGEENLILCIVGNKNDL 130

Query: 130 EESKKLVTPKAAQELATSLGNIPLFL-TSAKSAINVDTAFEEIAR 173
            + + + T +   E+   L N  +F+ TS K+  NV   F+ IA+
Sbjct: 131 VDERSVSTKEG--EMKAQLLNAKIFMETSTKAGFNVKQLFKSIAK 173

>KLTH0C10384g Chr3 (861122..861826) [705 bp, 234 aa] {ON} highly
           similar to uniprot|Q99260 Saccharomyces cerevisiae
           YLR262C YPT6 Ras-like GTP binding protein involved in
           the secretory pathway, required for fusion of
           endosome-derived vesicles with the late Golgi; has
           similarity to the human GTPase, Rab6
          Length = 234

 Score =  127 bits (319), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 102/166 (61%), Gaps = 6/166 (3%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DDK   +Q+WDTAGQER
Sbjct: 35  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQER 94

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           F+SL  ++ R +   ++VYDVTN KSFE I  W ++     +    E     I+GNK D+
Sbjct: 95  FRSLIPSYIRDSHVAIVVYDVTNKKSFEYIDKWVEDV---KSERGEENVVLCIVGNKNDL 151

Query: 130 EESKKLVTPKAAQELATSLGNIPLFL-TSAKSAINVDTAFEEIARS 174
            + +++ T +   E    + N  +F+ TS K   NV   F +IA++
Sbjct: 152 SDERQVSTEEG--ERKAQVLNAKIFIETSTKVGFNVKNLFRKIAKT 195

>NCAS0D02500 Chr4 (474037..474705) [669 bp, 222 aa] {ON} Anc_6.49
          Length = 222

 Score =  127 bits (318), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 67/165 (40%), Positives = 101/165 (61%), Gaps = 4/165 (2%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DDK   +Q+WDTAGQER
Sbjct: 12  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQER 71

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           F+SL  ++ R +   ++VYD+T  KSFE I  W ++     N    +     I+GNK D+
Sbjct: 72  FRSLIPSYIRDSRVAIVVYDITKKKSFEYIDKWIEDV---KNERGDDNVILCIVGNKSDL 128

Query: 130 EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARS 174
            + ++ VT +  +  A  LG      TS K+  NV   F++IA+S
Sbjct: 129 SDERQ-VTIEEGENKAKILGADIFMETSTKAGYNVKNLFKKIAKS 172

>TBLA0E03190 Chr5 complement(803935..804558) [624 bp, 207 aa] {ON}
           Anc_6.49 YLR262C
          Length = 207

 Score =  126 bits (317), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 115/211 (54%), Gaps = 8/211 (3%)

Query: 1   MSFRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQ 60
           MS +     K++ LG+ GVGKTSL+ R++ D + + Y+ATIG DFL+K + +DDK   +Q
Sbjct: 1   MSNKTLTKYKIVFLGEQGVGKTSLITRFMYDTFDEHYQATIGIDFLSKTMYLDDKTIRLQ 60

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPF 120
           +WDTAGQERF+SL  ++ R +   ++VYD+T  KSFE I  W  +     N    +    
Sbjct: 61  LWDTAGQERFRSLIPSYIRDSRVAIVVYDITKKKSFEYIDKWIQDV---KNERGDDGVIL 117

Query: 121 VILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQ-QN 179
            I+GNK D+ + ++ V+ +  +  A  LG      TS K+  NV   F++IA+S  + +N
Sbjct: 118 CIVGNKSDLSDQRQ-VSNEEGENKAKLLGADIFMETSTKAGYNVKNLFKKIAKSLPEFEN 176

Query: 180 QXXXXXXXXXXXXXINIQLDGEPN---SCSC 207
                         I+I  + EP     C C
Sbjct: 177 TEGNPLENEERAGVIDIGENEEPKQEAGCQC 207

>TDEL0G04210 Chr7 (764766..765434) [669 bp, 222 aa] {ON} Anc_6.49
           YLR262C
          Length = 222

 Score =  126 bits (317), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 67/165 (40%), Positives = 101/165 (61%), Gaps = 4/165 (2%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DDK   +Q+WDTAGQER
Sbjct: 14  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQER 73

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           F+SL  ++ R +   ++VYD+T  KSFE I  W ++     N    E     I+GNK D+
Sbjct: 74  FRSLIPSYIRDSRVAIVVYDITKKKSFEFIDKWIEDV---KNERGEENVILCIVGNKSDL 130

Query: 130 EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARS 174
            + ++ V+ +  +  A  LG      TS K+  NV   F++IA+S
Sbjct: 131 ADERQ-VSTEEGEAKAKLLGAKIFMETSTKAGHNVKNLFKKIAKS 174

>Kpol_1042.2 s1042 complement(4659..5303) [645 bp, 214 aa] {ON}
           complement(4659..5303) [645 nt, 215 aa]
          Length = 214

 Score =  125 bits (314), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 64/165 (38%), Positives = 102/165 (61%), Gaps = 4/165 (2%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DDK   +Q+WDTAGQER
Sbjct: 12  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQER 71

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           F+SL  ++ R +   ++VYD+T  KSF+ I  W ++     N    +     ++GNK D+
Sbjct: 72  FRSLIPSYIRDSRVAIVVYDITKKKSFDCIDKWIEDV---KNERGEDNVILCVVGNKSDL 128

Query: 130 EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARS 174
            + ++ V+ +  ++ A  LG      TS K+  NV   F++IA+S
Sbjct: 129 TDERQ-VSTEDGEKKAKELGAKIFMETSTKAGYNVKNLFKKIAKS 172

>NDAI0I02380 Chr9 complement(542975..543643) [669 bp, 222 aa] {ON} 
          Length = 222

 Score =  124 bits (311), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 101/165 (61%), Gaps = 4/165 (2%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++ LG+ GVGKTSL+ R++ D +   Y+ATIG DFL+K + +DDK   +Q+WDTAGQER
Sbjct: 12  KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQER 71

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           F+SL  ++ R +   ++VYD+T  +SF+ I  W ++     N    +     I+GNK D+
Sbjct: 72  FRSLIPSYIRDSRVAIVVYDITKKESFDFIDKWINDV---KNERGEDNVILCIVGNKNDL 128

Query: 130 EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARS 174
            + ++ V+ +  +  A  LG      TS K+  NV T F+ IA+S
Sbjct: 129 TDQRQ-VSIEEGENKAKQLGANIFMETSTKAGYNVKTLFKRIAKS 172

>KLLA0D02376g Chr4 (201512..202135) [624 bp, 207 aa] {ON} similar to
           uniprot|P36018 Saccharomyces cerevisiae YKR014C YPT52
           rab5-like GTPase involved in vacuolar protein sorting
           and endocytosis probable purine nucleotide- binding
           protein
          Length = 207

 Score =  121 bits (304), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 110/206 (53%), Gaps = 11/206 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV----DDKVATMQVWDT 64
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +    D++V   ++WDT
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWDT 63

Query: 65  AGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILG 124
           AGQER++SL   +YR A+  ++VYDVT   S    K W DE     N    +     ++G
Sbjct: 64  AGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVN---DDKLIICLVG 120

Query: 125 NKVDV---EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQNQX 181
           NK+D+    ES  LV    A+E A    N+     SAK+  NV   F++I      QN+ 
Sbjct: 121 NKLDLVSERESTSLVDEADAREFAQE-NNLLFHQVSAKTGENVIKVFQDIGERLYLQNKD 179

Query: 182 XXXXXXXXXXXXINIQLDGEPNSCSC 207
                       I++Q     +S SC
Sbjct: 180 KIQESKKPNNNNISLQRPSTNDSQSC 205

>AER434C Chr5 complement(1466442..1467052,1467106..1467154) [660 bp,
           219 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YGL210W (YPT32) and YER031C (YPT31); 1-intron
          Length = 219

 Score =  120 bits (302), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 105/171 (61%), Gaps = 8/171 (4%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++GDSGVGK++L+ R+  D+++   K+TIG +F T+ + V+ K    Q+WDTAGQ
Sbjct: 14  LFKIVLIGDSGVGKSNLLSRFTTDEFNVNSKSTIGVEFATRTIEVEGKKVKAQIWDTAGQ 73

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    E     ++GNK 
Sbjct: 74  ERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENAD----ENVAVGLIGNKS 129

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFL-TSAKSAINVDTAFEEIARSALQ 177
           D+   + + T +A      + GN  LF  TSA +A NVD AF E+  +  Q
Sbjct: 130 DLAHLRAVPTDEAKN---FAQGNQMLFTETSALNAENVDLAFRELITAIYQ 177

>TBLA0C02780 Chr3 complement(668605..669267) [663 bp, 220 aa] {ON}
           Anc_1.289 YKR014C
          Length = 220

 Score =  120 bits (302), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 104/168 (61%), Gaps = 8/168 (4%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDK-VATMQVWDTAGQ 67
            K+++LGDS VGK+S+++R+V D + +  ++TIGA FL++ +T+ +K V   ++WDTAGQ
Sbjct: 4   FKLVLLGDSSVGKSSIVNRFVKDSFDELRESTIGAAFLSQTITLKNKTVIKFEIWDTAGQ 63

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ER++SL   +YR A+  ++VYD+T N S    ++W DE          E     ++GNK+
Sbjct: 64  ERYKSLAPMYYRNANAALVVYDITENDSLMKAQSWVDELKSKV---GDENLVICLVGNKI 120

Query: 128 DV---EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIA 172
           D+   +ESK++V  K A++ A    N+  +  SAKS  NV   F+ I 
Sbjct: 121 DLCDEDESKRVVLTKDAKDYADE-QNLMFYEVSAKSGENVKEVFQVIG 167

>Ecym_1207 Chr1 (420728..420773,421159..421766) [654 bp, 217 aa]
           {ON} similar to Ashbya gossypii AER434C  1-intron
          Length = 217

 Score =  119 bits (299), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 66/174 (37%), Positives = 106/174 (60%), Gaps = 14/174 (8%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++GDSGVGK++L+ R+  D+++   K+TIG +F T+ + V+ K    Q+WDTAGQ
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTDEFNVNSKSTIGVEFATRTIEVEGKKVKAQIWDTAGQ 72

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    E     ++GNK 
Sbjct: 73  ERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLAELRENAD----ENVAVGLIGNKS 128

Query: 128 DVEESKKLVTPKA---AQELATSLGNIPLFL-TSAKSAINVDTAFEEIARSALQ 177
           D+   + + T +A   AQE      N  LF  TSA +A NVD AF E+  +  Q
Sbjct: 129 DLAHLRAVPTDEAKNYAQE------NQMLFTETSALNAENVDLAFRELITAIYQ 176

>Smik_5.154 Chr5 complement(218975..219646) [672 bp, 223 aa] {ON}
           YER031C (REAL)
          Length = 223

 Score =  119 bits (299), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 64/175 (36%), Positives = 108/175 (61%), Gaps = 14/175 (8%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++GDSGVGK++L+ R+  ++++   K+TIG +F T+ + +D K    Q+WDTAGQ
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKAQIWDTAGQ 72

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    +     ++GNK 
Sbjct: 73  ERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENAD----DNVAVGLIGNKS 128

Query: 128 DVEESKKLVTPKA---AQELATSLGNIPLFL-TSAKSAINVDTAFEEIARSALQQ 178
           D+   + + T +A   AQE      N  LF  TSA ++ NVD AFEE+  +  Q+
Sbjct: 129 DLAHLRAVPTEEAKTFAQE------NQLLFTETSALNSENVDKAFEELINTIYQK 177

>Kpol_423.12 s423 (26761..27423) [663 bp, 220 aa] {ON}
           (26761..27423) [663 nt, 221 aa]
          Length = 220

 Score =  119 bits (298), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 66/174 (37%), Positives = 105/174 (60%), Gaps = 14/174 (8%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++GDSGVGK++L+ R+  D++  + K+TIG +F T+ + VD K    Q+WDTAGQ
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTDEFHLESKSTIGVEFATRTIDVDGKKIKAQIWDTAGQ 72

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ER++++  A+YRGA   ++VYD++   S+EN   W  E   +A+    +     ++GNK 
Sbjct: 73  ERYRAITSAYYRGAVGALIVYDISKQSSYENCNHWLAELRENAD----DNVAVGLIGNKS 128

Query: 128 DVEESKKLVTPKA---AQELATSLGNIPLFL-TSAKSAINVDTAFEEIARSALQ 177
           D+   + + T +A   AQE      N  LF  TSA ++ NVD AF E+  S  Q
Sbjct: 129 DLSHLRAVPTDEAKKFAQE------NQLLFTETSALNSENVDQAFRELITSIYQ 176

>KAFR0A03560 Chr1 (729254..729877) [624 bp, 207 aa] {ON} Anc_1.289
           YKR014C
          Length = 207

 Score =  119 bits (297), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 65/173 (37%), Positives = 105/173 (60%), Gaps = 13/173 (7%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDK----VATMQVWDT 64
            K+++LGDS VGK+S+++R+V D +    ++TIGA FL++ + ++D     +   ++WDT
Sbjct: 4   FKLVLLGDSSVGKSSIVNRFVKDSFEDLRESTIGAAFLSQTIKLNDNGKEVIVKFEIWDT 63

Query: 65  AGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILG 124
           AGQER++SL   +YR A+  ++VYD+T   S    KTW +E     N    +     ++G
Sbjct: 64  AGQERYKSLAPMYYRNANAALVVYDITELDSLNKAKTWVEEL---KNKVGDDNIVIYLVG 120

Query: 125 NKVDV---EESKKLVTPKAAQELATSLGNIPLFL-TSAKSAINVDTAFEEIAR 173
           NK+DV   + SK+LV+ + A+E A   G   LF+ TSAK+  N+   F+EI  
Sbjct: 121 NKLDVCEKDSSKRLVSLEGAKEYAKEQG--LLFIETSAKTGANIKETFQEIGE 171

>Suva_7.51 Chr7 (90232..90897) [666 bp, 221 aa] {ON} YGL210W (REAL)
          Length = 221

 Score =  119 bits (298), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 107/171 (62%), Gaps = 8/171 (4%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++GDSGVGK++L+ R+  D+++ + K+TIG +F T+ + V+DK    Q+WDTAGQ
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVEDKKIKAQIWDTAGQ 72

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    +     ++GNK 
Sbjct: 73  ERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENAD----DNVAVGLIGNKS 128

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFL-TSAKSAINVDTAFEEIARSALQ 177
           D+   + + T +A      ++ N  LF  TSA ++ NVD AF E+  +  Q
Sbjct: 129 DLAHLRAVPTDEARN---FAMENQMLFTETSALNSDNVDKAFRELIVAIFQ 176

>YOR089C Chr15 complement(490196..490828) [633 bp, 210 aa] {ON}
           VPS21Rab family GTPase required for endocytic transport
           and for sorting of vacuolar hydrolases; localized in
           endocytic intermediates; detected in mitochondria;
           geranylgeranylation required for membrane association;
           mammalian Rab5 homolog
          Length = 210

 Score =  118 bits (296), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 70/208 (33%), Positives = 117/208 (56%), Gaps = 14/208 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ VT+++     ++WDTAGQE
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTVKFEIWDTAGQE 67

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           RF SL   +YR A   ++VYDVT  +SF   + W  E  +H   S  +     ++GNK+D
Sbjct: 68  RFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKE--LHEQAS--KDIIIALVGNKID 123

Query: 129 V--EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIA-----RSALQQNQX 181
           +  E  ++ V  +  ++LA   G +  F TSAK+  NV+  F  I      ++A +QN  
Sbjct: 124 MLQEGGERKVAREEGEKLAEEKG-LLFFETSAKTGENVNDVFLGIGEKIPLKTAEEQNSA 182

Query: 182 XXXXXXXXXXXXINIQLDGEP--NSCSC 207
                       +N   DG    ++CSC
Sbjct: 183 SNERESNNQRVDLNAANDGTSANSACSC 210

>Suva_5.128 Chr5 complement(190103..190774) [672 bp, 223 aa] {ON}
           YER031C (REAL)
          Length = 223

 Score =  118 bits (296), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 108/175 (61%), Gaps = 14/175 (8%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++GDSGVGK++L+ R+  ++++   K+TIG +F T+ + +D K    Q+WDTAGQ
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKAQIWDTAGQ 72

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    +     ++GNK 
Sbjct: 73  ERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENAD----DNVAVGLIGNKS 128

Query: 128 DVEESKKLVTPKA---AQELATSLGNIPLFL-TSAKSAINVDTAFEEIARSALQQ 178
           D+   + + T ++   AQE      N  LF  TSA ++ NVD AFEE+  +  Q+
Sbjct: 129 DLAHLRAVPTEESKTFAQE------NQLLFTETSALNSENVDKAFEELINTIYQK 177

>Skud_5.140 Chr5 complement(211975..212646) [672 bp, 223 aa] {ON}
           YER031C (REAL)
          Length = 223

 Score =  118 bits (296), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 108/175 (61%), Gaps = 14/175 (8%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++GDSGVGK++L+ R+  ++++   K+TIG +F T+ + +D K    Q+WDTAGQ
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKAQIWDTAGQ 72

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    +     ++GNK 
Sbjct: 73  ERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENAD----DNVAVGLIGNKS 128

Query: 128 DVEESKKLVTPKA---AQELATSLGNIPLFL-TSAKSAINVDTAFEEIARSALQQ 178
           D+   + + T ++   AQE      N  LF  TSA ++ NVD AFEE+  +  Q+
Sbjct: 129 DLAHLRAVPTEESKTFAQE------NQLLFTETSALNSENVDEAFEELINTIYQK 177

>YER031C Chr5 complement(214076..214747) [672 bp, 223 aa] {ON}
           YPT31Rab family GTPase, very similar to Ypt32p; involved
           in the exocytic pathway; mediates intra-Golgi traffic or
           the budding of post-Golgi vesicles from the trans-Golgi
          Length = 223

 Score =  118 bits (296), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 108/175 (61%), Gaps = 14/175 (8%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++GDSGVGK++L+ R+  ++++   K+TIG +F T+ + +D K    Q+WDTAGQ
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKAQIWDTAGQ 72

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    +     ++GNK 
Sbjct: 73  ERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENAD----DNVAVGLIGNKS 128

Query: 128 DVEESKKLVTPKA---AQELATSLGNIPLFL-TSAKSAINVDTAFEEIARSALQQ 178
           D+   + + T ++   AQE      N  LF  TSA ++ NVD AFEE+  +  Q+
Sbjct: 129 DLAHLRAVPTEESKTFAQE------NQLLFTETSALNSENVDKAFEELINTIYQK 177

>SAKL0F01914g Chr6 (162387..162432,162627..163246) [666 bp, 221 aa]
           {ON} highly similar to uniprot|P51996 Saccharomyces
           cerevisiae YGL210W YPT32 probably involved in
           intra-Golgi transport or in the formation of transport
           vesicles at the most distal Golgi compartment ras-like
           GTPase highly homologous to YPT31
          Length = 221

 Score =  117 bits (294), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 64/174 (36%), Positives = 107/174 (61%), Gaps = 14/174 (8%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + V+ K    Q+WDTAGQ
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNMESKSTIGVEFATRTIEVEGKKIKAQIWDTAGQ 72

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    E     ++GNK 
Sbjct: 73  ERYRAITSAYYRGAVGALIVYDISKSNSYENCNHWLTELRENAD----ENVAVGLIGNKS 128

Query: 128 DVEESKKLVTPKA---AQELATSLGNIPLFL-TSAKSAINVDTAFEEIARSALQ 177
           D+   + + T +A   AQE      N  LF  TSA ++ NVD AF E+  +  Q
Sbjct: 129 DLAHLRAVPTDEAKNFAQE------NQLLFTETSALNSENVDLAFRELITAIYQ 176

>KLTH0G01760g Chr7 (132121..132166,132307..132917) [657 bp, 218 aa]
           {ON} highly similar to uniprot|P51996 Saccharomyces
           cerevisiae YGL210W YPT32 probably involved in
           intra-Golgi transport or in the formation of transport
           vesicles at the most distal Golgi compartment; ras-like
           GTPase, highly homologous to YPT31
          Length = 218

 Score =  117 bits (293), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 64/174 (36%), Positives = 107/174 (61%), Gaps = 14/174 (8%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + V+ K    Q+WDTAGQ
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNMESKSTIGVEFATRTIEVEGKKIKAQIWDTAGQ 72

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    E     ++GNK 
Sbjct: 73  ERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENAD----ENVAVGLIGNKS 128

Query: 128 DVEESKKLVTPKA---AQELATSLGNIPLFL-TSAKSAINVDTAFEEIARSALQ 177
           D+   + + T +A   AQE      N  LF  TSA ++ NVD AF E+  +  Q
Sbjct: 129 DLAHLRAVPTDEAKNFAQE------NQLLFTETSALNSENVDQAFRELITAIYQ 176

>YGL210W Chr7 (93792..94460) [669 bp, 222 aa] {ON}  YPT32Rab family
           GTPase, very similar to Ypt31p; involved in the exocytic
           pathway; mediates intra-Golgi traffic or the budding of
           post-Golgi vesicles from the trans-Golgi
          Length = 222

 Score =  117 bits (293), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 61/171 (35%), Positives = 107/171 (62%), Gaps = 8/171 (4%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++GDSGVGK++L+ R+  D+++ + K+TIG +F T+ + V++K    Q+WDTAGQ
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKAQIWDTAGQ 72

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    +     ++GNK 
Sbjct: 73  ERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENAD----DNVAVGLIGNKS 128

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFL-TSAKSAINVDTAFEEIARSALQ 177
           D+   + + T +A      ++ N  LF  TSA ++ NVD AF E+  +  Q
Sbjct: 129 DLAHLRAVPTDEAKN---FAMENQMLFTETSALNSDNVDKAFRELIVAIFQ 176

>Smik_7.53 Chr7 (88592..89260) [669 bp, 222 aa] {ON} YGL210W (REAL)
          Length = 222

 Score =  117 bits (293), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 61/171 (35%), Positives = 107/171 (62%), Gaps = 8/171 (4%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++GDSGVGK++L+ R+  D+++ + K+TIG +F T+ + V++K    Q+WDTAGQ
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKAQIWDTAGQ 72

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    +     ++GNK 
Sbjct: 73  ERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENAD----DNVAVGLIGNKS 128

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFL-TSAKSAINVDTAFEEIARSALQ 177
           D+   + + T +A      ++ N  LF  TSA ++ NVD AF E+  +  Q
Sbjct: 129 DLAHLRAVPTDEAKN---FAMENQMLFTETSALNSDNVDRAFRELIIAIFQ 176

>Skud_7.58 Chr7 (99129..99797) [669 bp, 222 aa] {ON} YGL210W (REAL)
          Length = 222

 Score =  117 bits (293), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 61/171 (35%), Positives = 107/171 (62%), Gaps = 8/171 (4%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++GDSGVGK++L+ R+  D+++ + K+TIG +F T+ + V++K    Q+WDTAGQ
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKAQIWDTAGQ 72

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    +     ++GNK 
Sbjct: 73  ERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENAD----DNVAVGLIGNKS 128

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFL-TSAKSAINVDTAFEEIARSALQ 177
           D+   + + T +A      ++ N  LF  TSA ++ NVD AF E+  +  Q
Sbjct: 129 DLAHLRAVPTDEAKN---FAMENQMLFTETSALNSDNVDRAFRELIVAIFQ 176

>TPHA0D03430 Chr4 complement(719751..720422) [672 bp, 223 aa] {ON}
           Anc_3.521 YER031C
          Length = 223

 Score =  117 bits (293), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 64/174 (36%), Positives = 106/174 (60%), Gaps = 14/174 (8%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++GDSGVGK++L+ R+  + ++ + K+TIG +F T+ + V++K    Q+WDTAGQ
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNDFNLESKSTIGVEFATRTIEVENKKIKAQIWDTAGQ 72

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ER++++  A+YRGA   ++VYD++   S+EN   W  E   +A+    +     ++GNK 
Sbjct: 73  ERYRAITSAYYRGAVGALIVYDISKQSSYENCNHWLTELRENAD----DNVAVGLIGNKS 128

Query: 128 DVEESKKLVTPKA---AQELATSLGNIPLFL-TSAKSAINVDTAFEEIARSALQ 177
           D+   + + T +A   AQE      N  LF  TSA ++ NVD AF E+  S  Q
Sbjct: 129 DLSHLRAVPTEEAKNFAQE------NQLLFTETSALNSENVDQAFRELITSIYQ 176

>CAGL0C02453g Chr3 (247493..248149) [657 bp, 218 aa] {ON} highly
           similar to uniprot|P38555 Saccharomyces cerevisiae
           YER031c YPT31
          Length = 218

 Score =  116 bits (291), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 107/172 (62%), Gaps = 8/172 (4%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++GDSGVGK++L+ R+  ++++   K+TIG +F T+ + VD K    Q+WDTAGQ
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNIDSKSTIGVEFATRTIDVDGKKIKAQIWDTAGQ 72

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ER++++  A+YRGA   ++VYD++ + S+EN   W  E   +A+    +     ++GNK 
Sbjct: 73  ERYRAITSAYYRGAVGALIVYDISKSSSYENCHHWLSELRENAD----DNVAVGLIGNKS 128

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFL-TSAKSAINVDTAFEEIARSALQQ 178
           D+   + + T +A Q  +    N  LF  TSA ++ NVD AF+E+  +  Q+
Sbjct: 129 DLAHLRAVPTEEAKQFASE---NQLLFTETSALNSDNVDLAFKELITAIHQK 177

>TPHA0P00950 Chr16 complement(193256..193897) [642 bp, 213 aa] {ON}
           Anc_2.196 YNL093W
          Length = 213

 Score =  116 bits (290), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 99/164 (60%), Gaps = 9/164 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
           +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V +DD     ++WDTAGQE
Sbjct: 8   VKLVLLGEAAVGKSSIVVRFVSNDFSENKEPTIGAAFLTQRVNIDDHTIKFEIWDTAGQE 67

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           RF SL   +YR A   ++VYDVT  +SF   + W  E  +H   S        + GNKVD
Sbjct: 68  RFASLAPMYYRNAQAALIVYDVTKPQSFIKARHWVKE--LHEQASG--DIVIALAGNKVD 123

Query: 129 V----EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAF 168
           +     E+++ V  +  Q+LA    N+  F TSAK+  NV+  F
Sbjct: 124 LIEENGENERKVATEEGQKLADE-ENLLFFETSAKTGYNVNEIF 166

>Kpol_1029.16 s1029 (30724..31359) [636 bp, 211 aa] {ON}
           (30724..31359) [636 nt, 212 aa]
          Length = 211

 Score =  115 bits (288), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 97/162 (59%), Gaps = 7/162 (4%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
           +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V +DD     ++WDTAGQE
Sbjct: 8   VKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNIDDHTVKFEIWDTAGQE 67

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           RF SL   +YR A   ++VYDV+  +SF   + W  E    A+          + GNKVD
Sbjct: 68  RFASLAPMYYRNAQAALVVYDVSKPQSFIKARHWVKELQERAS----SDIIIALAGNKVD 123

Query: 129 VEE--SKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAF 168
           + E   ++ V  +  Q+LA   G +  F TSAK+  NV+  F
Sbjct: 124 IVEDGGERKVATEEGQKLADEEG-LLFFETSAKTGQNVNEVF 164

>CAGL0K09394g Chr11 complement(930063..930728) [666 bp, 221 aa] {ON}
           highly similar to uniprot|P51996 Saccharomyces
           cerevisiae YGL210w YPT32 or uniprot|P38555 Saccharomyces
           cerevisiae YER031c YPT31
          Length = 221

 Score =  115 bits (289), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 59/166 (35%), Positives = 105/166 (63%), Gaps = 10/166 (6%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + V+DK    Q+WDTAGQ
Sbjct: 14  LFKIVLIGDSGVGKSNLLSRFTTNEFNLESKSTIGVEFATRTIKVEDKKIKAQIWDTAGQ 73

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ER++++  A+YRGA   ++VYD++ + ++EN   W  E   +A+    +     ++GNK 
Sbjct: 74  ERYRAITSAYYRGAVGALIVYDISKSGTYENCNHWLTELKENAD----DNVAIGLIGNKS 129

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFL--TSAKSAINVDTAFEEI 171
           D+E  + + T +A    + +     LF   TSA ++ NVD AF E+
Sbjct: 130 DLEHLRAVPTEEARGFASEN----QLFFTETSALNSENVDLAFREL 171

>TBLA0C04910 Chr3 complement(1193590..1194285) [696 bp, 231 aa] {ON}
           Anc_3.521 YER031C
          Length = 231

 Score =  115 bits (289), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 107/174 (61%), Gaps = 14/174 (8%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + V+ K    Q+WDTAGQ
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNLESKSTIGVEFATRTIEVEGKKIKAQIWDTAGQ 72

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ER++++  A+YRGA   ++VYD++   S+EN + W  E   +A+ +        ++GNK 
Sbjct: 73  ERYRAITSAYYRGAVGALIVYDISKPSSYENCQHWLTELRGNADAN----VAVGLIGNKS 128

Query: 128 DVEESKKLVTPKA---AQELATSLGNIPLFL-TSAKSAINVDTAFEEIARSALQ 177
           D++  + + T +A   AQE      N  LF  TSA  + NVD AF E+  +  Q
Sbjct: 129 DLDHMRAVPTDEAKNFAQE------NQLLFTETSALQSSNVDQAFRELITAIYQ 176

>KLLA0C13728g Chr3 (1173329..1173955) [627 bp, 208 aa] {ON} highly
           similar to uniprot|P36017 Saccharomyces cerevisiae
           YOR089C VPS21 Rab5-like GTPase involved in vacuolar
           protein sorting and endocytosis post vesicle
           internalization geranylgeranylated geranylgeranylation
           required for membrane association
          Length = 208

 Score =  115 bits (287), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 110/207 (53%), Gaps = 14/207 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ V + D     ++WDTAGQE
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNMADHTIKFEIWDTAGQE 67

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           RF SL   +YR A   ++VYDVT  +SF   + W  E  +H   S  +     ++GNK+D
Sbjct: 68  RFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKE--LHEQAS--KGIVIALVGNKMD 123

Query: 129 VEESKKLVTPKAAQELATSLG---NIPLFLTSAKSAINVDTAFEEIARSALQQNQXXXXX 185
           + ES++    K A+E A  L    N+  F TSAK+  NV+  F  I      +       
Sbjct: 124 LLESEE--DRKVAKEEAEKLSQEENLLFFETSAKTGDNVNEVFLAIGEKIPLKKSDGSNT 181

Query: 186 XXXXXXXXINIQLD-----GEPNSCSC 207
                     I L+       PNSC C
Sbjct: 182 DGLRGTEDGRIDLNKPDDTSNPNSCGC 208

>Suva_8.142 Chr8 complement(247554..248183) [630 bp, 209 aa] {ON}
           YOR089C (REAL)
          Length = 209

 Score =  114 bits (286), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 102/162 (62%), Gaps = 7/162 (4%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ VT+++     ++WDTAGQE
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTVKFEIWDTAGQE 67

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           RF SL   +YR A   ++VYDVT  +SF   + W  E  +H   S  +     ++GNK+D
Sbjct: 68  RFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKE--LHEQAS--KDIIIALVGNKID 123

Query: 129 V--EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAF 168
           +  E+ ++ V  +  ++LA   G +  F TSAK+  NV+  F
Sbjct: 124 MLQEDGERKVAREEGEKLAEENG-LLFFETSAKTGENVNNVF 164

>Smik_14.234 Chr14 (430086..430748) [663 bp, 220 aa] {ON} YNL093W
           (REAL)
          Length = 220

 Score =  114 bits (286), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 99/170 (58%), Gaps = 10/170 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
           +K+++LG+S VGK+S++ R+V+D + +  + TIGA FLTK +  DDKV   ++WDTAGQE
Sbjct: 13  IKLVLLGESAVGKSSIVLRFVSDDFRESREPTIGAAFLTKRIIRDDKVIKFEIWDTAGQE 72

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           RF  L   +YR A   ++V+DVT++ SF   + W  E  +H  V   +     ++GNK+D
Sbjct: 73  RFAPLAPMYYRNAQAALVVFDVTDDGSFHKAQDWIQE--LHEKVG--DNIVIALVGNKID 128

Query: 129 V-----EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           +     E S + V     Q L     N+  F  SAK+  N+   F+++ +
Sbjct: 129 LLNIQGENSNRAVKEAELQNLCKR-ENLLYFEASAKTGENIHEIFQKLGQ 177

>Skud_15.253 Chr15 complement(446672..447301) [630 bp, 209 aa] {ON}
           YOR089C (REAL)
          Length = 209

 Score =  114 bits (285), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 101/162 (62%), Gaps = 7/162 (4%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ VT+++     ++WDTAGQE
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTVKFEIWDTAGQE 67

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           RF SL   +YR A   ++VYDVT  +SF   + W  E  +H   S  +     ++GNK+D
Sbjct: 68  RFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKE--LHEQAS--KDIIIALVGNKID 123

Query: 129 V--EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAF 168
           V  +  ++ V  +  ++LA   G +  F TSAK+  NV+  F
Sbjct: 124 VLQDGGERKVAKEEGEKLAEEKG-LLFFETSAKTGENVNNVF 164

>ZYRO0E08492g Chr5 complement(676074..676684,676766..676811) [657
           bp, 218 aa] {ON} highly similar to uniprot|P51996
           Saccharomyces cerevisiae YGL210W YPT32 probably involved
           in intra-Golgi transport or in the formation of
           transport vesicles at the most distal Golgi compartment;
           ras-like GTPase, highly homologous to YPT31
          Length = 218

 Score =  114 bits (286), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 105/174 (60%), Gaps = 14/174 (8%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++GDSGVGK++L+ R+  + ++ + K+TIG +F T+ + V+ K    Q+WDTAGQ
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNDFNMESKSTIGVEFATRTIEVEGKKIKAQIWDTAGQ 72

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ER++++  A+YRGA   ++VYD++   S+EN   W  E   +A+    +     ++GNK 
Sbjct: 73  ERYRAITSAYYRGAVGALIVYDISKPSSYENCNHWLTELRENAD----DNVAVGLIGNKS 128

Query: 128 DVEESKKLVTPKA---AQELATSLGNIPLFL-TSAKSAINVDTAFEEIARSALQ 177
           D++  + + T +A   AQE      N  LF  TSA  + NVD AF E+  +  Q
Sbjct: 129 DLDHLRAVPTDEAKNFAQE------NQLLFTETSALKSENVDLAFRELITAIYQ 176

>Ecym_5362 Chr5 (735204..735833) [630 bp, 209 aa] {ON} similar to
           Ashbya gossypii ACL084C
          Length = 209

 Score =  114 bits (284), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 61/162 (37%), Positives = 102/162 (62%), Gaps = 7/162 (4%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
           +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V + ++    ++WDTAGQE
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNMGNQTIKFEIWDTAGQE 67

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           RF SL   +YR A   ++VYD+T  +SF   + W  E  +H   S  ++    ++GNK+D
Sbjct: 68  RFASLAPMYYRNAQAALVVYDITKPQSFIKARHWVKE--LHEQAS--KSIIIALVGNKLD 123

Query: 129 VEES--KKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAF 168
           + ES  ++ V  + A+ LA   G +  F TSAK+  NV+  F
Sbjct: 124 LLESDEERKVAREEAESLAQEEG-LLFFETSAKTGDNVNEVF 164

>CAGL0J08635g Chr10 complement(856102..856728) [627 bp, 208 aa] {ON}
           highly similar to uniprot|P36017 Saccharomyces
           cerevisiae YOR089c VPS21 GTP-binding protein
          Length = 208

 Score =  114 bits (284), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 61/165 (36%), Positives = 95/165 (57%), Gaps = 5/165 (3%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
           LK+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ VT+++     ++WDTAGQE
Sbjct: 8   LKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVTINEHTVKFEIWDTAGQE 67

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           RF SL   +YR A   ++VYDVT  +SF   + W  E    A+    +     ++GNK+D
Sbjct: 68  RFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELQEQAS----KDIIIALVGNKID 123

Query: 129 V-EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIA 172
           V E   +    +   E      N+  F TSAKS  N+   F  I 
Sbjct: 124 VLENGTERSVSREEAEKLAEEENLLFFETSAKSGENITDVFLAIG 168

>KLLA0B00671g Chr2 complement(50393..51006,51417..51462) [660 bp,
           219 aa] {ON} highly similar to uniprot|P51996
           Saccharomyces cerevisiae YGL210W YPT32 probably involved
           in intra-Golgi transport or in the formation of
           transport vesicles at the most distal Golgi compartment;
           ras-like GTPase, highly homologous to YPT31
          Length = 219

 Score =  114 bits (284), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 64/174 (36%), Positives = 104/174 (59%), Gaps = 14/174 (8%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++GDSGVGK++L+ R+  ++++   K TIG +F T+ + V+ K    Q+WDTAGQ
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTANEFNLDSKTTIGVEFATRTIEVEGKKIKAQIWDTAGQ 72

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ER++++  A+YR A   ++VYD+T + S+EN   W  E   +A+    E     ++GNK 
Sbjct: 73  ERYRAITTAYYRAAVGALIVYDITKSSSYENCNHWLAELKQNAD----ENVAVGLIGNKS 128

Query: 128 DVEESKKLVTPKA---AQELATSLGNIPLFL-TSAKSAINVDTAFEEIARSALQ 177
           D++  + + T +A   AQE      N  LF  TSA +A NVD AF  +  +  Q
Sbjct: 129 DLDHKRAVPTDEARNYAQE------NQLLFTETSALNADNVDEAFRALITAIYQ 176

>NCAS0B06720 Chr2 complement(1278798..1279436) [639 bp, 212 aa] {ON}
           Anc_2.196
          Length = 212

 Score =  114 bits (284), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 62/168 (36%), Positives = 97/168 (57%), Gaps = 10/168 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
           +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V ++D     ++WDTAGQE
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNINDNTVKFEIWDTAGQE 67

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           RF SL   +YR A   ++VYDVT  +SF   + W  E    AN    +     ++GNKVD
Sbjct: 68  RFASLAPMYYRNAQAALIVYDVTKPQSFIKARHWIKELHEQAN----KDMIIALVGNKVD 123

Query: 129 V----EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIA 172
           V    E+ +K+   +   E       +  F TSAK+ +NV   F  I 
Sbjct: 124 VLENNEDERKVA--REEGEKLAEEEGLLFFETSAKTGLNVTETFVAIG 169

>Smik_15.269 Chr15 complement(451402..452034) [633 bp, 210 aa] {ON}
           YOR089C (REAL)
          Length = 210

 Score =  114 bits (284), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 101/162 (62%), Gaps = 7/162 (4%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ VT+++     ++WDTAGQE
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTVKFEIWDTAGQE 67

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           RF SL   +YR A   ++VYDVT  +SF   + W  E  +H   S  +     ++GNK+D
Sbjct: 68  RFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKE--LHEQAS--KDIIIALVGNKID 123

Query: 129 V--EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAF 168
           +  E  ++ V  +  ++LA   G +  F TSAK+  NV+  F
Sbjct: 124 MLQEGGERKVAREEGEKLAEEKG-LLFFETSAKTGENVNDVF 164

>NDAI0I02910 Chr9 complement(688721..689380) [660 bp, 219 aa] {ON}
           Anc_3.521
          Length = 219

 Score =  114 bits (284), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 106/171 (61%), Gaps = 8/171 (4%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + V+ K    Q+WDTAGQ
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNIESKSTIGVEFATRTIEVEGKKIKAQIWDTAGQ 72

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ER++++  A+YRGA   ++VYD++ + ++EN   W  E   +A+    +     ++GNK 
Sbjct: 73  ERYRAITSAYYRGAVGALIVYDISKSSTYENCNHWLTELKENAD----DNVAVGLIGNKS 128

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFL-TSAKSAINVDTAFEEIARSALQ 177
           D+   + + T +A      +L N  LF  TSA ++ NVD AF E+  +  Q
Sbjct: 129 DLAHLRAVPTDEAKN---FALENQLLFTETSALNSENVDQAFRELITAIYQ 176

>KNAG0B00580 Chr2 (94797..95474) [678 bp, 225 aa] {ON} Anc_3.521
           YER031C
          Length = 225

 Score =  114 bits (284), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 62/174 (35%), Positives = 107/174 (61%), Gaps = 14/174 (8%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + V+ K    Q+WDTAGQ
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNIESKSTIGVEFATRTIEVEGKKIKAQIWDTAGQ 72

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ER++++  A+YRGA   ++VYD++ + ++EN   W  E   +A+    +     ++GNK 
Sbjct: 73  ERYRAITSAYYRGAVGALIVYDISKSSTYENCNHWLTELRENAD----DNVAVGLIGNKS 128

Query: 128 DVEESKKLVTPKA---AQELATSLGNIPLFL-TSAKSAINVDTAFEEIARSALQ 177
           D+   + + T +A   AQE      N  LF  TSA ++ NVD AF E+  +  Q
Sbjct: 129 DLAHLRAVPTDEAKNFAQE------NQLLFTETSALNSENVDQAFRELITAIYQ 176

>Skud_14.238 Chr14 (440139..440801) [663 bp, 220 aa] {ON} YNL093W
           (REAL)
          Length = 220

 Score =  113 bits (282), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 59/169 (34%), Positives = 99/169 (58%), Gaps = 10/169 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
           +K+++LG+S VGK+S++ R++++ +++  + TIGA FLTK +T DDK    ++WDTAGQE
Sbjct: 13  IKLVLLGESAVGKSSIVLRFISNDFTESREPTIGAAFLTKRITRDDKAIKFEIWDTAGQE 72

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           RF  L   +YR A   ++V+D+TN +SF   + W +E  +H  +   +     ++GNK+D
Sbjct: 73  RFAPLAPMYYRNAQAALVVFDITNEQSFRKAQDWVEE--LHEKLG--DNIIIALVGNKMD 128

Query: 129 V-----EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIA 172
           +     E S + V     Q L     N+  F  SAK+  N+   F+ + 
Sbjct: 129 LLTMQGEISNRAVNEDEIQNLCQQ-ENLLYFEVSAKTGKNIHEVFQAVG 176

>KLTH0G08206g Chr7 (666127..666765) [639 bp, 212 aa] {ON} highly
           similar to uniprot|P36017 Saccharomyces cerevisiae
           YOR089C VPS21 Rab5-like GTPase involved in vacuolar
           protein sorting and endocytosis post vesicle
           internalization geranylgeranylated geranylgeranylation
           required for membrane association
          Length = 212

 Score =  113 bits (282), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 61/167 (36%), Positives = 102/167 (61%), Gaps = 7/167 (4%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ V + D     ++WDTAGQE
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNMGDHTIKFEIWDTAGQE 67

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           RF SL   +YR A   ++VYDVT  +SF   + W  E    A+    +     ++GNK+D
Sbjct: 68  RFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELREQAS----KDIIIALVGNKLD 123

Query: 129 VEE--SKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           + E  +++ V  + A+ LA+  G +  F TSAK+  NV+  F  I +
Sbjct: 124 MVETGAERKVALEEAENLASQEG-LLFFETSAKTGSNVNEVFLAIGQ 169

>Suva_14.247 Chr14 (448490..449146) [657 bp, 218 aa] {ON} YNL093W
           (REAL)
          Length = 218

 Score =  113 bits (282), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 58/167 (34%), Positives = 101/167 (60%), Gaps = 8/167 (4%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
           +KV++LG+S VGK+S++ R+V++ ++Q  + TIGA FLTK ++ +D+    ++WDTAGQE
Sbjct: 13  IKVVLLGESAVGKSSIVLRFVSNDFTQSREPTIGAAFLTKRISRNDEAIKFEIWDTAGQE 72

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           RF  L   +YR A   ++V+D+TN +SF   + W ++  +H  V +       ++GNK+D
Sbjct: 73  RFAPLAPMYYRNAQAALVVFDITNEQSFHKAQNWVEQ--LHERVGN--HIIIALVGNKID 128

Query: 129 V---EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIA 172
           +   +   + V  +  ++L     N+  F TSAK+  N+   F+ I 
Sbjct: 129 LLSMQNVNRAVRIEVVEDLCQR-ENLLYFETSAKTGENIHEVFQAIG 174

>Kwal_23.2978 s23 (97956..98591) [636 bp, 211 aa] {ON} YOR089C
           (VPS21) - small GTP-binding protein; geranylgeranylated;
           geranylgeranylation required for membrane association;
           also involved in endocytosis post vesicle
           internalization [contig 247] FULL
          Length = 211

 Score =  112 bits (281), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 64/178 (35%), Positives = 105/178 (58%), Gaps = 11/178 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ V + D     ++WDTAGQE
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNMGDHTIKFEIWDTAGQE 67

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           RF SL   +YR A   ++VYDVT  +SF   + W  E    A+    +     ++GNK+D
Sbjct: 68  RFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELREQAS----KDIVIALVGNKLD 123

Query: 129 VEES--KKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAF----EEIARSALQQNQ 180
           + ES  ++ V  + A+ LA     +  F TSAK+  NV+  F    ++I   + QQ Q
Sbjct: 124 IVESGGERKVAREEAENLAAQ-EQLLFFETSAKTGSNVNEVFLGIGQKIPLKSPQQQQ 180

>YNL093W Chr14 (449868..450530) [663 bp, 220 aa] {ON}  YPT53Rab
           family GTPase, similar to Ypt51p and Ypt52p and to
           mammalian rab5; required for vacuolar protein sorting
           and endocytosis
          Length = 220

 Score =  112 bits (281), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 96/169 (56%), Gaps = 10/169 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
           +KV++LG+S VGK+S++ R+V+D + +  + TIGA FLTK +T D KV   ++WDTAGQE
Sbjct: 13  IKVVLLGESAVGKSSIVLRFVSDDFKESKEPTIGAAFLTKRITRDGKVIKFEIWDTAGQE 72

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           RF  L   +YR A   ++V+DVTN  SF   + W +E  +H  V         ++GNK+D
Sbjct: 73  RFAPLAPMYYRNAQAALVVFDVTNEGSFYKAQNWVEE--LHEKVG--HDIVIALVGNKMD 128

Query: 129 V-----EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIA 172
           +     E   + +   A Q L     N+  F  SAK+  N+   F+ + 
Sbjct: 129 LLNNDDENENRAMKAPAVQNLCER-ENLLYFEASAKTGENIYQIFQTLG 176

>NCAS0E00600 Chr5 (102956..103615) [660 bp, 219 aa] {ON} Anc_3.521
          Length = 219

 Score =  112 bits (280), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 107/171 (62%), Gaps = 8/171 (4%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + V+ K    Q+WDTAGQ
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNIESKSTIGVEFATRTIEVEGKKIKAQIWDTAGQ 72

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ER++++  A+YRGA   ++VYD++ + ++EN   W  E   +A+    +     ++GNK 
Sbjct: 73  ERYRAITSAYYRGAVGALIVYDISKSGTYENCNHWLKELRDNAD----DNVAVGLIGNKS 128

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFL-TSAKSAINVDTAFEEIARSALQ 177
           D+   + + T + A+  A+   N  LF  TSA ++ NVD AF E+  +  Q
Sbjct: 129 DLAHLRAVPTAE-AKNFASE--NELLFTETSALNSENVDQAFRELITAIYQ 176

>KAFR0F04160 Chr6 complement(819022..819759) [738 bp, 245 aa] {ON}
           Anc_3.521 YER031C
          Length = 245

 Score =  113 bits (282), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 59/171 (34%), Positives = 106/171 (61%), Gaps = 8/171 (4%)

Query: 8   ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQ 67
           + K++++GDSGVGK++L+ R+  ++++ + K+TIG +F T+ + ++ K    Q+WDTAGQ
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTTNEFNIESKSTIGVEFATRTIEMEGKKIKAQIWDTAGQ 72

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ER++++  A+YRGA   ++VYD++ + ++EN   W  E   +A+    +     ++GNK 
Sbjct: 73  ERYRAITSAYYRGAVGALIVYDISKSSTYENCNHWLSELRENAD----DNVAVGLIGNKS 128

Query: 128 DVEESKKLVTPKAAQELATSLGNIPLFL-TSAKSAINVDTAFEEIARSALQ 177
           D+   + + T +A      +L N  LF  TSA ++ NVD AF E+  +  Q
Sbjct: 129 DLAHLRAVPTDEAKN---FALENQLLFTETSALNSENVDQAFRELITAIYQ 176

>Kpol_1016.24 s1016 (61782..62417) [636 bp, 211 aa] {ON}
           (61782..62417) [636 nt, 212 aa]
          Length = 211

 Score =  112 bits (279), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 102/171 (59%), Gaps = 9/171 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD--DKVATMQVWDTAG 66
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +D  D V   ++WDTAG
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQSIKLDEDDTVIKFEIWDTAG 63

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNK 126
           QER++SL   +YR A+  ++VYD+T + S    ++W +E     N  + +     ++GNK
Sbjct: 64  QERYKSLAPMYYRNANAALVVYDITASDSLSKAQSWVEEL---KNKVADDKLVICLVGNK 120

Query: 127 VDV---EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARS 174
           +D+   +  K+ V    A++ A   G +  F  SAK+   V+  F+ I  S
Sbjct: 121 LDLCQEDSGKRSVEISDAKQYADEQG-LLFFEVSAKTGEKVNDVFKSIGES 170

>KAFR0J01850 Chr10 complement(356911..357540) [630 bp, 209 aa] {ON}
           Anc_2.196 YNL093W
          Length = 209

 Score =  112 bits (279), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 116/207 (56%), Gaps = 13/207 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
           +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V +++     ++WDTAGQE
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNINNNTIKFEIWDTAGQE 67

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           RF SL   +YR A   ++VYD+T  +SF   + W  E  +H   S  +     ++GNKVD
Sbjct: 68  RFASLAPMYYRNAQAALVVYDITKPQSFIKARHWVKE--LHEQAS--KDIIIALVGNKVD 123

Query: 129 V---EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIA-RSALQQNQXXXX 184
           +   +ES++ V  +  + LA   G I  F TSAK+A NV+  F  I  +  L+ +     
Sbjct: 124 IIENDESERKVAREEGERLAEEEGLI-FFETSAKTAENVNDVFLNIGEKIPLKNDNSSPN 182

Query: 185 XXXXXXXXXINIQLDG----EPNSCSC 207
                    IN+        E +SCSC
Sbjct: 183 DTTITEDQRINLAASANATSEASSCSC 209

>TPHA0I02780 Chr9 complement(614605..615231) [627 bp, 208 aa] {ON}
           Anc_1.289 YKR014C
          Length = 208

 Score =  110 bits (276), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 59/170 (34%), Positives = 104/170 (61%), Gaps = 9/170 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDD--KVATMQVWDTAG 66
            K+++LGDS VGK+S+++R+V D + +  ++TIGA FL++ +T+++  +V   ++WDTAG
Sbjct: 4   FKLVLLGDSSVGKSSIVYRFVKDSFDEFRESTIGAAFLSQTITLEENNQVIKFEIWDTAG 63

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNK 126
           QER++SL   +YR A+  ++VYDVT   S    K+W +E          E     ++GNK
Sbjct: 64  QERYKSLAPMYYRNANAALVVYDVTAPDSLMKAKSWIEELKKKV---GNEELVICLVGNK 120

Query: 127 VDV---EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           VD+   +++K+ +  + A++ A    N+  +  SAK+  NV   F++I  
Sbjct: 121 VDICEEDDTKRKIEFEEAKDWAND-ENLLFYEVSAKTGYNVKEVFQKIGE 169

>TDEL0D05890 Chr4 complement(1067167..1067856) [690 bp, 229 aa] {ON}
           Anc_3.521 YER031C
          Length = 229

 Score =  111 bits (277), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 105/175 (60%), Gaps = 14/175 (8%)

Query: 7   NILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAG 66
           N + V+++GDSGVGK++L+ R+  + ++ + K+TIG +F T+ + V+ K    Q+WDTAG
Sbjct: 24  NWVIVVLIGDSGVGKSNLLSRFTTNDFNMESKSTIGVEFATRTIEVEGKKIKAQIWDTAG 83

Query: 67  QERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNK 126
           QER++++  A+YRGA   ++VYD++   S+EN   W  E   +A+    +     ++GNK
Sbjct: 84  QERYRAITSAYYRGAVGALIVYDISKPSSYENCNHWLTELRENAD----DNVAVGLIGNK 139

Query: 127 VDVEESKKLVTPKA---AQELATSLGNIPLFL-TSAKSAINVDTAFEEIARSALQ 177
            D++  + + T +A   AQE      N  LF  TSA  + NV+ AF E+  +  Q
Sbjct: 140 SDLDHLRAVPTDEARNFAQE------NQLLFTETSALKSENVELAFRELITAIYQ 188

>TDEL0C04660 Chr3 complement(845203..845838) [636 bp, 211 aa] {ON}
           Anc_2.196 YNL093W
          Length = 211

 Score =  110 bits (274), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 61/165 (36%), Positives = 98/165 (59%), Gaps = 5/165 (3%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ V + D+    ++WDTAGQE
Sbjct: 8   VKLVLLGEAAVGKSSIVLRFVSNDFTENKEPTIGAAFLTQRVNIGDETVKFEIWDTAGQE 67

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           RF SL   +YR A   ++VYDVT  +SF   + W  E  +H   S  +     ++GNK+D
Sbjct: 68  RFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKE--LHEQAS--KGIIIALVGNKID 123

Query: 129 VEES-KKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIA 172
           V ES ++    +   E      N+  F TSAK+  NV+  F  I 
Sbjct: 124 VLESGEERKVAREEAEKLAEEENLLYFETSAKTGENVNEVFLAIG 168

>KNAG0I01080 Chr9 (207327..208088) [762 bp, 253 aa] {ON} Anc_2.196
           YNL093W
          Length = 253

 Score =  110 bits (275), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 102/167 (61%), Gaps = 8/167 (4%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
           +K+++LG+  VGK+S++ R+V++ +++  + TIGA FLT+ V +++     ++WDTAGQE
Sbjct: 8   IKLVLLGEVAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNINEHTIKFEIWDTAGQE 67

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           RF SL   +YR A   ++VYDVT  +SF   + W  E  +H   S  +     ++GNK+D
Sbjct: 68  RFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKE--LHEQAS--KDIIIALVGNKID 123

Query: 129 V---EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIA 172
           +   + +++ V  +  ++LA    N+  F TSAK+  NV+  F +I 
Sbjct: 124 MLDEDPTERKVAREEGEKLAQE-ENLLFFETSAKTGANVNEVFLKIG 169

>CAGL0G07689g Chr7 complement(729919..730566) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P36018 Saccharomyces
           cerevisiae YKR014c YPT52 GTP-binding protein
          Length = 215

 Score =  108 bits (271), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 61/171 (35%), Positives = 97/171 (56%), Gaps = 11/171 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV----DDKVATMQVWDT 64
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ V +    +D V   ++WDT
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63

Query: 65  AGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILG 124
           AGQER++SL   +YR A+  ++VYDVT   S    ++W  E     N    E     ++G
Sbjct: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQEL---QNKVGDEELVIYLVG 120

Query: 125 NKVDV---EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIA 172
           NKVD+   +ES + +  +   E A +   +     SAK+   V   F+EI 
Sbjct: 121 NKVDIVEADESARKIETEEGAEYAQA-QKLLFKEVSAKTGAGVKDIFQEIG 170

>KLTH0H09768g Chr8 (840625..841314) [690 bp, 229 aa] {ON} similar to
           uniprot|P36018 Saccharomyces cerevisiae YKR014C YPT52
           rab5-like GTPase involved in vacuolar protein sorting
           and endocytosis probable purine nucleotide- binding
           protein
          Length = 229

 Score =  109 bits (272), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 61/176 (34%), Positives = 100/176 (56%), Gaps = 10/176 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD---DKVATMQVWDTA 65
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + ++   D     ++WDTA
Sbjct: 26  FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHPDVTIKFEIWDTA 85

Query: 66  GQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGN 125
           GQER++SL   +YR A+  ++VYDVT   S    ++W +E     N    +     + GN
Sbjct: 86  GQERYKSLAPMYYRNANAALIVYDVTQPGSLVKAQSWVEEL---KNKVGDQDLVICLAGN 142

Query: 126 KVDV---EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQ 178
           KVD+   + + + V  + AQ  A   G +  + TSAK+   V   F+EI     Q+
Sbjct: 143 KVDICDEDATAREVQREDAQLYAQEQG-LLFYETSAKTGAGVSAIFQEIGERVYQK 197

>KNAG0C01840 Chr3 (363258..363896) [639 bp, 212 aa] {ON} Anc_1.338
           YBR264C
          Length = 212

 Score =  108 bits (270), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 65/176 (36%), Positives = 99/176 (56%), Gaps = 8/176 (4%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVAT-MQVWDTAGQE 68
           KV++LG S VGK+S++ R V  K+ +   ATIGA F  KEV ++DK A  + VWDTAGQE
Sbjct: 12  KVVLLGGSSVGKSSIVTRLVTGKFMKN-SATIGAAFSWKEVFLEDKKAVKLSVWDTAGQE 70

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           R+++L   +YR  D  ++VYDVTN+ S E  K+W +E   + N          ++GNK+D
Sbjct: 71  RYRALTPMYYRNTDVALIVYDVTNSTSIEGAKSWIEELHNYVNEDRRNKISIWLVGNKID 130

Query: 129 VEESKKLVTPKAAQE--LATSLGNIP----LFLTSAKSAINVDTAFEEIARSALQQ 178
           +  + +        E  L   + +IP    L   SAK+   ++  F EI+R   ++
Sbjct: 131 LLPTAQDSDTTYPHEDVLRGIMHDIPNPNELAYVSAKTGAGIEEMFNEISRQVPEE 186

>KNAG0C01600 Chr3 (317298..317942) [645 bp, 214 aa] {ON} Anc_1.289
           YKR014C
          Length = 214

 Score =  108 bits (270), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 97/175 (55%), Gaps = 14/175 (8%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDK-----VATMQVWD 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + V+ +     V   ++WD
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTIKVESEDQQEVVIKFEIWD 63

Query: 64  TAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVIL 123
           TAGQER++SL   +YR A+  ++VYDVT   S    K W +E     N    E     ++
Sbjct: 64  TAGQERYKSLAPMYYRNANAALVVYDVTQEDSLNKAKAWVEEL---KNKVGDEDLVIFLV 120

Query: 124 GNKVDV-----EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           GNKVD+      E K+ V    A++ A   G +     SAK+   V   F+ I +
Sbjct: 121 GNKVDLCEGSDNEDKRAVAATLAKQYAEDQG-LMFDEVSAKTGHGVKEVFQAIGQ 174

>Ecym_6328 Chr6 complement(629586..630203) [618 bp, 205 aa] {ON}
           similar to Ashbya gossypii AAL176C
          Length = 205

 Score =  108 bits (269), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 65/177 (36%), Positives = 104/177 (58%), Gaps = 11/177 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV---DDKVATMQVWDTA 65
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +   DD +   ++WDTA
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLAEYDDTMIKFEIWDTA 63

Query: 66  GQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGN 125
           GQER++SL   +YR A+  ++VYDVT   S    ++W +E     +    +     ++GN
Sbjct: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNEL---KSKVGDDDLVICLVGN 120

Query: 126 KVDV--EESK-KLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIA-RSALQQ 178
           KVD+  E+SK K++    A++ A   G I     SAKS   V   F+ I  R  LQ+
Sbjct: 121 KVDLAEEDSKSKVIDEDDAKDYAEQHGLI-FHEVSAKSGRGVIEVFQNIGERLYLQR 176

>Kwal_14.2394 s14 (738645..739268) [624 bp, 207 aa] {ON} YKR014C
           (YPT52) - probable purine nucleotide-binding protein
           [contig 225] FULL
          Length = 207

 Score =  107 bits (268), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 61/176 (34%), Positives = 100/176 (56%), Gaps = 10/176 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD---DKVATMQVWDTA 65
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + ++   D     ++WDTA
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDTA 63

Query: 66  GQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGN 125
           GQER++SL   +YR A+  ++VYDVT   S    ++W +E     N    +     ++GN
Sbjct: 64  GQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEEL---KNKVGDQDLVICLVGN 120

Query: 126 KVDV---EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQ 178
           K+D+   EE  + V  + AQ  A   G +     SAK+   V   F+EI  +  Q+
Sbjct: 121 KLDLCTEEEGGRGVEKEDAQMYAQEQG-LLFHEVSAKTGSGVAAIFQEIGENVYQK 175

>TBLA0B01820 Chr2 complement(415800..416438) [639 bp, 212 aa] {ON}
           Anc_2.196 YNL093W
          Length = 212

 Score =  107 bits (268), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 67/209 (32%), Positives = 104/209 (49%), Gaps = 14/209 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
           +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V + +     ++WDTAGQE
Sbjct: 8   VKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNIGNHTIKFEIWDTAGQE 67

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           RF SL   +YR A   ++VYDVT  +SF   + W  E    AN    +     ++GNK D
Sbjct: 68  RFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELQEQAN----KGIIIALVGNKAD 123

Query: 129 -VEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQNQXXXXXXX 187
            +E+ ++    +   E       +  F TSAK+  NV+  F  I      +N        
Sbjct: 124 IIEDGEERKVAREEAEKLAEEEGLLFFETSAKTGNNVNETFLAIGEKIPLKNSSSANDQH 183

Query: 188 XXXXXXIN--IQLDGEP-------NSCSC 207
                  N  I LD  P         CSC
Sbjct: 184 HDTNNNNNQRIDLDNNPVDAASNAPGCSC 212

>TDEL0D01570 Chr4 (310454..311107) [654 bp, 217 aa] {ON} Anc_1.289
           YKR014C
          Length = 217

 Score =  107 bits (268), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 59/180 (32%), Positives = 103/180 (57%), Gaps = 15/180 (8%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV------DDKVATMQVW 62
            K+++LGDS VGK+S+++R+V + + +  ++TIGA FL++ + V      ++ V   ++W
Sbjct: 4   FKLVLLGDSSVGKSSIVYRFVKNSFDEFRESTIGAAFLSQTIKVKESDDGEETVIKFEIW 63

Query: 63  DTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVI 122
           DTAGQER++SL   +YR A+  ++VYDVT   S    ++W +E     N    +     +
Sbjct: 64  DTAGQERYKSLAPMYYRNANAALVVYDVTQQDSLVKAQSWVNEL---KNKVGDDDLVICL 120

Query: 123 LGNKVDV-----EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQ 177
           +GNKVD+     E++K+ V  + A+  A    N+  +  SAK+ +NV   F+ I     +
Sbjct: 121 VGNKVDLCDEDAEDNKRAVGTEEARSYANE-QNLLFYEVSAKTGLNVQQIFQSIGEKLFE 179

>SAKL0D05940g Chr4 (485575..486198) [624 bp, 207 aa] {ON} highly
           similar to uniprot|Q75F92 Ashbya gossypii AAL176C
           AAL176Cp and similar to YKR014C uniprot|P36018
           Saccharomyces cerevisiae YKR014C YPT52 rab5-like GTPase
           involved in vacuolar protein sorting and endocytosis
           probable purine nucleotide-binding protein
          Length = 207

 Score =  107 bits (266), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 62/178 (34%), Positives = 99/178 (55%), Gaps = 10/178 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV---DDKVATMQVWDTA 65
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +   +D V   ++WDTA
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63

Query: 66  GQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGN 125
           GQER++SL   +YR A+  ++VYDVT   S    + W DE     +    E     ++GN
Sbjct: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDEL---KSKVGDEDLVICLVGN 120

Query: 126 KVDV---EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQNQ 180
           K+D+   E  ++ V    AQ  A+  G +     SAK+   V   F+EI      Q +
Sbjct: 121 KLDLCEEEGQERGVDKDDAQSYASDKG-LLFHEVSAKTGKGVSNIFQEIGEKLYLQKK 177

>AAL176C Chr1 complement(31588..32205) [618 bp, 205 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKR014C
           (YPT52)
          Length = 205

 Score =  107 bits (266), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 60/178 (33%), Positives = 106/178 (59%), Gaps = 10/178 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV---DDKVATMQVWDTA 65
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +   DD +   ++WDTA
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDTA 63

Query: 66  GQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGN 125
           GQER++SL   +YR A+  ++VYDVT   S    ++W +E  + + V   +   F++ GN
Sbjct: 64  GQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNE--LKSKVGDEDLVIFLV-GN 120

Query: 126 KVDV--EESK-KLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQNQ 180
           K+D+  E+ K +++  + AQ  A + G +     SAK+   +   F+ I     +Q +
Sbjct: 121 KLDLVDEDCKPRVIDSEEAQAYAEAHG-LMFHEVSAKTGTGILDVFQGIGGKLYEQRR 177

>ZYRO0C15554g Chr3 complement(1218190..1218825) [636 bp, 211 aa]
           {ON} highly similar to uniprot|P36017 Saccharomyces
           cerevisiae YOR089C VPS21 Rab5-like GTPase involved in
           vacuolar protein sorting and endocytosis post vesicle
           internalization geranylgeranylated geranylgeranylation
           required for membrane association
          Length = 211

 Score =  106 bits (264), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 94/161 (58%), Gaps = 5/161 (3%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
           +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V + ++    ++WDTAGQE
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNIGEQTVKFEIWDTAGQE 67

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           RF SL   +YR A   ++VYD+T  +SF   + W  E  +H   S  +     ++GNK+D
Sbjct: 68  RFASLAPMYYRNAQAALVVYDITKPQSFIKARHWVKE--LHEQAS--KGIVIALVGNKLD 123

Query: 129 -VEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAF 168
            +E   +    K   E       +  F TSAKS  NV+  F
Sbjct: 124 MIENGGERKVAKEEAEKLAEEEGLLFFETSAKSGENVNEVF 164

>ACL084C Chr3 complement(199020..199643) [624 bp, 207 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR089C
           (VPS21) and YNL093W (YPT53)
          Length = 207

 Score =  105 bits (263), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 57/165 (34%), Positives = 94/165 (56%), Gaps = 5/165 (3%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
           +K+++LG++ VGK+S++ R+V++ +S+  + TIGA FLT+ V +D K    ++WDTAGQE
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNMDSKTIKFEIWDTAGQE 67

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           RF SL   +YR A   ++VYD+T  +SF   + W  E  +H   S  +     ++GNK+D
Sbjct: 68  RFASLAPMYYRNAQAALVVYDITKPQSFIKARHWVKE--LHEQAS--KGIVIALVGNKLD 123

Query: 129 -VEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIA 172
            +E  +     +   E       +  F TSAK+   ++  F  I 
Sbjct: 124 LLENGEARKVSREEAEKLAEEEGLLFFETSAKTGDKINEVFLAIG 168

>SAKL0E09922g Chr5 complement(829249..829890) [642 bp, 213 aa] {ON}
           similar to uniprot|P36017 Saccharomyces cerevisiae
           YOR089C VPS21 Rab5-like GTPase involved in vacuolar
           protein sorting and endocytosis post vesicle
           internalization geranylgeranylated geranylgeranylation
           required for membrane association
          Length = 213

 Score =  105 bits (263), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 97/180 (53%), Gaps = 12/180 (6%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
           +K+++LG++ VGK+S++ R+V++ +++  + TIGA FLT+ V + D     ++WDTAGQE
Sbjct: 9   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNMGDHTIKFEIWDTAGQE 68

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           RF SL   +YR A   ++VYDVT  +SF   + W  E    AN    +     ++GNK+D
Sbjct: 69  RFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQAN----KGIIIALVGNKLD 124

Query: 129 -VEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR-------SALQQNQ 180
            +E   +    K   E       +  F TSAK+  NV+  F  I           LQQ Q
Sbjct: 125 LLENGGERKVAKEEGEKLAEEEGLLFFETSAKTGDNVNEVFLAIGEKIPLHTPEELQQQQ 184

>Skud_11.247 Chr11 complement(445982..446686) [705 bp, 234 aa] {ON}
           YKR014C (REAL)
          Length = 234

 Score =  106 bits (264), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 100/191 (52%), Gaps = 31/191 (16%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD--------DKVATMQ 60
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ +T+         D V   +
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNGAKDVVIKFE 63

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPF 120
           +WDTAGQER++SL   +YR A+  ++VYD+T   S +  + W DE     N    +    
Sbjct: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDEL---KNKVGDDDLVI 120

Query: 121 VILGNKVDV-------------------EESKKLVTPKAAQELATSLGNIPLFLTSAKSA 161
            +LGNKVD+                   E+  + ++ + A++ A   G +     SAK+ 
Sbjct: 121 YLLGNKVDLCQDMPGSETIPELNEGEDDEQKVRAISTEEAKQYAQEQG-LLFREVSAKTG 179

Query: 162 INVDTAFEEIA 172
             +   F+EI 
Sbjct: 180 DGIKEIFQEIG 190

>Smik_11.271 Chr11 complement(452840..453544) [705 bp, 234 aa] {ON}
           YKR014C (REAL)
          Length = 234

 Score =  106 bits (264), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 101/191 (52%), Gaps = 31/191 (16%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVT--------VDDKVATMQ 60
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ +T        V D +   +
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGGEVKDVIIKFE 63

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPF 120
           +WDTAGQER++SL   +YR A+  ++VYD+T   S +  + W DE     N    +    
Sbjct: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDEL---KNKVGDDDLVI 120

Query: 121 VILGNKVDV-------------------EESKKLVTPKAAQELATSLGNIPLFLTSAKSA 161
            +LGNKVD+                   E+  ++++ + A++ A   G +     SAK+ 
Sbjct: 121 YLLGNKVDLCQESASTEPSPESNKGEDDEQKVRVISTEEAKQYAQEQG-LLFREVSAKTG 179

Query: 162 INVDTAFEEIA 172
             V   F++I 
Sbjct: 180 EGVKEIFQDIG 190

>ZYRO0G21384g Chr7 complement(1763055..1763711) [657 bp, 218 aa]
           {ON} highly similar to uniprot|Q75F92 Ashbya gossypii
           AAL176C AAL176Cp and similar to YKR014C uniprot|P36018
           Saccharomyces cerevisiae YKR014C YPT52 rab5-like GTPase
           involved in vacuolar protein sorting and endocytosis
           probable purine nucleotide-binding protein
          Length = 218

 Score =  105 bits (262), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 97/178 (54%), Gaps = 17/178 (9%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDK------VATMQVW 62
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + ++DK      V   ++W
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKIEDKGSQQEVVIKFEIW 63

Query: 63  DTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVI 122
           DTAGQER++SL   +YR A+  ++VYDVT   S    + W +E          +     +
Sbjct: 64  DTAGQERYKSLAPMYYRNANAALVVYDVTQQDSLAKAQGWVNELKTKVG---EDDLVICL 120

Query: 123 LGNKVDV--EESKKLVTPKA-----AQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           +GNK+D+  EE +    PKA     A+  A   G +     SAK+   V   F+ I  
Sbjct: 121 VGNKLDLCTEEGESSSKPKAVESSDAEGYANEQG-LLFHEVSAKTGEGVKQVFQSIGE 177

>YKR014C Chr11 complement(465367..466071) [705 bp, 234 aa] {ON}
           YPT52Rab family GTPase, similar to Ypt51p and Ypt53p and
           to mammalian rab5; required for vacuolar protein sorting
           and endocytosis
          Length = 234

 Score =  105 bits (263), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 50/129 (38%), Positives = 79/129 (61%), Gaps = 11/129 (8%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD--------DKVATMQ 60
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ +T+         D V   +
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63

Query: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPF 120
           +WDTAGQER++SL   +YR A+  ++VYD+T   S +  + W DE     N    +    
Sbjct: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDEL---KNKVGDDDLVI 120

Query: 121 VILGNKVDV 129
            +LGNKVD+
Sbjct: 121 YLLGNKVDL 129

>Suva_11.246 Chr11 complement(449412..450122) [711 bp, 236 aa] {ON}
           YKR014C (REAL)
          Length = 236

 Score =  105 bits (263), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 63/193 (32%), Positives = 101/193 (52%), Gaps = 33/193 (17%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD----------DKVAT 58
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ +T+           D V  
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNEANAKDVVIK 63

Query: 59  MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETF 118
            ++WDTAGQER++SL   +YR A+  ++VYD+T   S +  + W DE     N    +  
Sbjct: 64  FEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDEL---KNKVGDDDL 120

Query: 119 PFVILGNKVDV----------EESK---------KLVTPKAAQELATSLGNIPLFLTSAK 159
              +LGNKVD+          +ESK         + ++ + A++ A   G +     SAK
Sbjct: 121 VIYLLGNKVDLCLGTPGAEIGQESKEDGDNEPKERAISTEEARQYAQEQG-LLFREVSAK 179

Query: 160 SAINVDTAFEEIA 172
           +   V   F EI 
Sbjct: 180 TGEGVKDIFREIG 192

>NCAS0B07630 Chr2 complement(1443664..1444314) [651 bp, 216 aa] {ON}
           Anc_1.289
          Length = 216

 Score =  105 bits (261), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 95/173 (54%), Gaps = 13/173 (7%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV------DDKVATMQVW 62
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +      +D V   ++W
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEIW 63

Query: 63  DTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVI 122
           DTAGQER++SL   +YR A+  ++VYD+T   S    ++W +E     N    E     +
Sbjct: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEEL---KNKVGDEDLVIFL 120

Query: 123 LGNKVDV---EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIA 172
           +GNK+D+   EE  + V    A+  A    N+     SAK+   V   F  I 
Sbjct: 121 VGNKLDLCEGEEDLRAVDTSEAKAYAEE-QNLLFTEVSAKTGQGVKEVFRSIG 172

>TPHA0I02590 Chr9 complement(571327..572004) [678 bp, 225 aa] {ON}
           Anc_1.338 YBR264C
          Length = 225

 Score =  104 bits (259), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 63/171 (36%), Positives = 100/171 (58%), Gaps = 7/171 (4%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV-----DDKVATMQVWD 63
           LK+++LG+S VGK+S++ RYV  K+++   ATIGA F+TKE+       + +V  +++WD
Sbjct: 15  LKLVLLGESSVGKSSVVSRYVTGKFNKT-NATIGAAFITKEIKFVSEEGEHRVVNLEIWD 73

Query: 64  TAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVIL 123
           TAGQER++SL   +YR  D  V+V+D+T   S      W DE L +      E     ++
Sbjct: 74  TAGQERYRSLAPMYYRNTDVAVIVFDLTVPDSAAKALAWVDELLSYVEKERREEIVITVV 133

Query: 124 GNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARS 174
           GNK D+ E    +     Q++AT L   P++  SAK+   ++  F++I RS
Sbjct: 134 GNKNDLIEGDDKIDSAMEQDIAT-LAKRPIWRVSAKTGEGIEELFQDIVRS 183

>NDAI0B04980 Chr2 complement(1216833..1217516) [684 bp, 227 aa] {ON}
           Anc_1.289
          Length = 227

 Score =  104 bits (259), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 69/226 (30%), Positives = 107/226 (47%), Gaps = 33/226 (14%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVA------TMQVW 62
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL + + + D           ++W
Sbjct: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLAQTIKIKDTETQEDIDIKFEIW 63

Query: 63  DTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVI 122
           DTAGQER++SL   +YR A+  ++VYD+T   S     +W DE          E     +
Sbjct: 64  DTAGQERYKSLAPMYYRNANAALVVYDLTQKNSLSKAMSWVDELKSKV---GDEDLVIYL 120

Query: 123 LGNKVDV--------------EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAF 168
           +GNK+D+              EE+K++VT + A   A   G +     SAK+   V   F
Sbjct: 121 VGNKLDLCDNVENRGGKEQEEEENKRVVTTQEADSYAKDQG-LLFAEISAKTGQGVKEVF 179

Query: 169 E-------EIARSALQQNQXXXXXXXXXXXXXINIQL--DGEPNSC 205
           +       EI +  L   +             INIQ     +P SC
Sbjct: 180 QTIGEKLYEIKKPELLAKKNREYGRNSSEAVDINIQRPNTNDPTSC 225

>KAFR0C04310 Chr3 (855871..856470) [600 bp, 199 aa] {ON} Anc_1.338
           YBR264C
          Length = 199

 Score =  103 bits (257), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 79/122 (64%), Gaps = 2/122 (1%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDD-KVATMQVWDTAGQ 67
           LK+++LG+S VGK+S++ R+V  K+ Q+  ATIGA F +K + +DD K   +++WDTAGQ
Sbjct: 11  LKLVLLGESSVGKSSIVTRFVTGKF-QKNNATIGAAFTSKSIKLDDYKEVNLEIWDTAGQ 69

Query: 68  ERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKV 127
           ER++SL   +YR  D  ++V+DVTN +S E  ++W DE   +           +++ NK 
Sbjct: 70  ERYRSLAPMYYRETDVALVVFDVTNKRSLERAQSWIDELNFYIVSERQHAVKIMLVANKA 129

Query: 128 DV 129
           D+
Sbjct: 130 DL 131

>ZYRO0B09152g Chr2 complement(714608..715279) [672 bp, 223 aa] {ON}
           similar to uniprot|P36019 Saccharomyces cerevisiae
           YNL093W YPT53 Involved in vacuolar protein sorting and
           endocytosis GTP-binding protein of the rab family
          Length = 223

 Score =  103 bits (258), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 63/176 (35%), Positives = 98/176 (55%), Gaps = 20/176 (11%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV--DDKVA---TMQVWD 63
           LK+++LG+S VGKTS++ RY    Y Q+  ATIGA F TK + V  +D V     +++WD
Sbjct: 35  LKLVLLGESSVGKTSIVTRYTTGNY-QKTNATIGAAFFTKAINVPSEDGVVRKVNVEIWD 93

Query: 64  TAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPET-FPFVI 122
           TAGQER++SL   +YR  D   +V+DVT  +S E   +W +E   + +   PE     ++
Sbjct: 94  TAGQERYRSLTPVYYRNTDAAFIVFDVTKPESLEKAHSWIEELNEYCSSDRPENEINTIV 153

Query: 123 LGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQ 178
           +GNK+D++               T L  +   L SAK+   +   FE++A+S L +
Sbjct: 154 VGNKIDLDHGP----------FETDLQYV---LVSAKTGEGIVKLFEKLAQSVLNE 196

>NCAS0B07360 Chr2 complement(1389230..1389907) [678 bp, 225 aa] {ON}
           Anc_1.338
          Length = 225

 Score =  103 bits (258), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 59/169 (34%), Positives = 95/169 (56%), Gaps = 13/169 (7%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDK----VATMQVWDT 64
           LK+++LG+S VGKTS++ R+   K+ Q+  ATIGA FL K +   D+       +++WDT
Sbjct: 23  LKLVLLGESSVGKTSIVTRFTTGKF-QRNNATIGAAFLNKNIRWVDEDNIYEVDLEIWDT 81

Query: 65  AGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILG 124
           AGQER++SL   +YR  D  ++V+DVT++ +F+  ++W DE   + +    +     ++G
Sbjct: 82  AGQERYRSLAPIYYRNTDVALIVFDVTSSNTFQKARSWVDELRSYLDNEQGKEIQLYLIG 141

Query: 125 NKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           NK D+E     +   A  ++ T          SAK    +   FEEIAR
Sbjct: 142 NKCDLEHES--IAKTAILDMCT------FKEVSAKRDEGIQELFEEIAR 182

>Smik_2.408 Chr2 complement(723817..724416) [600 bp, 199 aa] {ON}
           YBR264C (REAL)
          Length = 199

 Score =  101 bits (252), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 95/166 (57%), Gaps = 19/166 (11%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEV------TVDDKVATMQVW 62
           +KV++LGDS VGKTS++ R  + K+  ++ ATIGA F+TK +      T  DK   M++W
Sbjct: 5   IKVVLLGDSSVGKTSVVTRLKSGKFLAKHAATIGAAFITKTIEIPSDDTTTDKRIHMEIW 64

Query: 63  DTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVI 122
           DTAGQER++SL   +YR A+  +LV+++ +  S +  KTW  +    A  +       ++
Sbjct: 65  DTAGQERYKSLVPMYYRDANIALLVFELGDISSLQCAKTWFQDLQDRAQGTQ-----VIL 119

Query: 123 LGNKVDV--EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDT 166
           +GNK D+  EE    VT      +   L ++P  L SAK+  N DT
Sbjct: 120 VGNKYDLVREEHLDEVT------IPAELQDLPYVLVSAKTGYNFDT 159

>TDEL0D02060 Chr4 (403098..403706) [609 bp, 202 aa] {ON} Anc_1.338
           YBR264C
          Length = 202

 Score =  101 bits (251), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 55/168 (32%), Positives = 91/168 (54%), Gaps = 17/168 (10%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDD-----KVATMQVWD 63
           LK+++LG+S VGK+S++ RYV   + Q+  ATIGA F T+   V       K   +++WD
Sbjct: 13  LKLVLLGESSVGKSSIVMRYVTGSF-QKTNATIGAAFTTRTFEVPQCDGSIKRINLEIWD 71

Query: 64  TAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVIL 123
           TAGQER++SL   ++R  D  ++V+DVT  +S    ++W +E   +      +     ++
Sbjct: 72  TAGQERYRSLAPMYFRNTDIALVVFDVTKPESLRKAQSWIEELNSYVEEDRRDDLRIKVI 131

Query: 124 GNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEI 171
           GNK D+E            +   ++  +PLF  SAK+   +D  FE +
Sbjct: 132 GNKKDLE-----------HDPVGTIEGLPLFTVSAKTGEGIDELFESL 168

>AEL187C Chr5 complement(284984..285610) [627 bp, 208 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR264C
           (YPT10)
          Length = 208

 Score =  100 bits (250), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 97/176 (55%), Gaps = 23/176 (13%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDD-----------KVA 57
           +K+++LG+S VGK+S++ R+   ++ +  +ATIGA F T+ V  ++           +  
Sbjct: 9   VKLVLLGESSVGKSSIVTRFTTGEFRKN-QATIGAAFTTRSVQWEEDAGDGSDAKEVRSV 67

Query: 58  TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPET 117
           T ++WDTAGQER++SL   +YR  D  ++VYDVT  +SF+N ++W DE   +   +    
Sbjct: 68  TFEIWDTAGQERYRSLAPMYYRNTDVALVVYDVTEQQSFQNARSWIDELNTYIGEAQRND 127

Query: 118 FPFVILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
               I+GNK+D+    +L  P  +   AT          SAK+   ++  F +IA+
Sbjct: 128 VVVRIVGNKIDLHAGGQLEQPLPS---AT--------FVSAKTGEGIEELFMDIAK 172

>Suva_4.526 Chr4 complement(909423..910019) [597 bp, 198 aa] {ON}
           YBR264C (REAL)
          Length = 198

 Score = 99.4 bits (246), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 101/181 (55%), Gaps = 22/181 (12%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD------DKVATMQVW 62
           +KV++LGDS VGKTS++ R  + K+ +++ ATIGA F+TK + V       +K   M++W
Sbjct: 5   IKVVLLGDSSVGKTSIVTRLKSGKFPEKHAATIGAAFVTKTIEVPTSDTSTEKRIHMEIW 64

Query: 63  DTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVI 122
           DTAGQER++SL   +YR A+  +LV+++ N  S +   TW  +    A  +       ++
Sbjct: 65  DTAGQERYKSLVPMYYRDANIALLVFELNNAASLQCAMTWFQDLQDRAQETK-----VIL 119

Query: 123 LGNKVDV---EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQN 179
           +GNK D+   E+S ++       E+   L  +P    SAK+  N D A  +I  S +  +
Sbjct: 120 VGNKHDLVSQEQSSEV-------EIPVELQGVPYVPVSAKTGYNFD-ALNKIIISLIPDD 171

Query: 180 Q 180
           Q
Sbjct: 172 Q 172

>YBR264C Chr2 complement(737770..738369) [600 bp, 199 aa] {ON}
           YPT10Rab family GTP-binding protein that contains the
           PEST signal sequence specific for proteolytic enzymes;
           may be involved in vesicular transport; overexpression
           leads to accumulation of Golgi-like cisternae with
           budding vesicles
          Length = 199

 Score = 98.6 bits (244), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 60/167 (35%), Positives = 93/167 (55%), Gaps = 21/167 (12%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV------DDKVATMQVW 62
           +KV++LGDS VGKTS++ R  + K+  ++ ATIGA F+TK + V       +K   M++W
Sbjct: 5   IKVVLLGDSSVGKTSIVTRLKSGKFLAKHAATIGAAFITKTIEVPSNDSSTEKRIHMEIW 64

Query: 63  DTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVI 122
           DTAGQER++SL   +YR A+  ++V+++ +  S +  KTW  +    A  +       +I
Sbjct: 65  DTAGQERYKSLVPMYYRDANIALIVFELGDVSSLQCAKTWFQDLQDRAQGTQ-----VII 119

Query: 123 LGNKVDV---EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDT 166
           +GNK D+   E S ++  P   Q L       P    SAK+  N DT
Sbjct: 120 VGNKYDLVCEEHSGEVTIPAELQGL-------PYVAVSAKTGYNFDT 159

>CAGL0I09306g Chr9 complement(897357..897977) [621 bp, 206 aa] {ON}
           similar to uniprot|P38146 Saccharomyces cerevisiae
           YBR264c GTP-binding protein
          Length = 206

 Score = 97.4 bits (241), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 95/170 (55%), Gaps = 14/170 (8%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV----DDKVATMQVWDT 64
           LKV++LG+S VGK++++ R+   KY +   ATIGA ++TK++      D     +++WDT
Sbjct: 11  LKVVLLGESAVGKSAIVTRFSTGKYLRN-NATIGAAYVTKDLEYIRDGDVYQVRLEIWDT 69

Query: 65  AGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILG 124
           AGQER++SL   +YR  D  ++V+DV+N +S      W DE   +      E    V++G
Sbjct: 70  AGQERYRSLTPMYYRNTDVAIVVFDVSNLRSLSMAHKWIDELNTYVENKGRERINIVLVG 129

Query: 125 NKVDV-EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           NK+D+  + ++   P+  +E   ++        SAKS   ++  F+ I +
Sbjct: 130 NKMDLCSDEERSTLPQRVEEQFQAV--------SAKSGEGIEELFDHIVK 171

>Skud_2.397 Chr2 complement(706771..707370) [600 bp, 199 aa] {ON}
           YBR264C (REAL)
          Length = 199

 Score = 97.1 bits (240), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 66/208 (31%), Positives = 103/208 (49%), Gaps = 22/208 (10%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD------DKVATMQVW 62
           +KV++LGDS VGKTS++ R  + K+  ++ ATIGA F+TK + V       +K   M++W
Sbjct: 5   IKVVLLGDSSVGKTSIVTRLKSGKFLAKHAATIGAAFVTKTIEVPCGDAAIEKRIHMEIW 64

Query: 63  DTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVI 122
           DTAGQER++SL   +YR A+  +LV+++ +  S     TW  +    A  +       ++
Sbjct: 65  DTAGQERYKSLVPMYYRDANIALLVFELGDTASLRCAMTWFQDLQDRAQETQ-----VIL 119

Query: 123 LGNKVDV---EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQN 179
           +GNK D+   E SK++  P   Q L       P    SAK+  N   A  +I    + ++
Sbjct: 120 VGNKYDLVGEERSKEVDIPAELQGL-------PYVPVSAKTGYNFG-ALNDIVIRLVPED 171

Query: 180 QXXXXXXXXXXXXXINIQLDGEPNSCSC 207
           Q             + I   G   SC C
Sbjct: 172 QFKTLSKDNEQNNRLEINKKGSRGSCIC 199

>KAFR0D02040 Chr4 complement(412576..413382,413464..413481) [825 bp,
           274 aa] {ON} Anc_2.182 YNL098C
          Length = 274

 Score = 98.6 bits (244), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 50/163 (30%), Positives = 96/163 (58%), Gaps = 6/163 (3%)

Query: 11  VIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQERF 70
           + ++G  G+GK+++  R++  +++ +Y  TI  D   K++TVD+   T+ + DTAGQE +
Sbjct: 16  IAVVGSGGIGKSAITIRFIQSRFTDEYDPTI-EDSYRKQLTVDNAKYTIDILDTAGQEEY 74

Query: 71  QSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDVE 130
             +   + R  D  +LVY +++ +S++ +  +  + L    V   E  P V++GNK D+ 
Sbjct: 75  YMMREQYMRNCDGFLLVYSISSMQSYDELLNFYHQIL---RVKEVEYIPIVVIGNKSDL- 130

Query: 131 ESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           ES++ V+ K  +++  ++   P F TSAK  +N+D AF+ + R
Sbjct: 131 ESERQVSFKEGEQMGCNISG-PFFETSAKYGLNIDVAFQSLVR 172

>Ecym_6309 Chr6 (585998..586624) [627 bp, 208 aa] {ON} similar to
           Ashbya gossypii AEL187C
          Length = 208

 Score = 97.1 bits (240), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 83/137 (60%), Gaps = 13/137 (9%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDD------------KV 56
           LK+++LG+S VGK+S++ R+   ++ +  +ATIGA F T+ ++  +            K 
Sbjct: 9   LKLVLLGESSVGKSSIVTRFTTGEFHKN-QATIGAAFTTRTISWKENPTNRSSEELITKS 67

Query: 57  ATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPE 116
              ++WDTAGQER++SL   +YR  D  ++V+D+T+  S E  ++W DE   + + S  +
Sbjct: 68  VNFEIWDTAGQERYRSLAPMYYRNTDVALIVFDITDESSLEKAQSWIDELNTYVDESRQK 127

Query: 117 TFPFVILGNKVDVEESK 133
                I+GNK+D+++SK
Sbjct: 128 QIVIKIVGNKMDLKDSK 144

>KLTH0G14850g Chr7 (1304240..1304884) [645 bp, 214 aa] {ON} highly
           similar to uniprot|P32835 Saccharomyces cerevisiae
           YLR293C GSP1 GTP binding protein (mammalian Ranp
           homolog) involved in the maintenance of nuclear
           organization RNA processing and transport regulated by
           Prp20p Rna1p Yrb1p Yrb2p Yrp4p Yrb30p Cse1p and Kap95p
           yeast Gsp2p homolog
          Length = 214

 Score = 96.7 bits (239), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 86/165 (52%), Gaps = 9/165 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        D       VWDTAGQE
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTDFGELKFDVWDTAGQE 67

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           +F  L   +Y  A C ++++DVT+  +++N+  W  +      V   E  P V+ GNKVD
Sbjct: 68  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 122

Query: 129 VEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           V+E K     KA         N+  +  SAKS  N +  F  +AR
Sbjct: 123 VKERKV----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLAR 163

>Kwal_56.23361 s56 complement(508046..508690) [645 bp, 214 aa] {ON}
           YLR293C (GSP1) - GTP-binding protein [contig 181] FULL
          Length = 214

 Score = 96.7 bits (239), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 86/165 (52%), Gaps = 9/165 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        D       VWDTAGQE
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTDFGELKFDVWDTAGQE 67

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           +F  L   +Y  A C ++++DVT+  +++N+  W  +      V   E  P V+ GNKVD
Sbjct: 68  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 122

Query: 129 VEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           V+E K     KA         N+  +  SAKS  N +  F  +AR
Sbjct: 123 VKERKV----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLAR 163

>SAKL0D06490g Chr4 complement(531028..531684) [657 bp, 218 aa] {ON}
           similar to uniprot|P36019 Saccharomyces cerevisiae
           YNL093W YPT53 Involved in vacuolar protein sorting and
           endocytosis GTP-binding protein of the rab family
          Length = 218

 Score = 96.3 bits (238), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 97/185 (52%), Gaps = 33/185 (17%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD----------DKVAT 58
           LK+++LG+S VGK+S++ R+    + +   ATIGA F TK ++++          DK   
Sbjct: 9   LKLVLLGESSVGKSSIVTRFTTGNFHRS-NATIGAAFTTKTLSLESIVPETGETIDKKIK 67

Query: 59  MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETF 118
           +++WDTAGQER++SL   +YR  D  ++V+DVTN  S    ++W DE   + N    E  
Sbjct: 68  LEIWDTAGQERYRSLAPMYYRNTDVALIVFDVTNKDSIARAQSWIDELNRYINEGEHEER 127

Query: 119 PFV--ILGNKVDVEESKKLVTPKAAQELATSLGNIPL--------FLTSAKSAINVDTAF 168
             +  I+GNK+D       + P+A +       N+P         F  SAK+   +D  F
Sbjct: 128 GILIKIVGNKID-------LNPEARE-----TQNLPYIQDQGYNWFPVSAKTGDGIDELF 175

Query: 169 EEIAR 173
           + I +
Sbjct: 176 DTIVK 180

>Skud_15.352 Chr15 complement(632241..632903) [663 bp, 220 aa] {ON}
           YOR185C (REAL)
          Length = 220

 Score = 95.9 bits (237), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 86/165 (52%), Gaps = 9/165 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +       VWDTAGQE
Sbjct: 14  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQE 73

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           +F  L   +Y  A C ++++DVT+  +++N+  W  +      V   E  P V+ GNKVD
Sbjct: 74  KFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 128

Query: 129 VEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           V+E K     KA         N+  +  SAKS  N +  F  +AR
Sbjct: 129 VKERKV----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLAR 169

>Smik_15.370 Chr15 complement(637457..638119) [663 bp, 220 aa] {ON}
           YOR185C (REAL)
          Length = 220

 Score = 95.5 bits (236), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 86/165 (52%), Gaps = 9/165 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +       VWDTAGQE
Sbjct: 14  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQE 73

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           +F  L   +Y  A C ++++DVT+  +++N+  W  +      V   E  P V+ GNKVD
Sbjct: 74  KFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 128

Query: 129 VEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           V+E K     KA         N+  +  SAKS  N +  F  +AR
Sbjct: 129 VKERKV----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLAR 169

>YOR185C Chr15 complement(681444..682106) [663 bp, 220 aa] {ON}
           GSP2GTP binding protein (mammalian Ranp homolog)
           involved in the maintenance of nuclear organization, RNA
           processing and transport; interacts with Kap121p,
           Kap123p and Pdr6p (karyophilin betas); Gsp1p homolog
           that is not required for viability
          Length = 220

 Score = 95.5 bits (236), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 86/165 (52%), Gaps = 9/165 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +       VWDTAGQE
Sbjct: 14  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQE 73

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           +F  L   +Y  A C ++++DVT+  +++N+  W  +      V   E  P V+ GNKVD
Sbjct: 74  KFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 128

Query: 129 VEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           V+E K     KA         N+  +  SAKS  N +  F  +AR
Sbjct: 129 VKERKV----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLAR 169

>Suva_8.241 Chr8 complement(432445..433107) [663 bp, 220 aa] {ON}
           YOR185C (REAL)
          Length = 220

 Score = 95.5 bits (236), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 86/165 (52%), Gaps = 9/165 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +       VWDTAGQE
Sbjct: 14  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQE 73

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           +F  L   +Y  A C ++++DVT+  +++N+  W  +      V   E  P V+ GNKVD
Sbjct: 74  KFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 128

Query: 129 VEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           V+E K     KA         N+  +  SAKS  N +  F  +AR
Sbjct: 129 VKERKV----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLAR 169

>Suva_10.389 Chr10 complement(681930..682589) [660 bp, 219 aa] {ON}
           YLR293C (REAL)
          Length = 219

 Score = 95.5 bits (236), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 86/165 (52%), Gaps = 9/165 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +       VWDTAGQE
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQE 72

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           +F  L   +Y  A C ++++DVT+  +++N+  W  +      V   E  P V+ GNKVD
Sbjct: 73  KFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 127

Query: 129 VEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           V+E K     KA         N+  +  SAKS  N +  F  +AR
Sbjct: 128 VKERKV----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLAR 168

>Skud_12.375 Chr12 complement(661797..662456) [660 bp, 219 aa] {ON}
           YLR293C (REAL)
          Length = 219

 Score = 95.5 bits (236), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 86/165 (52%), Gaps = 9/165 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +       VWDTAGQE
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQE 72

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           +F  L   +Y  A C ++++DVT+  +++N+  W  +      V   E  P V+ GNKVD
Sbjct: 73  KFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 127

Query: 129 VEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           V+E K     KA         N+  +  SAKS  N +  F  +AR
Sbjct: 128 VKERKV----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLAR 168

>Smik_12.371 Chr12 complement(658971..659630) [660 bp, 219 aa] {ON}
           YLR293C (REAL)
          Length = 219

 Score = 95.5 bits (236), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 86/165 (52%), Gaps = 9/165 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +       VWDTAGQE
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQE 72

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           +F  L   +Y  A C ++++DVT+  +++N+  W  +      V   E  P V+ GNKVD
Sbjct: 73  KFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 127

Query: 129 VEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           V+E K     KA         N+  +  SAKS  N +  F  +AR
Sbjct: 128 VKERKV----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLAR 168

>YLR293C Chr12 complement(720771..721430) [660 bp, 219 aa] {ON}
           GSP1Ran GTPase, GTP binding protein (mammalian Ranp
           homolog) involved in the maintenance of nuclear
           organization, RNA processing and transport; regulated by
           Srm1p, Rna1p, Yrb1p, Yrb2p, Yrp4p, Yrb30p, Cse1p and
           Kap95p; yeast Gsp2p homolog
          Length = 219

 Score = 95.5 bits (236), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 86/165 (52%), Gaps = 9/165 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +       VWDTAGQE
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQE 72

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           +F  L   +Y  A C ++++DVT+  +++N+  W  +      V   E  P V+ GNKVD
Sbjct: 73  KFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 127

Query: 129 VEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           V+E K     KA         N+  +  SAKS  N +  F  +AR
Sbjct: 128 VKERKV----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLAR 168

>ZYRO0D14784g Chr4 complement(1247520..1248164) [645 bp, 214 aa]
           {ON} highly similar to uniprot|P32836 Saccharomyces
           cerevisiae YOR185C GSP2 GTP binding protein (mammalian
           Ranp homolog) involved in the maintenance of nuclear
           organization RNA processing and transport interacts with
           Kap121p Kap123p and Pdr6p (karyophilin betas) Gsp1p
           homolog that is not required for viability
          Length = 214

 Score = 94.7 bits (234), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 86/165 (52%), Gaps = 9/165 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +       VWDTAGQE
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQE 67

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           +F  L   +Y  A C ++++DVT+  +++N+  W  +      V   E  P V+ GNKVD
Sbjct: 68  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 122

Query: 129 VEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           V+E K     KA         N+  +  SAKS  N +  F  +AR
Sbjct: 123 VKERKV----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLAR 163

>CAGL0I00594g Chr9 (44835..45479) [645 bp, 214 aa] {ON} highly
           similar to uniprot|P32835 Saccharomyces cerevisiae
           YLR293c GSP1
          Length = 214

 Score = 94.7 bits (234), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 86/165 (52%), Gaps = 9/165 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +       VWDTAGQE
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFHTNFGEIKFDVWDTAGQE 67

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           +F  L   +Y  A C ++++DVT+  +++N+  W  +      V   E  P V+ GNKVD
Sbjct: 68  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 122

Query: 129 VEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           V+E K     KA         N+  +  SAKS  N +  F  +AR
Sbjct: 123 VKERKV----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLAR 163

>Ecym_3097 Chr3 (181482..182126) [645 bp, 214 aa] {ON} similar to
           Ashbya gossypii AGR294C
          Length = 214

 Score = 94.7 bits (234), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 86/165 (52%), Gaps = 9/165 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +       VWDTAGQE
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGEIKFDVWDTAGQE 67

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           +F  L   +Y  A C ++++DVT+  +++N+  W  +      V   E  P V+ GNKVD
Sbjct: 68  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 122

Query: 129 VEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           V+E K     KA         N+  +  SAKS  N +  F  +AR
Sbjct: 123 VKERKV----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLAR 163

>AGR294C Chr7 complement(1287036..1287680) [645 bp, 214 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR185C
           (GSP2) and YLR293C (GSP1)
          Length = 214

 Score = 94.7 bits (234), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 86/165 (52%), Gaps = 9/165 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +       VWDTAGQE
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGEIKFDVWDTAGQE 67

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           +F  L   +Y  A C ++++DVT+  +++N+  W  +      V   E  P V+ GNKVD
Sbjct: 68  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 122

Query: 129 VEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           V+E K     KA         N+  +  SAKS  N +  F  +AR
Sbjct: 123 VKERKV----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLAR 163

>TDEL0G03810 Chr7 (699414..700082) [669 bp, 222 aa] {ON} Anc_6.90
           YLR293C
          Length = 222

 Score = 94.7 bits (234), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 86/165 (52%), Gaps = 9/165 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +       VWDTAGQE
Sbjct: 16  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQE 75

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           +F  L   +Y  A C ++++DVT+  +++N+  W  +      V   E  P V+ GNKVD
Sbjct: 76  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 130

Query: 129 VEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           V+E K     KA         N+  +  SAKS  N +  F  +AR
Sbjct: 131 VKERKV----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLAR 171

>KLLA0A04499g Chr1 complement(404732..405376) [645 bp, 214 aa] {ON}
           highly similar to uniprot|P32836 Saccharomyces
           cerevisiae YOR185C GSP2 GTP binding protein (mammalian
           Ranp homolog) involved in the maintenance of nuclear
           organization RNA processing and transport interacts with
           Kap121p Kap123p and Pdr6p (karyophilin betas) Gsp1p
           homolog that is not required for viability
          Length = 214

 Score = 94.4 bits (233), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 86/165 (52%), Gaps = 9/165 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +       VWDTAGQE
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGEIKFDVWDTAGQE 67

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           +F  L   +Y  A C ++++DVT+  +++N+  W  +      V   E  P V+ GNKVD
Sbjct: 68  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 122

Query: 129 VEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           V+E K     KA         N+  +  SAKS  N +  F  +AR
Sbjct: 123 VKERKV----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLAR 163

>KLLA0C05126g Chr3 complement(463657..464301) [645 bp, 214 aa] {ON}
           highly similar to uniprot|P32836 Saccharomyces
           cerevisiae YOR185C GSP2 GTP binding protein (mammalian
           Ranp homolog) involved in the maintenance of nuclear
           organization RNA processing and transport interacts with
           Kap121p Kap123p and Pdr6p (karyophilin betas) Gsp1p
           homolog that is not required for viability
          Length = 214

 Score = 94.4 bits (233), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 86/165 (52%), Gaps = 9/165 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +       VWDTAGQE
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGEIKFDVWDTAGQE 67

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           +F  L   +Y  A C ++++DVT+  +++N+  W  +      V   E  P V+ GNKVD
Sbjct: 68  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 122

Query: 129 VEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           V+E K     KA         N+  +  SAKS  N +  F  +AR
Sbjct: 123 VKERKV----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLAR 163

>SAKL0A07744g Chr1 (688406..689050) [645 bp, 214 aa] {ON} highly
           similar to uniprot|P32835 Saccharomyces cerevisiae
           YLR293C GSP1 GTP binding protein (mammalian Ranp
           homolog) involved in the maintenance of nuclear
           organization RNA processing and transport regulated by
           Prp20p Rna1p Yrb1p Yrb2p Yrp4p Yrb30p Cse1p and Kap95p
           yeast Gsp2p homolog
          Length = 214

 Score = 94.4 bits (233), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 86/165 (52%), Gaps = 9/165 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +       VWDTAGQE
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGEIKFDVWDTAGQE 67

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           +F  L   +Y  A C ++++DVT+  +++N+  W  +      V   E  P V+ GNKVD
Sbjct: 68  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 122

Query: 129 VEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           V+E K     KA         N+  +  SAKS  N +  F  +AR
Sbjct: 123 VKERKV----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLAR 163

>NDAI0D02670 Chr4 (618909..619571) [663 bp, 220 aa] {ON} Anc_6.90
          Length = 220

 Score = 93.2 bits (230), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 85/165 (51%), Gaps = 9/165 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +        WDTAGQE
Sbjct: 14  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNYGEIKFDCWDTAGQE 73

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           +F  L   +Y  A C ++++DVT+  +++N+  W  +      V   E  P V+ GNKVD
Sbjct: 74  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 128

Query: 129 VEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           V+E K     KA         N+  +  SAKS  N +  F  +AR
Sbjct: 129 VKERKV----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLAR 169

>NCAS0F00440 Chr6 complement(79004..79663) [660 bp, 219 aa] {ON}
           Anc_6.90 YLR293C
          Length = 219

 Score = 93.2 bits (230), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 85/165 (51%), Gaps = 9/165 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +        WDTAGQE
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFFTNYGEIKFDCWDTAGQE 72

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           +F  L   +Y  A C ++++DVT+  +++N+  W  +      V   E  P V+ GNKVD
Sbjct: 73  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 127

Query: 129 VEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           V+E K     KA         N+  +  SAKS  N +  F  +AR
Sbjct: 128 VKERKV----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLAR 168

>TBLA0E00980 Chr5 (224289..224954) [666 bp, 221 aa] {ON} Anc_6.90
           YLR293C
          Length = 221

 Score = 93.2 bits (230), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 85/165 (51%), Gaps = 9/165 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +        WDTAGQE
Sbjct: 15  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDCWDTAGQE 74

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           +F  L   +Y  A C ++++DVT+  +++N+  W  +      V   E  P V+ GNKVD
Sbjct: 75  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 129

Query: 129 VEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           V+E K     KA         N+  +  SAKS  N +  F  +AR
Sbjct: 130 VKERKV----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLAR 170

>KAFR0A04800 Chr1 (954630..955289) [660 bp, 219 aa] {ON} Anc_6.90
           YLR293C
          Length = 219

 Score = 92.8 bits (229), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 85/165 (51%), Gaps = 9/165 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +        WDTAGQE
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDCWDTAGQE 72

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           +F  L   +Y  A C ++++DVT+  +++N+  W  +      V   E  P V+ GNKVD
Sbjct: 73  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 127

Query: 129 VEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           V+E K     KA         N+  +  SAKS  N +  F  +AR
Sbjct: 128 VKERKV----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLAR 168

>TPHA0K01060 Chr11 (219078..219719) [642 bp, 213 aa] {ON} Anc_6.90
           YLR293C
          Length = 213

 Score = 92.8 bits (229), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 85/165 (51%), Gaps = 9/165 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +        WDTAGQE
Sbjct: 7   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFFTNFGEIKFDCWDTAGQE 66

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           +F  L   +Y  A C ++++DVT+  +++N+  W  +      V   E  P V+ GNKVD
Sbjct: 67  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 121

Query: 129 VEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           V+E K     KA         N+  +  SAKS  N +  F  +AR
Sbjct: 122 VKERKV----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLAR 162

>KNAG0F03180 Chr6 complement(598089..598973) [885 bp, 294 aa] {ON}
           Anc_6.90 YLR293C
          Length = 294

 Score = 94.4 bits (233), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 85/165 (51%), Gaps = 9/165 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +        WDTAGQE
Sbjct: 88  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDCWDTAGQE 147

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           +F  L   +Y  A C ++++DVT+  +++N+  W  +      V   E  P V+ GNKVD
Sbjct: 148 KFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 202

Query: 129 VEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           V+E K     KA         N+  +  SAKS  N +  F  +AR
Sbjct: 203 VKERKV----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLAR 243

>Kpol_1009.9 s1009 complement(23990..24631) [642 bp, 213 aa] {ON}
           complement(23990..24631) [642 nt, 214 aa]
          Length = 213

 Score = 92.8 bits (229), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 85/165 (51%), Gaps = 9/165 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
            K++++GD G GKT+ + R++  ++ ++Y ATIG +        +        WDTAGQE
Sbjct: 7   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFFTNFGEIKFDCWDTAGQE 66

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
           +F  L   +Y  A C ++++DVT+  +++N+  W  +      V   E  P V+ GNKVD
Sbjct: 67  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDL-----VRVCENIPIVLCGNKVD 121

Query: 129 VEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           V+E K     KA         N+  +  SAKS  N +  F  +AR
Sbjct: 122 VKERKV----KAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLAR 162

>NDAI0B04180 Chr2 (1055285..1056274) [990 bp, 329 aa] {ON} Anc_2.182
          Length = 329

 Score = 94.4 bits (233), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 100/175 (57%), Gaps = 8/175 (4%)

Query: 1   MSFRKKNI--LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVAT 58
           MS  K NI   K++++G  GVGK++L  + ++  +  +Y  TI  D   K+V +DDKV  
Sbjct: 1   MSLNKSNIREFKLVVVGGGGVGKSALTIQLIHSHFVDEYDPTI-EDSYRKQVVIDDKVTV 59

Query: 59  MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETF 118
           + V DTAGQE + ++   + R  +  VLVY +T+  SFE + T+  +      V   +  
Sbjct: 60  LDVLDTAGQEEYSAMREQYMRTGEGFVLVYSITSKNSFEELMTYYQQI---QRVKDSDYI 116

Query: 119 PFVILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           P VI+GNK D+E+ ++ V+ +A   LA  + N P   TSAK AINV+ AF  + R
Sbjct: 117 PVVIVGNKSDLEDERQ-VSYQAGVNLAKQM-NAPFLETSAKQAINVEEAFYTLVR 169

>Kpol_1066.11 s1066 complement(18137..18865) [729 bp, 242 aa] {ON}
           complement(18137..18865) [729 nt, 243 aa]
          Length = 242

 Score = 91.7 bits (226), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 50/148 (33%), Positives = 80/148 (54%), Gaps = 19/148 (12%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDD-------------- 54
           LK+++LGDS VGKTS++ R     +     ATIGA F+T  + VDD              
Sbjct: 19  LKLVLLGDSSVGKTSIVGRLTTGNFINS-NATIGAAFVTTTIEVDDEEMINGGNNGMSSK 77

Query: 55  ----KVATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHA 110
               K    ++WDTAGQER++SL   +YR  D  ++V+D++  +SF+  ++W +E   + 
Sbjct: 78  RSIKKRVNFEIWDTAGQERYRSLAPMYYRNTDVALIVFDLSRPQSFKGAQSWIEELNSYV 137

Query: 111 NVSSPETFPFVILGNKVDVEESKKLVTP 138
             SS      V++G+K D+E  +  + P
Sbjct: 138 EESSRGEIITVLVGSKKDIEIGQPSMAP 165

>KAFR0J01970 Chr10 (379033..379989) [957 bp, 318 aa] {ON} Anc_2.182
           YNL098C
          Length = 318

 Score = 92.8 bits (229), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 101/175 (57%), Gaps = 8/175 (4%)

Query: 1   MSFRKKNI--LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVAT 58
           MS  K NI   K++++G  GVGK++L  + ++  +  +Y  TI  D   K+V +D+KV  
Sbjct: 1   MSLNKSNIREYKLVVVGGGGVGKSALTIQLIHSHFVDEYDPTI-EDSYRKQVVIDNKVTI 59

Query: 59  MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETF 118
           + + DTAGQE + ++   + R  +  +LVY VT+  SFE + T+  +      V   +  
Sbjct: 60  LDILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFEELMTYYQQI---QRVKDSDYI 116

Query: 119 PFVILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           P VI+GNK D+E+ ++ V+ +  Q +AT + N P   TSAK AINV+ AF  + R
Sbjct: 117 PVVIVGNKSDLEDERQ-VSYEDGQHIATQM-NAPFLETSAKQAINVEEAFYSLVR 169

>CAGL0J05632g Chr10 complement(539466..540032) [567 bp, 188 aa] {ON}
           highly similar to uniprot|P06781 Saccharomyces
           cerevisiae YNL090w RHO2
          Length = 188

 Score = 90.1 bits (222), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 97/176 (55%), Gaps = 11/176 (6%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++I+GD   GKTSL++ +   K+ +QY  T+  +++T +  VD    ++ +WDTAGQE 
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYVT-DCRVDGIKVSLALWDTAGQEE 67

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKT-WKDEFLVHANVSSPETFPFVILGNKVD 128
           ++ L    Y GAD  ++ + V N +S  N +T W +E   +     P+  P +++G K D
Sbjct: 68  YERLRPFSYSGADVILIAFSVDNVESLHNARTKWAEEAFRYC----PDA-PVILVGLKED 122

Query: 129 VEESKK----LVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQNQ 180
           + +SK+     V  + A+++A ++G       SA +   VD  FE   RS+L  ++
Sbjct: 123 LRKSKQEGIVFVNREDAEQVAKAIGAKKYLECSALTGEGVDDVFELATRSSLLMHK 178

>NDAI0F02560 Chr6 complement(629428..630000) [573 bp, 190 aa] {ON} 
          Length = 190

 Score = 89.7 bits (221), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 98/178 (55%), Gaps = 13/178 (7%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++I+GD   GKTSL++ +   ++ Q+Y  T+  +++T +  VD    ++ +WDTAGQE 
Sbjct: 9   KLVIVGDGCCGKTSLLYVFTLGEFPQEYHPTVFENYVT-DCRVDGIKVSLTLWDTAGQEE 67

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKT-WKDEFLVHANVSSPETFPFVILGNKVD 128
           ++ L    Y  AD  ++ + V + +S EN +T W +E L +     P+  P +++G K D
Sbjct: 68  YERLRPFSYSNADIILVGFAVDDIESLENARTKWAEEVLRYC----PDA-PIILVGLKGD 122

Query: 129 VEE------SKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQNQ 180
           + E      +KK+V P+ AQ +A  +G       SA +   VD  FE   R++L  N+
Sbjct: 123 LREQGNGTSNKKMVRPEDAQHVARLVGAKKYLECSALTGAGVDDVFELATRTSLLVNK 180

>KLTH0H10274g Chr8 complement(882443..883048) [606 bp, 201 aa] {ON}
           weakly similar to uniprot|P36018 Saccharomyces
           cerevisiae YKR014C YPT52 rab5-like GTPase involved in
           vacuolar protein sorting and endocytosis; probable
           purine nucleotide-binding protein
          Length = 201

 Score = 89.7 bits (221), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 59/169 (34%), Positives = 89/169 (52%), Gaps = 18/169 (10%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQV----WDT 64
           LK+++LG+S VGK++L+ R+    + +   ATIGA F TK V+ +   A  QV    WDT
Sbjct: 10  LKLVLLGESSVGKSALVTRFTTGAFHKN-NATIGAAFTTKVVSWETNEAIKQVKFEIWDT 68

Query: 65  AGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILG 124
           AGQER++SL   +YR  D   +V+DVT++ +F    +W DE   +            ++G
Sbjct: 69  AGQERYRSLTPMYYRKTDVAFVVFDVTDDATFSKAGSWIDELKGYMQSEDAHDIIIKLVG 128

Query: 125 NKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           NK D+ +      P       T+L   P+   SAK+   V   FE +AR
Sbjct: 129 NKTDLLDH----VPD------TTLEWTPV---SAKTGEGVANLFESVAR 164

>Kwal_47.19055 s47 complement(1078494..1079033) [540 bp, 179 aa]
           {ON} YGL210W (YPT32) - ras-like GTPase, highly
           homologous to YPT31 [contig 188] FULL
          Length = 179

 Score = 89.0 bits (219), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 54/144 (37%), Positives = 83/144 (57%), Gaps = 14/144 (9%)

Query: 38  KATIGADFLTKEVTVDDKVATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFE 97
           K+TIG +F T+ + V+ K    Q+WDTAGQER++++  A+YRGA   ++VYD++ + S+E
Sbjct: 4   KSTIGVEFATRTIEVEGKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYE 63

Query: 98  NIKTWKDEFLVHANVSSPETFPFVILGNKVDVEESKKLVTPKA---AQELATSLGNIPLF 154
           N   W  E   +A+    E     ++GNK D+   + + T +A   AQE      N  LF
Sbjct: 64  NCNHWLTELRENAD----ENVAVGLIGNKSDLAHLRAVPTDEAKNFAQE------NQLLF 113

Query: 155 L-TSAKSAINVDTAFEEIARSALQ 177
             TSA ++ NVD AF E+  +  Q
Sbjct: 114 TETSALNSENVDQAFRELISAIYQ 137

>NDAI0B04680 Chr2 complement(1157279..1157950) [672 bp, 223 aa] {ON}
           Anc_1.338
          Length = 223

 Score = 89.4 bits (220), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 58/178 (32%), Positives = 99/178 (55%), Gaps = 15/178 (8%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDD----------KVAT 58
           LKV++LG+S VGKTS++ +    K+ Q+  ATIGA F TK++  ++          KV+ 
Sbjct: 13  LKVVLLGESSVGKTSIVTKISTGKF-QKGAATIGAAFTTKQIQFNEIEENGVEQCFKVS- 70

Query: 59  MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSS--PE 116
           +++WDTAGQER++SL   +YR  D  ++V+D+T   S +  ++W DE   + + SS   +
Sbjct: 71  IEIWDTAGQERYRSLTPMYYRNTDVALIVFDLTQEASLKKARSWIDELKSYLDSSSRRDK 130

Query: 117 TFPFVILGNKVD-VEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
               +++ NKVD V ++          E        PL + SAK+   ++  F++I +
Sbjct: 131 HISMILVANKVDLVAKNDGTFDINQYLENWDIPSEYPLKIVSAKTNEGINELFDDIIK 188

>KAFR0J01240 Chr10 complement(229638..230201) [564 bp, 187 aa] {ON}
           Anc_2.200 YNL090W
          Length = 187

 Score = 87.4 bits (215), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 95/170 (55%), Gaps = 8/170 (4%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++I+GD   GKTSL++ +   K+ ++Y  T+  +++T +  VD    ++ +WDTAGQE 
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPEEYHPTVFENYVT-DCRVDGIKVSLALWDTAGQEE 67

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           ++ L    Y  AD  ++ + V + +S EN    +D++ V A    PE  P +++G K D+
Sbjct: 68  YERLRPFSYSNADVILIAFAVDDVESLENT---RDKWAVEALRYCPEV-PIILVGLKKDL 123

Query: 130 EES---KKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSAL 176
            ++    ++V P+  Q++A ++G       SA +   VD  FE   R++L
Sbjct: 124 RQANNKNRMVRPEDVQKIARAVGAKNYMECSALTGEGVDDVFEVATRTSL 173

>NCAS0B06850 Chr2 (1305199..1306173) [975 bp, 324 aa] {ON} Anc_2.182
          Length = 324

 Score = 90.1 bits (222), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 64/175 (36%), Positives = 99/175 (56%), Gaps = 8/175 (4%)

Query: 1   MSFRKKNI--LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVAT 58
           MS  K NI   K++++G  GVGK++L  + ++  +  +Y  TI  D   K+V +DDKV  
Sbjct: 1   MSLNKSNIREYKLVVVGGGGVGKSALTIQLIHSHFVDEYDPTI-EDSYRKQVVIDDKVTV 59

Query: 59  MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETF 118
           + V DTAGQE + ++   + R  +  +LVY VT+  SFE + T+  +      V   +  
Sbjct: 60  LDVLDTAGQEEYSAMREQYMRTGEGFLLVYSVTSKNSFEELLTYYQQI---QRVKDSDYI 116

Query: 119 PFVILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           P VI+GNK D+E+ ++ V  ++   LA  + N P   TSAK AINV+ AF  + R
Sbjct: 117 PVVIVGNKSDLEDERQ-VPYQSGVNLAKQM-NAPFLETSAKQAINVEEAFYTLVR 169

>NCAS0G02730 Chr7 (491357..491920) [564 bp, 187 aa] {ON} 
          Length = 187

 Score = 87.4 bits (215), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 97/175 (55%), Gaps = 10/175 (5%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++I+GD   GKTSL++ +   K+ Q+Y  T+  +++T +  VD    ++ +WDTAGQE 
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPQEYHPTVFENYVT-DCRVDGIKVSLTLWDTAGQEE 67

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKT-WKDEFLVHANVSSPETFPFVILGNKVD 128
           ++ L    Y  AD  ++ + + + +S +N +  W +E L +     PE  P +++G K D
Sbjct: 68  YERLRPFSYSKADIILIGFAINDTESLDNARNKWTEEALRYC----PEA-PIILVGLKKD 122

Query: 129 VEESK---KLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQNQ 180
           + + +   ++V P+ AQ++A  +G       SA +   VD  FE   R++L  N+
Sbjct: 123 LRQKQDGVEMVKPEDAQQVARIIGAKKYVECSALTGEGVDDVFELATRTSLLVNK 177

>KNAG0M01830 Chr13 complement(339904..340464) [561 bp, 186 aa] {ON} 
          Length = 186

 Score = 86.7 bits (213), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 93/170 (54%), Gaps = 9/170 (5%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++I+GD   GKTSL++ +   ++ Q+Y+ T+  +++T +  VD     + +WDTAGQE 
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGQFPQEYQPTVFENYVT-DCRVDGIKVMLALWDTAGQEE 67

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIK-TWKDEFLVHANVSSPETFPFVILGNKVD 128
           ++ L    Y  AD  V+ + V +  S EN +  W  E   +     P+  P V++G K D
Sbjct: 68  YERLRPFSYSKADIIVIGFAVDDEDSLENARDKWAQEVFRYC----PDA-PIVLVGLKND 122

Query: 129 VEES--KKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSAL 176
           +  +   KLV+P+ A+++A ++G       SA +   VD  FE   R++L
Sbjct: 123 LRNNVDAKLVSPQMAEQVARAIGAKKYMECSALTGEGVDDVFEVATRTSL 172

>TDEL0F02770 Chr6 complement(507090..507806) [717 bp, 238 aa] {ON}
           Anc_4.73 YGR152C
          Length = 238

 Score = 87.8 bits (216), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 94/168 (55%), Gaps = 5/168 (2%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K+++LG  GVGK+ L  ++V   Y   Y  TI  D   K V +D+KVA +++ DTAG  +
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDSYDPTI-EDSYRKTVEIDNKVADLEILDTAGVAQ 63

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           F ++   + +     +LVY VT+ +S E +   +++ L    +      P V++GNK D+
Sbjct: 64  FTAMRELYIKSGMGFLLVYSVTDRQSLEELLDLREQVL---RIKDMNRVPMVLVGNKADL 120

Query: 130 EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQ 177
           ++ +++++ +   E+++  G +P + TSA    NVD  F ++ R  ++
Sbjct: 121 KD-ERVISVEEGIEVSSDWGKVPFYETSALLRSNVDEVFIDLVRQIIR 167

>KLTH0G08294g Chr7 (678358..678921) [564 bp, 187 aa] {ON} highly
           similar to uniprot|P06781 Saccharomyces cerevisiae
           YNL090W RHO2 Non-essential small GTPase of the Rho/Rac
           subfamily of Ras-like proteins involved in the
           establishment of cell polarity and in microtubule
           assembly
          Length = 187

 Score = 85.9 bits (211), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 96/175 (54%), Gaps = 10/175 (5%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++I+GD   GKTSL++ +   K+ ++Y  T+  +++T +  VD    ++ +WDTAGQE 
Sbjct: 9   KLVIIGDGACGKTSLLYVFALGKFPKEYHPTVFENYVT-DCRVDGIKVSLALWDTAGQEE 67

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKT-WKDEFLVHANVSSPETFPFVILGNKVD 128
           ++ L    Y  A+  ++ + + + +S  N +T W +E L +     PE  P V++G K D
Sbjct: 68  YERLRPFSYSKANVILIGFAIDDAESLLNARTKWTEEALRYC----PEA-PIVLVGLKRD 122

Query: 129 V---EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQNQ 180
           +   E S K VT + A+++A ++G       SA     VD  FE   R++L  N+
Sbjct: 123 LRKSESSHKFVTREEAEQVARAIGAKKYMECSALDGSGVDDVFELATRTSLLVNK 177

>Kwal_14.2484 s14 complement(777938..778549) [612 bp, 203 aa] {ON}
           YOR089C (VPS21) - small GTP-binding protein;
           geranylgeranylated; geranylgeranylation required for
           membrane association; also involved in endocytosis post
           vesicle internalization [contig 224] FULL
          Length = 203

 Score = 85.9 bits (211), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 88/169 (52%), Gaps = 18/169 (10%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVAT----MQVWDT 64
           LK+++LG+S VGK++L+ R+    +  +  ATIGA F TK ++ + + A      ++WDT
Sbjct: 10  LKLVLLGESSVGKSALVTRFTTGSF-HKSNATIGAAFTTKVISWETETARKEVKFEIWDT 68

Query: 65  AGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILG 124
           AGQER+++L   +YR  D   +V+DVT   +     +W  E   +            ++G
Sbjct: 69  AGQERYRALTPMYYRNTDVAFVVFDVTEESTSLKADSWVQELKSYMEGEEAHNIVIKLIG 128

Query: 125 NKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           NK+D+ +    V P+        +G  P+   SAK+   V   FE +AR
Sbjct: 129 NKIDLLDE---VPPR-------KVGWTPV---SAKTGEGVADLFESVAR 164

>YOR101W Chr15 (515244..516173) [930 bp, 309 aa] {ON}  RAS1GTPase
           involved in G-protein signaling in the adenylate cyclase
           activating pathway, plays a role in cell proliferation;
           localized to the plasma membrane; homolog of mammalian
           RAS proto-oncogenes
          Length = 309

 Score = 87.4 bits (215), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 52/153 (33%), Positives = 86/153 (56%), Gaps = 6/153 (3%)

Query: 21  KTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQERFQSLGVAFYRG 80
           K++L  +++   +  +Y  TI  D   K+V +DDKV+ + + DTAGQE + ++   + R 
Sbjct: 23  KSALTIQFIQSYFVDEYDPTI-EDSYRKQVVIDDKVSILDILDTAGQEEYSAMREQYMRT 81

Query: 81  ADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDVEESKKLVTPKA 140
            +  +LVY VT+  SF+ + ++  +      V   +  P V++GNK+D+E  ++ V+ + 
Sbjct: 82  GEGFLLVYSVTSRNSFDELLSYYQQI---QRVKDSDYIPVVVVGNKLDLENERQ-VSYED 137

Query: 141 AQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
              LA  L N P   TSAK AINVD AF  + R
Sbjct: 138 GLRLAKQL-NAPFLETSAKQAINVDEAFYSLIR 169

>Kwal_14.2244 s14 (671441..672175) [735 bp, 244 aa] {ON} YGR152C
           (RSR1) - GTP-binding protein, ras superfamily [contig
           227] FULL
          Length = 244

 Score = 85.9 bits (211), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 93/168 (55%), Gaps = 5/168 (2%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K+++LG  GVGK+ L  ++V   Y   Y  TI  D   K + +D+KV  +++ DTAG  +
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTI-EDSYRKTMEIDNKVFDLEILDTAGVAQ 63

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           F ++   + +     +LVY VT+ +S E +   +++ L    +      P V++GNK D+
Sbjct: 64  FTAMRELYIKSGMGFLLVYSVTDRQSLEELIELREQVL---RIKDNSRVPMVLVGNKADL 120

Query: 130 EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQ 177
           ++ +++++ +   E+++  G +P + TSA    NVD  F ++ R  ++
Sbjct: 121 QD-ERVISVEEGIEMSSKWGKVPFYETSALLRSNVDEVFVDVVRQIIR 167

>ZYRO0G07018g Chr7 complement(559273..560025) [753 bp, 250 aa] {ON}
           similar to uniprot|P13856 Saccharomyces cerevisiae
           YGR152C RSR1 GTP-binding protein of the ras superfamily
           required for bud site selection, morphological changes
           in response to mating pheromone, and efficient cell
           fusion; localized to the plasma membrane; significantly
           similar to mammalian Rap GTPases
          Length = 250

 Score = 86.3 bits (212), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 94/168 (55%), Gaps = 5/168 (2%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K+++LG  GVGK+ L  ++V   Y   Y  TI  D   K + +D+KV  +++ DTAG  +
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTI-EDSYRKTIEIDNKVFDLEILDTAGVAQ 63

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           F ++   + +     +LVY VT+ +S E +   +++ L   +VS     P V++GNK D+
Sbjct: 64  FTAMRELYIKSGMGFLLVYSVTDRQSLEELLDLREQVLRIKDVSR---VPMVLVGNKADL 120

Query: 130 EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQ 177
            + +++V+ +   E+++  G +P + TSA    NVD  F ++ R  ++
Sbjct: 121 GD-ERVVSVEEGIEVSSKWGKVPFYETSALLRSNVDEVFVDLVRQIMR 167

>CAGL0B04521g Chr2 complement(439732..440751) [1020 bp, 339 aa] {ON}
           similar to uniprot|P01120 Saccharomyces cerevisiae
           YNL098c RAS2 GTP-binding protein or uniprot|P01119
           Saccharomyces cerevisiae YOR101w RAS1
          Length = 339

 Score = 87.4 bits (215), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 55/153 (35%), Positives = 84/153 (54%), Gaps = 6/153 (3%)

Query: 21  KTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQERFQSLGVAFYRG 80
           K++L  + V+  +  +Y  TI  D   K+V +DDKV  + + DTAGQE + ++   + R 
Sbjct: 21  KSALTIQLVHSHFVDEYDPTI-EDSYRKQVVIDDKVTILDILDTAGQEEYSAMREQYMRT 79

Query: 81  ADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDVEESKKLVTPKA 140
            +  +LVY VT+  SFE + T+  +      V   E  P V++GNK D+E  +++   + 
Sbjct: 80  GEGFLLVYSVTSRTSFEELITYYQQI---QRVKDVEYIPVVVVGNKSDLETERQVSFEEG 136

Query: 141 AQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           A  LA  L N P   TSAK AINV+ AF  + R
Sbjct: 137 A-SLAKQL-NAPFLETSAKQAINVEDAFYTLVR 167

>SAKL0E09834g Chr5 complement(819736..820308) [573 bp, 190 aa] {ON}
           highly similar to uniprot|P06781 Saccharomyces
           cerevisiae YNL090W RHO2 Non-essential small GTPase of
           the Rho/Rac subfamily of Ras-like proteins involved in
           the establishment of cell polarity and in microtubule
           assembly
          Length = 190

 Score = 84.0 bits (206), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 98/176 (55%), Gaps = 11/176 (6%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++I+GD   GKTSL++ +   K+ ++Y  T+  +++T +  VD     + +WDTAGQE 
Sbjct: 11  KLVIIGDGACGKTSLLYVFTLGKFPEEYHPTVFENYVT-DCRVDGIKVQLALWDTAGQEE 69

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKT-WKDEFLVHANVSSPETFPFVILGNKVD 128
           ++ L    Y  A+  ++ + + + +S  N +T W +E L +       T P V++G K D
Sbjct: 70  YERLRPFSYSKANIILIGFAIDDPESLMNARTKWTEEALRYC-----PTAPIVLVGLKKD 124

Query: 129 VEES----KKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQNQ 180
           + +S    +++VT +AA+++A ++G       SA +   VD  FE   R++L  N+
Sbjct: 125 LRKSVGNGEEVVTREAAEQVARAIGAKRYMECSALTGEGVDDIFEVATRTSLLVNK 180

>Skud_15.266 Chr15 (471563..472504) [942 bp, 313 aa] {ON} YOR101W
           (REAL)
          Length = 313

 Score = 86.3 bits (212), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 52/153 (33%), Positives = 85/153 (55%), Gaps = 6/153 (3%)

Query: 21  KTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQERFQSLGVAFYRG 80
           K++L  + +   +  +Y  TI  D   K+V +DDKV+ + + DTAGQE + ++   + R 
Sbjct: 23  KSALTIQLIQSYFVDEYDPTI-EDSYRKQVVIDDKVSILDILDTAGQEEYSAMREQYMRT 81

Query: 81  ADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDVEESKKLVTPKA 140
            +  +LVY VT+  SF+ + ++  +      V   +  P V++GNK+D+E  ++ V+ + 
Sbjct: 82  GEGFLLVYSVTSRNSFDELLSYYQQI---QRVKDSDYIPVVVVGNKLDLENERQ-VSYED 137

Query: 141 AQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
              LA  L N P   TSAK AINVD AF  + R
Sbjct: 138 GLRLAKQL-NAPFLETSAKQAINVDEAFYSLIR 169

>Suva_7.443 Chr7 complement(764401..765216) [816 bp, 271 aa] {ON}
           YGR152C (REAL)
          Length = 271

 Score = 85.5 bits (210), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 93/168 (55%), Gaps = 5/168 (2%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K+++LG  GVGK+ L  ++V   Y   Y  TI  D   K + +D+KV  +++ DTAG  +
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTI-EDSYRKTIEIDNKVFDLEILDTAGIAQ 63

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           F ++   + +     +LVY VT+ +S E +   +++ L    +   +  P V++GNK D+
Sbjct: 64  FTAMRELYIKSGMGFLLVYSVTDRQSLEELMELREQVL---RIKDSDRVPMVLIGNKADL 120

Query: 130 EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQ 177
             ++++++ +   E+++  G +P + TSA    NVD  F ++ R  ++
Sbjct: 121 -NNERVISVEEGIEVSSKWGRVPFYETSALLRSNVDEVFVDLVRQIIR 167

>ZYRO0C15466g Chr3 complement(1208350..1208919) [570 bp, 189 aa]
           {ON} highly similar to uniprot|P06781 Saccharomyces
           cerevisiae YNL090W RHO2 Non-essential small GTPase of
           the Rho/Rac subfamily of Ras-like proteins involved in
           the establishment of cell polarity and in microtubule
           assembly
          Length = 189

 Score = 83.6 bits (205), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 95/177 (53%), Gaps = 12/177 (6%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++I+GD   GKTSL++ +   ++ Q+Y  T+  +++T +  VD    T+ +WDTAGQE 
Sbjct: 9   KLVIIGDGACGKTSLLYVFALGQFPQEYHPTVFENYVT-DCRVDGIKVTLTLWDTAGQEE 67

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKT-WKDEFLVHANVSSPETFPFVILGNKVD 128
           ++ L    Y  AD  ++ + V + +S  N KT W +E L       P+  P +++G K D
Sbjct: 68  YERLRPFSYANADILLMGFAVDDPESLLNSKTKWAEEALRFC----PDA-PIILVGLKKD 122

Query: 129 VEESK-----KLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQNQ 180
           + + K     +LV+   AQ++A  +G       SA +   VD  FE   R++L  N+
Sbjct: 123 LRQIKGSLQNELVSIDEAQQVARHIGAKKYLECSALTGDGVDDVFEIATRTSLLVNK 179

>Skud_7.476 Chr7 complement(778308..779126) [819 bp, 272 aa] {ON}
           YGR152C (REAL)
          Length = 272

 Score = 85.1 bits (209), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 93/168 (55%), Gaps = 5/168 (2%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K+++LG  GVGK+ L  ++V   Y   Y  TI  D   K + +D+KV  +++ DTAG  +
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTI-EDSYRKTIEIDNKVFDLEILDTAGIAQ 63

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           F ++   + +     +LVY VT+ +S E +   +++ L    +   +  P V++GNK D+
Sbjct: 64  FTAMRELYIKSGMGFLLVYSVTDRQSLEELMELREQVL---RIKDSDRVPMVLIGNKADL 120

Query: 130 EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQ 177
             ++++++ +   E+++  G +P + TSA    NVD  F ++ R  ++
Sbjct: 121 -INERIISVEEGIEVSSKWGRVPFYETSALLRSNVDEVFVDLVRQIIR 167

>TDEL0C04630 Chr3 complement(837302..837877) [576 bp, 191 aa] {ON}
           Anc_2.200 YNL090W
          Length = 191

 Score = 83.2 bits (204), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/179 (30%), Positives = 95/179 (53%), Gaps = 14/179 (7%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++I+GD   GKTSL++ +   K+ ++Y  T+  +++T +  VD    ++ +WDTAGQE 
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPEEYHPTVFENYVT-DCRVDGIKVSLTLWDTAGQEE 67

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKT-WKDEFLVHANVSSPETFPFVILGNKVD 128
           ++ L    Y  AD  ++ + V + +S  N +T W +E L +     P+  P +++G K D
Sbjct: 68  YERLRPFSYSKADIILIGFAVDDPESLINARTKWAEEALRYC----PDA-PIILVGLKKD 122

Query: 129 VEES-------KKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQNQ 180
           +  S       +K V+   AQ++A  +G       SA S   VD  FE   R++L  N+
Sbjct: 123 LRRSHEENAQGEKFVSLADAQQIAKQIGAKKYLECSALSGEGVDDVFELATRTSLLVNK 181

>Suva_14.250 Chr14 (455251..455829) [579 bp, 192 aa] {ON} YNL090W
           (REAL)
          Length = 192

 Score = 83.2 bits (204), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 95/176 (53%), Gaps = 15/176 (8%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++I+GD   GKTSL++ +   K+ +QY  T+  +++T +  VD    ++ +WDTAGQE 
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYVT-DCRVDGIKVSLTLWDTAGQEE 67

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKT-WKDEFLVHANVSSPETFPFVILGNKVD 128
           ++ L    Y  AD  ++ + V N++S  N +T W DE L +     P+  P V++G K D
Sbjct: 68  YERLRPFSYSKADIILIGFAVDNSESLINARTKWADEALRYC----PDA-PIVLVGLKKD 122

Query: 129 VEESK--------KLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSAL 176
           + +          ++V  + A+++A ++G       SA +   VD  FE   R++L
Sbjct: 123 LRQEAHFKENAVDEMVPAEDAKQVARAIGAKKYMECSALTGEGVDDVFEVATRTSL 178

>ZYRO0D03146g Chr4 complement(244206..245039) [834 bp, 277 aa] {ON}
           similar to uniprot|Q00246 Saccharomyces cerevisiae
           YKR055W RHO4 Non-essential small GTPase of the Rho/Rac
           subfamily of Ras-like proteins likely to be involved in
           the establishment of cell polarity
          Length = 277

 Score = 85.1 bits (209), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 51/172 (29%), Positives = 86/172 (50%), Gaps = 7/172 (4%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
           LK++++GD  VGKT L+  YV  ++   Y  T+  +++T+     +K+  + +WDTAGQE
Sbjct: 73  LKIVVVGDGAVGKTCLLISYVQRRFPTDYVPTVFENYVTRIQGPQNKIIELALWDTAGQE 132

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
            +  L    Y   D  ++ Y   N  S +N+    D +        P+  P +++G K D
Sbjct: 133 EYSRLRPLSYSEVDILLVCYAANNPTSLQNV---DDLWFPEVTHFCPDV-PIMLVGLKSD 188

Query: 129 V---EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQ 177
           +   +++  LV P+ A+ LA  LG       SAK+  NV+  F     +AL 
Sbjct: 189 LYANDDTSNLVDPREAESLALKLGAFSHIQCSAKTRNNVELVFTTAMDTALH 240

>KLLA0F01232g Chr6 complement(114430..115062) [633 bp, 210 aa] {ON}
           similar to uniprot|P36019 Saccharomyces cerevisiae
           YNL093W YPT53 Involved in vacuolar protein sorting and
           endocytosis GTP-binding protein of the rab family
          Length = 210

 Score = 83.6 bits (205), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 51/171 (29%), Positives = 89/171 (52%), Gaps = 19/171 (11%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDD------KVATMQVW 62
           +K+++LG+S VGK++++ R+   ++      TIGA F TK +   D      +    ++W
Sbjct: 10  VKLVLLGESSVGKSTIVTRFTTGEFHIN-SPTIGAAFSTKAMEWVDSEDGIKRRVNFEIW 68

Query: 63  DTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVI 122
           DTAGQER++SL   +YR  D  ++V+DVT   S +  ++W DE   +      +T    +
Sbjct: 69  DTAGQERYRSLAPMYYRNTDVALIVFDVTQLASEKKAQSWIDELNNYLEDYKKDTVQLRV 128

Query: 123 LGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           +GNK+D+ + + L     A+            L SAK+   +D  F +I +
Sbjct: 129 VGNKIDLVDEETLQNWNDAE------------LVSAKTGEGIDELFLKIGK 167

>KAFR0F03670 Chr6 complement(726736..727527) [792 bp, 263 aa] {ON}
           Anc_4.73 YGR152C
          Length = 263

 Score = 84.7 bits (208), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 93/168 (55%), Gaps = 5/168 (2%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K+++LG  GVGK+ L  ++V   Y   Y  TI  D   K + +D+KV  +++ DTAG  +
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTI-EDSYRKTIEIDNKVFDLEILDTAGVAQ 63

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           F ++   + +     +LVY VT+ +S + +   +++ L    +   +  P V++GNK D+
Sbjct: 64  FTAMRELYIKSGMGFLLVYSVTDQRSLDELMELREQVL---RIKDSDKVPMVLVGNKADL 120

Query: 130 EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQ 177
            + +++++ +   E+++  G +P + TSA    NVD  F ++ R  ++
Sbjct: 121 TD-ERVISVEDGIEISSKWGKVPFYETSALLRSNVDEVFVDVVRQIIR 167

>Smik_15.281 Chr15 (476294..477232) [939 bp, 312 aa] {ON} YOR101W
           (REAL)
          Length = 312

 Score = 85.5 bits (210), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/153 (33%), Positives = 85/153 (55%), Gaps = 6/153 (3%)

Query: 21  KTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQERFQSLGVAFYRG 80
           K++L  + +   +  +Y  TI  D   K+V +DDKV+ + + DTAGQE + ++   + R 
Sbjct: 23  KSALTIQLIQSYFVDEYDPTI-EDSYRKQVVIDDKVSILDILDTAGQEEYSAMREQYMRT 81

Query: 81  ADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDVEESKKLVTPKA 140
            +  +LVY VT+  SF+ + ++  +      V   +  P V++GNK+D+E  ++ V+ + 
Sbjct: 82  GEGFLLVYSVTSRNSFDELLSYYQQI---QRVKDSDYIPVVVVGNKLDLENERQ-VSYED 137

Query: 141 AQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
              LA  L N P   TSAK AINVD AF  + R
Sbjct: 138 GLRLAKQL-NAPFLETSAKQAINVDEAFYSLIR 169

>KLTH0D08932g Chr4 (742772..742786,742899..743762) [879 bp, 292 aa]
           {ON} similar to uniprot|P01120 Saccharomyces cerevisiae
           YNL098C RAS2 GTP-binding protein that regulates the
           nitrogen starvation response, sporulation, and
           filamentous growth; farnesylation and palmitoylation
           required for activity and localization to plasma
           membrane; homolog of mammalian Ras proto-oncogenes
          Length = 292

 Score = 85.1 bits (209), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 62/178 (34%), Positives = 97/178 (54%), Gaps = 14/178 (7%)

Query: 1   MSFRKKNI--LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVAT 58
           MS  K NI   K++++G  GVGK++L  + +   +  +Y  TI  D   K+V VD KV+ 
Sbjct: 1   MSLNKNNIREYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTI-EDSYRKQVVVDGKVSI 59

Query: 59  MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETF 118
           + + DTAGQE + ++   + R  +  +LVY VT+  SFE + T+  + L    V   +  
Sbjct: 60  LDILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFEELMTYYQQIL---RVKDADYV 116

Query: 119 PFVILGNKVDVEESKKLVTPKAAQELATSLG---NIPLFLTSAKSAINVDTAFEEIAR 173
           P  ++GNK D+E+ +++     A E   SL    N P   TSAK AINV+ +F  + R
Sbjct: 117 PVFLVGNKSDLEDERQV-----AYEEGVSLAKQFNAPFLETSAKQAINVEESFYGLVR 169

>KLTH0H09042g Chr8 (776732..777460) [729 bp, 242 aa] {ON} similar to
           uniprot|P13856 Saccharomyces cerevisiae YGR152C RSR1
           GTP-binding protein of the ras superfamily required for
           bud site selection, morphological changes in response to
           mating pheromone, and efficient cell fusion; localized
           to the plasma membrane; significantly similar to
           mammalian Rap GTPases
          Length = 242

 Score = 84.0 bits (206), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 93/168 (55%), Gaps = 5/168 (2%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K+++LG  GVGK+ L  ++V   Y   Y  TI  D   K + +D+KV  +++ DTAG  +
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTI-EDSYRKTMEIDNKVFDLEILDTAGVAQ 63

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           F ++   + +     +LVY VT+ +S E +   +++ L    +      P V++GNK D+
Sbjct: 64  FTAMRELYIKSGMGFLLVYSVTDRQSLEELIELREQVL---RIKDSTRVPMVLVGNKADL 120

Query: 130 EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQ 177
           ++ +++++ +   E++++ G +P + TSA    NVD  F +  R  ++
Sbjct: 121 QD-ERVISVEEGIEMSSNWGKVPFYETSALLRSNVDEVFVDAVRQIIR 167

>KLLA0C13816g Chr3 (1183412..1183975) [564 bp, 187 aa] {ON} highly
           similar to uniprot|P06781 Saccharomyces cerevisiae
           YNL090W RHO2 Non-essential small GTPase of the Rho/Rac
           subfamily of Ras-like proteins involved in the
           establishment of cell polarity and in microtubule
           assembly
          Length = 187

 Score = 82.8 bits (203), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/175 (29%), Positives = 96/175 (54%), Gaps = 10/175 (5%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++I+GD   GKTSL++ +   ++ ++Y  T+  +++T +  VD     + +WDTAGQE 
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGQFPEEYHPTVFENYVT-DCRVDGIKVQLTLWDTAGQEE 67

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKT-WKDEFLVHANVSSPETFPFVILGNKVD 128
           ++ L    Y  AD  ++ + + + +S  N +  W +E L +     PE  P V++G K D
Sbjct: 68  YERLRPFSYSKADIILIGFAIDDPESLVNARNKWSEEVLRYC----PEA-PVVLVGLKKD 122

Query: 129 V---EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQNQ 180
           +   +   ++VT + A+++A ++G       SA +  NVD  FE   R++L  N+
Sbjct: 123 LRSPDNEHQMVTREQAEQVARAIGAKKYMECSALTGENVDDVFEVATRTSLLVNK 177

>NDAI0D03820 Chr4 complement(908209..909015) [807 bp, 268 aa] {ON}
           Anc_4.73
          Length = 268

 Score = 84.7 bits (208), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 93/168 (55%), Gaps = 5/168 (2%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K+++LG  GVGK+ L  ++V   Y   Y  TI  D   K + +D+KV  +++ DTAG  +
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTI-EDSYRKTIEIDNKVFDLEILDTAGVAQ 63

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           F ++   + +     +LVY VT+ +S + +   +++ L    +      P V++GNK D+
Sbjct: 64  FTAMRELYIKSGMGFLLVYSVTDRQSLDELMELREQVL---RIKDSSKVPMVLVGNKADL 120

Query: 130 EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQ 177
            + +++++ +   E++++ G +P + TSA    NVD  F ++ R  ++
Sbjct: 121 ND-ERVISVEEGIEVSSTWGKVPFYETSALLRSNVDEVFVDLVRQIMR 167

>Smik_6.257 Chr6 complement(414005..414820) [816 bp, 271 aa] {ON}
           YGR152C (REAL)
          Length = 271

 Score = 84.3 bits (207), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 93/168 (55%), Gaps = 5/168 (2%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K+++LG  GVGK+ L  ++V   Y   Y  TI  D   K + +D+KV  +++ DTAG  +
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTI-EDSYRKTIEIDNKVFDLEILDTAGIAQ 63

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           F ++   + +     +LVY VT+ +S E +   +++ L    +   +  P V++GNK D+
Sbjct: 64  FTAMRELYIKSGMGFLLVYSVTDRQSLEELMELREQVL---RIKDSDRVPMVLIGNKADL 120

Query: 130 EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQ 177
             ++++++ +   E+++  G +P + TSA    NVD  F ++ R  ++
Sbjct: 121 -INERVISVEEGIEVSSKWGRVPFYETSALLRSNVDEVFVDLVRQIIR 167

>NCAS0B08090 Chr2 (1545134..1546003) [870 bp, 289 aa] {ON} Anc_1.215
          Length = 289

 Score = 84.7 bits (208), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 57/173 (32%), Positives = 89/173 (51%), Gaps = 10/173 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
           +K++I+GD GVGKT L+  YV  ++      T+  +++T     D +V  + +WDTA QE
Sbjct: 64  VKIVIVGDEGVGKTCLLISYVQREFPTGDIPTVFENYVTDFEGPDGEVVELALWDTAAQE 123

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIK-TWKDEFLVHANVSSPETFPFVILGNKV 127
            +  L    Y   D  ++ Y V N  S +NIK +W  E + H    +    P +++G K 
Sbjct: 124 DYNRLRPLSYTDVDILLVCYSVANPTSLKNIKRSWIPE-VKHFCYKT----PVILVGLKS 178

Query: 128 DV----EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSAL 176
           D+    E +  LV PK A++LA  LG +     SAK+  NV+  F    R+ L
Sbjct: 179 DLYDSNENTDTLVDPKEAEQLAEKLGALAHLQCSAKTRQNVEDVFTVAIRTVL 231

>Ecym_5365 Chr5 (743477..744046) [570 bp, 189 aa] {ON} similar to
           Ashbya gossypii ACL087C
          Length = 189

 Score = 82.8 bits (203), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 94/176 (53%), Gaps = 10/176 (5%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++I+GD   GKTSL+H +   K+ ++Y+ TI  +++T +  VD     + +WDTAGQE 
Sbjct: 9   KLVIIGDGACGKTSLLHVFTLGKFPEEYQPTIFENYVT-DCRVDGIRVQLALWDTAGQEE 67

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           ++ L    Y  AD  ++ + + + +S  N    ++++ V A    P   P +++G K D+
Sbjct: 68  YERLRPMSYSKADIILIGFAIDDAESLLNA---REKWTVEALRYCPSA-PIILVGLKKDL 123

Query: 130 EESK-----KLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQNQ 180
            +S      ++V    AQE+A ++G       SA +   VD  FE   R++L  N+
Sbjct: 124 RKSNSIDRAEMVNLSQAQEVAKAIGAKKYMECSALTGEGVDDVFELATRTSLLVNR 179

>YKR055W Chr11 (548216..549091) [876 bp, 291 aa] {ON}
           RHO4Non-essential small GTPase of the Rho/Rac subfamily
           of Ras-like proteins, likely to be involved in the
           establishment of cell polarity
          Length = 291

 Score = 84.7 bits (208), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 53/171 (30%), Positives = 85/171 (49%), Gaps = 7/171 (4%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
           LK++++GD  VGKT L+  YV   +   Y  TI  +++T     + ++  + +WDTAGQE
Sbjct: 73  LKIVVVGDGAVGKTCLLISYVQGTFPTDYIPTIFENYVTNIEGPNGQIIELALWDTAGQE 132

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
            +  L    Y  AD  ++ Y V +  S +N+   +D +        P T P +++G K D
Sbjct: 133 EYSRLRPLSYTNADVLMVCYSVGSKTSLKNV---EDLWFPEVKHFCPST-PIMLVGLKSD 188

Query: 129 VEES---KKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSAL 176
           + E+     LV P +A+ LA  LG       SA+   N+D  FE    + L
Sbjct: 189 LYEADNLSDLVEPSSAESLAKRLGAFAHIQCSARLKENIDEVFETAIHTLL 239

>SAKL0C06424g Chr3 complement(591532..592395) [864 bp, 287 aa] {ON}
           similar to uniprot|Q00246 Saccharomyces cerevisiae
           YKR055W RHO4 Non-essential small GTPase of the Rho/Rac
           subfamily of Ras-like proteins likely to be involved in
           the establishment of cell polarity
          Length = 287

 Score = 84.7 bits (208), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 87/172 (50%), Gaps = 9/172 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
           LK++++GD  VGKT L+  Y   ++  +Y  TI  ++++K     +KV  + +WDTAGQE
Sbjct: 78  LKIVVVGDGAVGKTCLLISYTQGRFPTEYVPTIFENYVSKVQGPRNKVIELALWDTAGQE 137

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKT-WKDEFLVHANVSSPETFPFVILGNKV 127
            +  L    Y   D  ++ Y V +  SF N++  W  E         P+  P +++G K 
Sbjct: 138 EYNRLRPLSYTDVDILMVCYSVDSKTSFYNVQELWFPE----VKHFCPDA-PVMLVGLKS 192

Query: 128 D---VEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSAL 176
           D   ++  ++LV PK A  LA  LG       SAKS  NVD  F     +AL
Sbjct: 193 DLYALDNLEQLVDPKDADTLAQQLGAFAHVQCSAKSRDNVDEVFNLAMTTAL 244

>Suva_11.289 Chr11 (531935..532810) [876 bp, 291 aa] {ON} YKR055W
           (REAL)
          Length = 291

 Score = 84.3 bits (207), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 86/172 (50%), Gaps = 9/172 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
           LK++++GD  VGKT L+  YV   +   Y  TI  +++T       +V  + +WDTAGQE
Sbjct: 73  LKIVVVGDGAVGKTCLLISYVQGTFPTDYIPTIFENYVTNIEGPKGQVVELALWDTAGQE 132

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIK-TWKDEFLVHANVSSPETFPFVILGNKV 127
            +  L    Y  AD  ++ Y V +  S  N++  W  E + H   S+    P +++G K 
Sbjct: 133 EYSRLRPLSYTNADVLMICYSVGSKTSLRNVEDLWFPE-VKHFCPSA----PIMLVGLKS 187

Query: 128 DVEES---KKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSAL 176
           D+ E+    +LV PKAA  LA  LG       SA+   NV+  FE    + L
Sbjct: 188 DLYEADDLSELVDPKAADSLAQRLGAFTHLQCSARLKDNVNEVFETAIHTLL 239

>YGR152C Chr7 complement(794674..795492) [819 bp, 272 aa] {ON}
           RSR1GTP-binding protein of the ras superfamily required
           for bud site selection, morphological changes in
           response to mating pheromone, and efficient cell fusion;
           localized to the plasma membrane; significantly similar
           to mammalian Rap GTPases
          Length = 272

 Score = 84.0 bits (206), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 93/168 (55%), Gaps = 5/168 (2%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K+++LG  GVGK+ L  ++V   Y   Y  TI  D   K + +D+KV  +++ DTAG  +
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTI-EDSYRKTIEIDNKVFDLEILDTAGIAQ 63

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           F ++   + +     +LVY VT+ +S E +   +++ L    +   +  P V++GNK D+
Sbjct: 64  FTAMRELYIKSGMGFLLVYSVTDRQSLEELMELREQVL---RIKDSDRVPMVLIGNKADL 120

Query: 130 EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQ 177
             ++++++ +   E+++  G +P + TSA    NVD  F ++ R  ++
Sbjct: 121 -INERVISVEEGIEVSSKWGRVPFYETSALLRSNVDEVFVDLVRQIIR 167

>Kpol_1029.8 s1029 complement(15899..16816) [918 bp, 305 aa] {ON}
           complement(15899..16816) [918 nt, 306 aa]
          Length = 305

 Score = 84.7 bits (208), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 84/153 (54%), Gaps = 6/153 (3%)

Query: 21  KTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQERFQSLGVAFYRG 80
           K++L  + +  ++  +Y  TI  D   K++ +DD VA + + DTAGQE + ++   + R 
Sbjct: 23  KSALTIQLIQSQFVDEYDPTI-EDSYRKQIVLDDSVAILDILDTAGQEEYSAMREQYMRT 81

Query: 81  ADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDVEESKKLVTPKA 140
            +  +LVY VT+  S+E + ++  +      V   E  P V++GNK D+ E+++ V+ + 
Sbjct: 82  GEGFLLVYSVTSRNSYEELMSYYQQI---QRVKDTEYIPVVVVGNKSDL-ETERQVSYEE 137

Query: 141 AQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
              LA  + N P   TSAK  INV  AF  +AR
Sbjct: 138 GMSLAKQM-NAPFLETSAKQDINVQDAFYNLAR 169

>SAKL0E10252g Chr5 (855721..855735,855900..856691) [807 bp, 268 aa]
           {ON} similar to uniprot|P01119 Saccharomyces cerevisiae
           YOR101W RAS1 GTPase involved in G-protein signaling in
           the adenylate cyclase activating pathway, plays a role
           in cell proliferation; localized to the plasma membrane;
           homolog of mammalian RAS proto-oncogenes
          Length = 268

 Score = 84.0 bits (206), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 59/176 (33%), Positives = 100/176 (56%), Gaps = 9/176 (5%)

Query: 1   MSFRKKNIL---KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVA 57
           MS+ K N +   K++++G  GVGK++L  + +   +  +Y  TI  D   K+V +D+ V+
Sbjct: 1   MSYNKNNNIREYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTI-EDSYRKQVVIDNHVS 59

Query: 58  TMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPET 117
            + + DTAGQE + ++   + R  +  +LVY VT+  SFE + T+  + L    V   + 
Sbjct: 60  ILDILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFEELMTYYQQIL---RVKDVDY 116

Query: 118 FPFVILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
            P +++GNK D+ ES++ V+ +   ++A    N P   TSAK AINV+ AF  + R
Sbjct: 117 VPVLVVGNKSDL-ESERQVSYEEGAKMAKQF-NAPFLETSAKQAINVEEAFYGLVR 170

>TPHA0P00920 Chr16 complement(185904..186470) [567 bp, 188 aa] {ON}
           Anc_2.200 YNL090W
          Length = 188

 Score = 82.0 bits (201), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 95/173 (54%), Gaps = 12/173 (6%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++I+GD   GKTSL++++   K+ +QY  T+  +++T +  VD    ++ +WDTAGQE 
Sbjct: 8   KLVIIGDGACGKTSLLYKFTLGKFPEQYHPTVFENYVT-DCFVDGIKVSLTLWDTAGQEE 66

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKT-WKDEFLVHANVSSPETFPFVILGNKVD 128
           ++ L    Y  AD  ++ + V + +S  N +T W +E L +     P+T   +++G K D
Sbjct: 67  YERLRPFSYSKADIILIGFAVDDVESLHNARTKWTEEVLRYC----PDT-KIILVGLKSD 121

Query: 129 VEESKK-----LVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSAL 176
           + ++ +      V  + A+++A  +G       SA +   VDT FE   R++L
Sbjct: 122 LRKTAQDYEEGFVKREDAEQVARQIGAKKYLECSALTGQGVDTVFELATRTSL 174

>Suva_8.155 Chr8 (272370..273320) [951 bp, 316 aa] {ON} YOR101W
           (REAL)
          Length = 316

 Score = 84.3 bits (207), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 52/153 (33%), Positives = 85/153 (55%), Gaps = 6/153 (3%)

Query: 21  KTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQERFQSLGVAFYRG 80
           K++L  + +   +  +Y  TI  D   K+V +DDKV+ + + DTAGQE + ++   + R 
Sbjct: 23  KSALTIQLIQSYFVDEYDPTI-EDSYRKQVVIDDKVSILDILDTAGQEEYSAMREQYMRT 81

Query: 81  ADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDVEESKKLVTPKA 140
            +  +LVY VT+  SF+ + ++  +      V   +  P V++GNK+D+E  ++ V+ + 
Sbjct: 82  GEGFLLVYSVTSRNSFDELLSYYQQI---QRVKDSDYIPVVVVGNKLDLENERQ-VSYED 137

Query: 141 AQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
              LA  L N P   TSAK AINVD AF  + R
Sbjct: 138 GLRLAKQL-NAPFLETSAKQAINVDEAFYGLIR 169

>KLLA0C13387g Chr3 complement(1142002..1142841,1143162..1143176)
           [855 bp, 284 aa] {ON} similar to uniprot|P01120
           Saccharomyces cerevisiae YNL098C RAS2 GTP-binding
           protein that regulates the nitrogen starvation response,
           sporulation, and filamentous growth; farnesylation and
           palmitoylation required for activity and localization to
           plasma membrane; homolog of mammalian Ras
           proto-oncogenes
          Length = 284

 Score = 83.6 bits (205), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 59/175 (33%), Positives = 97/175 (55%), Gaps = 8/175 (4%)

Query: 1   MSFRKKNI--LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVAT 58
           MS  K NI   K++++G  GVGK++L  + +   +  +Y  TI  D   K+  +DDKV+ 
Sbjct: 1   MSLNKSNIREYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTI-EDSYRKQAVIDDKVSI 59

Query: 59  MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETF 118
           + + DTAGQE + ++   + R  +  +LVY VT+  SFE + T+  + L    V   +  
Sbjct: 60  LDILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSKTSFEELMTYYQQIL---RVKDSDYV 116

Query: 119 PFVILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           P  ++GNK D+E+ ++ V+ +  Q LA    + P   TSAK  INV+ +F  + R
Sbjct: 117 PVFVIGNKSDLEDERQ-VSYEEGQTLAKQF-DAPFLETSAKQNINVEESFYGLVR 169

>ACL087C Chr3 complement(191573..192136) [564 bp, 187 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL090W
           (RHO2)
          Length = 187

 Score = 81.6 bits (200), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 89/174 (51%), Gaps = 8/174 (4%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++I+GD   GKTSL+H +   K+ ++Y  T+  +++T +  VD     + +WDTAGQE 
Sbjct: 9   KLVIIGDGACGKTSLLHVFTLGKFPEEYLPTVFENYVT-DCRVDGIKVQLALWDTAGQEE 67

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           ++ L    Y  AD  ++ + + +  S  N    ++++ V A    P   P +++G K D+
Sbjct: 68  YERLRPMSYSKADIILIGFAIDDPGSLSNA---REKWTVEALRYCPNA-PIILVGLKKDL 123

Query: 130 EESK---KLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQNQ 180
                   +V P  AQE+  ++G       SA +   VD  FE   R++L  N+
Sbjct: 124 RRPGTQCAMVAPSQAQEVVRAIGAKKYMECSALTGEGVDDVFELATRTSLLVNK 177

>YNL090W Chr14 (456565..457143) [579 bp, 192 aa] {ON}
           RHO2Non-essential small GTPase of the Rho/Rac subfamily
           of Ras-like proteins, involved in the establishment of
           cell polarity and in microtubule assembly
          Length = 192

 Score = 81.6 bits (200), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 95/176 (53%), Gaps = 15/176 (8%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++I+GD   GKTSL++ +   K+ +QY  T+  +++T +  VD    ++ +WDTAGQE 
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYVT-DCRVDGIKVSLTLWDTAGQEE 67

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKT-WKDEFLVHANVSSPETFPFVILGNKVD 128
           ++ L    Y  AD  ++ + V N +S  N +T W DE L +     P+  P V++G K D
Sbjct: 68  YERLRPFSYSKADIILIGFAVDNFESLINARTKWADEALRYC----PDA-PIVLVGLKKD 122

Query: 129 VEE--------SKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSAL 176
           + +        + ++V  + A+++A ++G       SA +   VD  FE   R++L
Sbjct: 123 LRQEAHFKENATDEMVPIEDAKQVARAIGAKKYMECSALTGEGVDDVFEVATRTSL 178

>NCAS0A01890 Chr1 complement(364746..365561) [816 bp, 271 aa] {ON}
           Anc_4.73
          Length = 271

 Score = 83.2 bits (204), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 92/168 (54%), Gaps = 5/168 (2%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K+++LG  GVGK+ L  ++V   Y   Y  TI  D   K + +D+KV  +++ DTAG  +
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGIYLDTYDPTI-EDSYRKTIEIDNKVFDLEILDTAGVAQ 63

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           F ++   + +     +LVY VT+ +S + +   +++ L    +   +  P V++GNK D+
Sbjct: 64  FTAMRELYIKSGMGFLLVYSVTDPQSLDELMELREQVL---RIKDTDRVPMVLVGNKADL 120

Query: 130 EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQ 177
            E  ++++ +   E+++  G +P + TSA    NVD  F ++ R  ++
Sbjct: 121 TED-RVISVEEGIEVSSKWGKVPFYETSALLRSNVDEVFVDLVRQIIR 167

>AFR464W Chr6 (1274600..1275394) [795 bp, 264 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR152C (RSR1)
          Length = 264

 Score = 83.2 bits (204), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 92/168 (54%), Gaps = 5/168 (2%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K+++LG  GVGK+ L  ++V  +Y   Y  TI  D   K + +DDK   +++ DTAG  +
Sbjct: 5   KLVVLGAGGVGKSCLTVQFVQGEYLDTYDPTI-EDSYRKSMEIDDKAFDLEILDTAGVAQ 63

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDV 129
           F ++   + +     +LVY VT+ +S   +   +++ L    +   +  P V++GNK D+
Sbjct: 64  FTAMRELYIKSGMGFLLVYSVTDRQSLAELMELREQIL---RIKDSKRVPMVLVGNKADL 120

Query: 130 EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQ 177
            ++++ ++ +   ++++  G +P + TSA    NVD  F ++ R  ++
Sbjct: 121 -QNERAISVEEGIDVSSRWGKVPFYETSALLKSNVDEVFIDLVRQIMR 167

>Skud_14.232 Chr14 complement(429739..430710) [972 bp, 323 aa] {ON}
           YNL098C (REAL)
          Length = 323

 Score = 84.0 bits (206), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 84/153 (54%), Gaps = 6/153 (3%)

Query: 21  KTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQERFQSLGVAFYRG 80
           K++L  +     +  +Y  TI  D   K+V +DD+V+ + + DTAGQE + ++   + R 
Sbjct: 23  KSALTIQLTQSHFVDEYDPTI-EDSYRKQVVIDDEVSILDILDTAGQEEYSAMREQYMRN 81

Query: 81  ADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDVEESKKLVTPKA 140
            +  +LVY +T+  S + + T+  + L    V   +  P V++GNK D+E  K+ V+ + 
Sbjct: 82  GEGFLLVYSITSKSSLDELMTYYQQIL---RVKDTDYVPIVVVGNKSDLENEKQ-VSYQD 137

Query: 141 AQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
              +A  + N P   TSAK AINV+ AF  +AR
Sbjct: 138 GLNMAKQM-NAPFLETSAKQAINVEEAFYTLAR 169

>YNL098C Chr14 complement(439602..440570) [969 bp, 322 aa] {ON}
           RAS2GTP-binding protein that regulates the nitrogen
           starvation response, sporulation, and filamentous
           growth; farnesylation and palmitoylation required for
           activity and localization to plasma membrane; homolog of
           mammalian Ras proto-oncogenes
          Length = 322

 Score = 84.0 bits (206), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 84/153 (54%), Gaps = 6/153 (3%)

Query: 21  KTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQERFQSLGVAFYRG 80
           K++L  +     +  +Y  TI  D   K+V +DD+V+ + + DTAGQE + ++   + R 
Sbjct: 23  KSALTIQLTQSHFVDEYDPTI-EDSYRKQVVIDDEVSILDILDTAGQEEYSAMREQYMRN 81

Query: 81  ADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDVEESKKLVTPKA 140
            +  +LVY +T+  S + + T+  + L    V   +  P V++GNK D+E  K+ V+ + 
Sbjct: 82  GEGFLLVYSITSKSSLDELMTYYQQIL---RVKDTDYVPIVVVGNKSDLENEKQ-VSYQD 137

Query: 141 AQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
              +A  + N P   TSAK AINV+ AF  +AR
Sbjct: 138 GLNMAKQM-NAPFLETSAKQAINVEEAFYTLAR 169

>Kwal_26.8387 s26 (763564..764442) [879 bp, 292 aa] {ON} YNL098C
           (RAS2) - Small, GTP-binding protein [contig 60] FULL
          Length = 292

 Score = 83.6 bits (205), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/156 (32%), Positives = 84/156 (53%), Gaps = 12/156 (7%)

Query: 21  KTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQERFQSLGVAFYRG 80
           K++L  + +   +  +Y  TI  D   K+V +DDKV+ + + DTAGQE + ++   + R 
Sbjct: 29  KSALTIQLIQSHFVDEYDPTI-EDSYRKQVVIDDKVSILDILDTAGQEEYSAMREQYMRT 87

Query: 81  ADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDVEESKKLVTPKA 140
            +  +LVY VT+  SF+ + T+  + L    V   +  P  ++GNK D+E+ +++     
Sbjct: 88  GEGFLLVYSVTSRTSFDELMTYYQQIL---RVKDADYVPVFLVGNKSDLEDERQV----- 139

Query: 141 AQELATSLG---NIPLFLTSAKSAINVDTAFEEIAR 173
           A E   SL    N P   TSAK AINV+ +F  + R
Sbjct: 140 AYEEGVSLAKQFNAPFMETSAKQAINVEDSFYGLVR 175

>TBLA0B01750 Chr2 complement(392769..393890) [1122 bp, 373 aa] {ON}
           Anc_2.182 YNL098C
          Length = 373

 Score = 84.3 bits (207), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 95/175 (54%), Gaps = 8/175 (4%)

Query: 1   MSFRKKNI--LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVAT 58
           M   K NI   K++++G  GVGK++L  R +   +  +Y  TI  D   K+V +DDKV  
Sbjct: 1   MPLNKSNIREYKLVVVGGGGVGKSALTIRLIQSHFVDEYDPTI-EDSYRKQVVIDDKVTI 59

Query: 59  MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETF 118
           + + DTAGQE + ++   + R  +  +LVY VT+  SFE +  +  +      V   +  
Sbjct: 60  LDILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRNSFEELMNYYQQI---QRVKDTDYV 116

Query: 119 PFVILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           P +++GNK D+E  ++ VT +    +A  + N P   TSAK AINV+ AF  + R
Sbjct: 117 PIMVVGNKSDLEIERQ-VTFEEGMTMAKQM-NSPFLETSAKEAINVEDAFYNLVR 169

>Smik_14.237 Chr14 (436872..437450) [579 bp, 192 aa] {ON} YNL090W
           (REAL)
          Length = 192

 Score = 81.3 bits (199), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 94/176 (53%), Gaps = 15/176 (8%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++I+GD   GKTSL++ +   K+ +QY  T+  +++T +  VD    ++ +WDTAGQE 
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYVT-DCRVDGIKVSLTLWDTAGQEE 67

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKT-WKDEFLVHANVSSPETFPFVILGNKVD 128
           ++ L    Y  AD  ++ + V N +S  N +T W DE L +     P+  P V++G K D
Sbjct: 68  YERLRPFSYSKADIILIGFAVDNFESLINARTKWADEALRYC----PDA-PIVLVGLKKD 122

Query: 129 VEESK--------KLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSAL 176
           + +          ++V    A+++A+++G       SA +   VD  FE   R++L
Sbjct: 123 LRQEAHFKEDAVDEMVPIDDAKQVASAIGAKKYMECSALTGEGVDDVFEVATRTSL 178

>Skud_11.291 Chr11 (529726..530601) [876 bp, 291 aa] {ON} YKR055W
           (REAL)
          Length = 291

 Score = 83.2 bits (204), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 56/171 (32%), Positives = 81/171 (47%), Gaps = 7/171 (4%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
           LK++++GD  VGKT L+  YV   +   Y  TI  +++T       +V  + +WDTAGQE
Sbjct: 73  LKIVVVGDGAVGKTCLLISYVQGTFPTDYIPTIFENYVTNIEGPRGQVIELALWDTAGQE 132

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVD 128
            +  L    Y  AD  ++ Y V N  S  N    +D +        P T P +++G K D
Sbjct: 133 EYSRLRPLSYTNADVLMICYSVGNKTSLRNA---EDLWFPEVKHFCPST-PIMLVGLKSD 188

Query: 129 VEES---KKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSAL 176
           + E+     LV P  A+ LA  LG       SA+   NV+  FE    S L
Sbjct: 189 LYEADNLSDLVEPTVAESLAKRLGAFSHVQCSARLKENVNEVFETAIHSLL 239

>KNAG0C01260 Chr3 complement(243934..244833) [900 bp, 299 aa] {ON}
           Anc_1.215 YKR055W
          Length = 299

 Score = 83.2 bits (204), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 84/165 (50%), Gaps = 9/165 (5%)

Query: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQE 68
           LK++++GD  VGKTSL+  YV   +  +Y  T+  +++T      DK   + +WDTAGQE
Sbjct: 82  LKIVVVGDGTVGKTSLLMSYVQKTFPTEYVPTVFENYVTTIEGPQDKCIELALWDTAGQE 141

Query: 69  RFQSLGVAFYRGADCCVLVYDVTNNKSFENIK-TWKDEFLVHANVSSPETFPFVILGNKV 127
            +  L    Y   D  ++ Y V N  SF+N +  W  E + H    +P+    +++G K 
Sbjct: 142 EYNRLRPLSYTNVDILMICYAVDNRNSFKNAEDIWYPE-VKHFCSGTPK----ILVGLKS 196

Query: 128 DV---EESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFE 169
           D+   E   ++V PK    LA  +G +     SAK   N+D  F+
Sbjct: 197 DLYAGEHINEMVEPKEGDLLAEKIGAVLHLQCSAKLRDNIDELFD 241

>Smik_14.227 Chr14 complement(419257..420225) [969 bp, 322 aa] {ON}
           YNL098C (REAL)
          Length = 322

 Score = 83.2 bits (204), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 84/153 (54%), Gaps = 6/153 (3%)

Query: 21  KTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQERFQSLGVAFYRG 80
           K++L  +     +  +Y  TI  D   K+V +DD+V+ + + DTAGQE + ++   + R 
Sbjct: 23  KSALTIQLTQSHFVDEYDPTI-EDSYRKQVVIDDEVSILDILDTAGQEEYSAMREQYMRN 81

Query: 81  ADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETFPFVILGNKVDVEESKKLVTPKA 140
            +  +LVY +T+  S + + T+  + L    V   +  P V++GNK D+E  K+ V+ + 
Sbjct: 82  GEGFLLVYSITSKSSLDELMTYYQQIL---RVKDTDYVPIVVVGNKSDLENEKQ-VSYQD 137

Query: 141 AQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
              +A  + N P   TSAK AINV+ AF  +AR
Sbjct: 138 GLNMAKQM-NAPFLETSAKQAINVEEAFYTLAR 169

>Suva_14.241 Chr14 complement(437053..438021) [969 bp, 322 aa] {ON}
           YNL098C (REAL)
          Length = 322

 Score = 83.2 bits (204), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 59/175 (33%), Positives = 97/175 (55%), Gaps = 8/175 (4%)

Query: 1   MSFRKKNI--LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVAT 58
           M   K NI   K++++G  GVGK++L  +     +  +Y  TI  D   K+V +DD+V+ 
Sbjct: 1   MPLNKSNIREYKLVVVGGGGVGKSALTIQLTQSHFVDEYDPTI-EDSYRKQVVIDDEVSI 59

Query: 59  MQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNNKSFENIKTWKDEFLVHANVSSPETF 118
           + + DTAGQE + ++   + R  +  +LVY +T+  S + + T+  + L    V   +  
Sbjct: 60  LDILDTAGQEEYSAMREQYMRNGEGFLLVYSITSKSSLDELMTYYQQIL---RVKDTDYV 116

Query: 119 PFVILGNKVDVEESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIAR 173
           P V++GNK D+E  K+ V+ +    +A  + N P   TSAK AINV+ AF  +AR
Sbjct: 117 PIVVVGNKSDLENEKQ-VSYQDGLNMAKQM-NAPFLETSAKQAINVEEAFYTLAR 169

>Kpol_1029.18 s1029 (37197..37763) [567 bp, 188 aa] {ON}
           (37197..37763) [567 nt, 189 aa]
          Length = 188

 Score = 80.9 bits (198), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 94/176 (53%), Gaps = 11/176 (6%)

Query: 10  KVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDDKVATMQVWDTAGQER 69
           K++I+GD   GKTSL++ +   K+ ++Y  T+  +++T +  VD    ++ +WDTAGQE 
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPEKYHPTVFENYVT-DCIVDGIKVSLTLWDTAGQEE 67

Query: 70  FQSLGVAFYRGADCCVLVYDVTNNKSFENIKT-WKDEFLVHANVSSPETFPFVILGNKVD 128
           ++ L    Y  AD  ++ + + + +S  N +T W +E L +     P+  P +++G K D
Sbjct: 68  YERLRPFSYSKADIILIGFAINDTESLYNARTKWSEESLRYC----PDA-PIILVGLKKD 122

Query: 129 VE----ESKKLVTPKAAQELATSLGNIPLFLTSAKSAINVDTAFEEIARSALQQNQ 180
           +     +   LV  + A+ +A  +G       SA +   VD+ FE   R++L  N+
Sbjct: 123 LRNNNTDGDDLVRSEDAETVARQIGAKKYLECSALTGEGVDSVFELATRTSLLVNK 178

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.131    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,817,855
Number of extensions: 787188
Number of successful extensions: 4413
Number of sequences better than 10.0: 618
Number of HSP's gapped: 3848
Number of HSP's successfully gapped: 638
Length of query: 207
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 103
Effective length of database: 41,556,135
Effective search space: 4280281905
Effective search space used: 4280281905
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)